Jump to content

All Activity

This stream auto-updates     

  1. Last week
  2. On 14 February 2018, the National Health and Family Planning Commission (NHFPC) of China notified the World Health Organization (WHO) of one case of human infection with avian influenza A(H7N4) virus. This is the first human case of avian influenza A(H7N4) infection to be reported worldwide. View the full article
  3. Lassa fever – Liberia

    On 9 January 2018, a patient from Guinea with fever, neck pain, body pain and vomiting was admitted to a hospital in Ganta in Nimba County, Liberia. The patient was treated with Ribavirin until her death on 11 January 2018. The patient first experienced symptoms on 29 December 2017. Prior to hospitalization in Liberia, she sought medical care at a health facility in Diécké in N'Zérékore Region, Guinea where she was treated for typhoid and malaria. View the full article
  4. Cholera – Mozambique

    On 27 October 2017, the Ministry of Health in Mozambique notified WHO of an outbreak of cholera. From 14 August 2017 through 11 February 2018, 1799 cases and one death (case fatality rate = 0.06%) of cholera were reported from the two provinces; Nampula (1580 cases) and Cabo Delgado (219 cases). Underreporting of the number of cases and deaths is likely. This outbreak has been confirmed by Rapid Diagnostic Tests and culture. View the full article
  5. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176518 A/chicken/Israel/881/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1159825 A/Cygnus atratus/Hubei/HF-1/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI1159817 A/Cygnus atratus/Hubei/2Z2-O/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1006681 A/common teal/Korea/W549/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1006680 A/common teal/Korea/W547/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI858836 A/duck/India/10CA01/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836614 A/common tern /Uvs-Nuur Lake/26/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836606 A/grey heron /Uvs-Nuur Lake/20/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774394 A/Bar-headed Goose/Qinghai/BTY17-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774386 A/Bar-headed Goose/Qinghai/BTY17-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774310 A/Bar-headed Goose/Qinghai/BTY12-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774242 A/Bar-headed Goose/Qinghai/BTY8-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774234 A/Bar-headed Goose/Qinghai/BTY8-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774121 A/Bar-headed Goose/Qinghai/BTY1-LV/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774113 A/Bar-headed Goose/Qinghai/BTY1-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1176519 A/chicken/Israel/1048/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006705 A/common teal/Korea/W555/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006704 A/common teal/Korea/W550/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006703 A/common teal/Korea/W548/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774475 A/Brown-headed Gull/Qinghai/ZTO5-K/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774458 A/Brown-headed Gull/Qinghai/ZTO4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774450 A/Brown-headed Gull/Qinghai/ZTO3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774402 A/Bar-headed Goose/Qinghai/BTY18-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774378 A/Bar-headed Goose/Qinghai/BTY16-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774326 A/Bar-headed Goose/Qinghai/BTY13-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774318 A/Bar-headed Goose/Qinghai/BTY13-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774302 A/Bar-headed Goose/Qinghai/BTY12-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774277 A/Bar-headed Goose/Qinghai/BTY10-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774267 A/Bar-headed Goose/Qinghai/BTY10-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774259 A/Bar-headed Goose/Qinghai/BTY9-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774251 A/Bar-headed Goose/Qinghai/BTY9-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774226 A/Bar-headed Goose/Qinghai/BTY7-LU2/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774218 A/Bar-headed Goose/Qinghai/BTY7-LU1/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774210 A/Bar-headed Goose/Qinghai/BTY7-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774201 A/Bar-headed Goose/Qinghai/BTY6-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774193 A/Bar-headed Goose/Qinghai/BTY6-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774185 A/Bar-headed Goose/Qinghai/BTY5-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774176 A/Bar-headed Goose/Qinghai/BTY4-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774168 A/Bar-headed Goose/Qinghai/BTY4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774159 A/Bar-headed Goose/Qinghai/BTY3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774150 A/Bar-headed Goose/Qinghai/BTY3-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 3068.4 0.000000e+00 1689/1704 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1704 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1704 (99%) EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
  6. LOCUS MF166575 1717 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/chicken/Israel/881/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166575 VERSION MF166575.1 KEYWORDS . SOURCE Influenza A virus (A/chicken/Israel/881/2016(H5N8)) ORGANISM Influenza A virus (A/chicken/Israel/881/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1717) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1717) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1717 /organism="Influenza A virus (A/chicken/Israel/881/2016(H5N8))" /mol_type="viral cRNA" /strain="A/chicken/Israel/881/2016" /serotype="H5N8" /host="chicken" /db_xref="taxon:2005432" /segment="4" /country="Israel" /collection_date="07-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45891.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSDGSLQCRVC V" sig_peptide 1..48 /gene="HA" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga aacctctgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaac 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagctc ttggcccaat 421 catgaaacat cattaggggt gagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggcttat caaaaagaac gatgcatatc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggga ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg aagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg gggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg agttctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc cgatgggtcg 1681 ttacagtgca gagtttgcgt ttaaatttgt gagatca
  7. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176529 A/grey goose/Israel/986/2016 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1629/1629 (100%) EPI1176519 A/chicken/Israel/1048/2016 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1626/1629 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1621/1630 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI1021132 A/goose/Czech Republic/1954-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI964917 A/chicken/Czech Republic/206-17_2/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI887468 A/chicken/Czech Republic/206-17_2/2017(H5N8) (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI859207 A/domestic_turkey/Hungary/53433/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032484 A/Goose/Hungary/15729/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032476 A/Goose/Hungary/17261/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1021135 A/quail/Czech Republic/2063-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI978863 A/grey heron/Germany-TH/R1125/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI962066 A/Turkey/Hungary/53136/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI962046 A/Duck/Hungary/54738/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI959539 A/Mute swan/Hungary/6276/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI959531 A/Mute swan/Hungary/6092/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI954655 A/Duck/Hungary/984/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI954639 A/Harris Hawk/Hungary/120/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI952782 A/mallard duck/Korea/WA137/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI952639 A/chicken/Korea/H903/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI930838 A/mute swan/Czech Republic/54-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI919636 A/chicken/Czech Republic/585-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI891670 A/greylag goose/Croatia/33/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI881901 A/mute swan/Croatia/15/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI869929 A/mute swan/Poland/108/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI866978 A/duck/Hungary/60441/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI861572 A/mute swan/Croatia/78/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 2946.5 0.000000e+00 1614/1624 (99%) EPI1021086 A/mute swan/Czech Republic/54-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2944.7 0.000000e+00 1617/1629 (99%) EPI869926 A/domestic goose/Poland/72/2016 (A/H5N8) segment 4 (HA) 2944.7 0.000000e+00 1617/1629 (99%) EPI1176530 A/peregrine falcon/Israel/1086/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1169885 A/chicken/Republic of Macedonia/466/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1605/1611 (99%) EPI1081894 A/turkey/Czech Republic/38-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032548 A/Goose/Hungary/64909/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032540 A/Goose/Hungary/63743/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032516 A/Goose/Hungary/59763/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032500 A/Goose/Hungary/17580/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021139 A/mallard/Czech Republic/2641-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021126 A/mute swan/Czech Republic/1691-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021125 A/mallard/Czech Republic/1690-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021103 A/mallard/Czech Republic/1219-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021098 A/mute swan/Czech Republic/1155-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021097 A/mute swan/Czech Republic/1060-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021088 A/mallard/Czech Republic/136-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021087 A/goose/Czech Republic/136-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI987882 A/chicken/Republic of Macedonia/AR1167-L02131/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI969265 A/chicken/Czech Republic/2644-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI961484 A/mute swan/Czech Republic/581-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI961475 A/mute swan/Czech Republic/499-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI959555 A/Pheasant/Hungary/7685/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%)
  8. LOCUS MF166581 1629 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/grey goose/Israel/986/2016(H5N8)) segment 4 hemagglutinin (HA) gene, partial cds. ACCESSION MF166581 VERSION MF166581.1 KEYWORDS . SOURCE Influenza A virus (A/grey goose/Israel/986/2016(H5N8)) ORGANISM Influenza A virus (A/grey goose/Israel/986/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1629) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1629) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (29-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1629 /organism="Influenza A virus (A/grey goose/Israel/986/2016(H5N8))" /mol_type="viral cRNA" /strain="A/grey goose/Israel/986/2016" /serotype="H5N8" /host="grey goose" /db_xref="taxon:2005436" /segment="4" /country="Israel" /collection_date="12-Dec-2016" /note="passage details: E1" gene <1..1611 /gene="HA" CDS <1..1611 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45897.1" /translation="VDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILKDCSVAG WLLGNPMCDEFIRVPEWSYIVERANPANDLCYPGSLNDYEELKHLLSRINHFEKILII PKSSWPNHETSLGVSAACPYQGTPSFFRNVVWLIKKNDAYPTIKISYNNTNREDLLIL WGIHHSNNAEEQTNLYKNPTTYISVGTSTLNQRLVPKIATRSQVNGQRGRMDFFWTIL KPNDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSEVEYGHCNTKCQTPVGAINSSMPF HNIHPLTIGECPKYVKSNKLVLATGLRNSPLREKRRKRGLFGAIAGFIEGGWQGMVDG WYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIE NLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNG CFEFYHKCDNECMESVRNGTYDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVA SSLALAIMVAGLSLWMCSNGSLQCRICI" mat_peptide <1..942 /gene="HA" /product="HA1" mat_peptide 943..1608 /gene="HA" /product="HA2" ORIGIN 1 gttgacacga taatggaaaa gaacgtcact gttacacatg cccaagacat actggaaaaa 61 acacacaacg ggaagctctg cgatctaaat ggggtgaaac ctctgatttt aaaggattgt 121 agtgtagctg gatggctcct cggaaaccca atgtgcgacg aattcatcag agtgccggaa 181 tggtcttaca tagtggagag ggctaacccc gctaatgacc tctgttaccc agggagcctc 241 aatgactatg aagaactgaa acacctgttg agcagaataa atcattttga gaagattctg 301 atcatcccca agagttcttg gcccaatcat gaaacatcat taggggtgag cgcagcttgt 361 ccataccagg gaacgccctc ctttttcaga aatgtggtat ggcttatcaa aaagaacgat 421 gcatacccaa caataaagat aagctacaat aataccaatc gggaagatct cttgatactg 481 tgggggattc atcattccaa caatgcagaa gagcagacaa atctctataa aaacccaacc 541 acctatattt cggttggaac atcaacatta aaccagagat tggtaccaaa aatagctact 601 agatcccaag taaacgggca acgtggaaga atggacttct tctggacaat tttaaaaccg 661 aatgatgcaa tccacttcga gagtaatgga aatttcattg ctccagaata tgcatacaaa 721 attgtcaaga aaggggactc aacaattatg aaaagtgaag tggaatatgg ccactgcaac 781 accaaatgtc aaaccccagt aggagcgata aactctagta tgccattcca caatatacat 841 cctctcacca tcggggaatg ccccaaatac gtgaagtcaa acaagttggt ccttgcgact 901 gggctcagaa atagtcctct aagagaaaag agaagaaaaa gagggctgtt tggggctata 961 gcaggtttta tagagggagg atggcaggga atggttgatg gttggtatgg gtaccaccat 1021 agcaatgagc aggggagtgg gtacgctgca gacaaagaat ccacccaaaa agcaatagat 1081 ggagttacca ataaggtcaa ctcgatcatt gacaaaatga acactcaatt tgaggcagtt 1141 ggaagggagt ttaataactt agaaaggagg atagagaatt tgaacaagaa aatggaagac 1201 ggattcctag atgtctggac ctataatgct gaacttctag ttctcatgga aaacgagagg 1261 actctagatt tccatgactc aaatgtcaag aacctttacg acaaagtcag actgcagctt 1321 agggataatg caaaggagct gggtaacggt tgtttcgagt tctatcacaa atgtgataat 1381 gaatgtatgg aaagtgtgag aaatgggacg tatgactacc ctcagtattc agaagaagca 1441 agattaaaaa gagaagaaat aagcggagtg aaattagaat caataggaac ttaccaaata 1501 ctgtcaattt attcaacagt ggcgagttcc ctagcactgg caatcatggt ggctggtcta 1561 tctttatgga tgtgctccaa tgggtcgtta cagtgcagaa tttgcattta aatttgggag 1621 ctcagattg
  9. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176524 A/cormorant/Israel/1035/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176517 A/turkey/Israel/1045/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1700/1705 (99%) EPI1176528 A/great egret/Israel/1084/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1699/1705 (99%) EPI1176525 A/great egret/Israel/1088/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1698/1706 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3099.8 0.000000e+00 1696/1705 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI922508 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909428 A/turkey/Rostov-on-Don/11/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI860509 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1023562 A/Eurasian_Wigeon/Netherlands/11/2016 (A/H5N8) segment 4 (HA) 3085.0 0.000000e+00 1691/1701 (99%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1693/1705 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1693/1705 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1693/1705 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019446 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019382 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI954783 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI909420 A/chicken/Voronezh/20/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI909412 A/chicken/Voronezh/19/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI863865 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI861224 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI860393 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1691/1703 (99%) EPI1040225 A/turkey/Italy/17VIR5878-3/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
  10. LOCUS MF166572 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/cormorant/Israel/1035/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166572 VERSION MF166572.1 KEYWORDS . SOURCE Influenza A virus (A/cormorant/Israel/1035/2016(H5N8)) ORGANISM Influenza A virus (A/cormorant/Israel/1035/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/cormorant/Israel/1035/2016(H5N8))" /mol_type="viral cRNA" /strain="A/cormorant/Israel/1035/2016" /serotype="H5N8" /host="cormorant" /db_xref="taxon:2005433" /segment="4" /country="Israel" /collection_date="19-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45888.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAKEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKR DSTIMKSGVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctttgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaat 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt aagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggaa ttcatcattc caacaatgca 601 aaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaagaggga ctcaacaatt 841 atgaaaagtg gagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccgtt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg aattctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  11. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176517 A/turkey/Israel/1045/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176528 A/great egret/Israel/1084/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%) EPI1176525 A/great egret/Israel/1088/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%) EPI1176524 A/cormorant/Israel/1035/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1700/1705 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3105.3 0.000000e+00 1696/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI922508 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909428 A/turkey/Rostov-on-Don/11/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI860509 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1023562 A/Eurasian_Wigeon/Netherlands/11/2016 (A/H5N8) segment 4 (HA) 3090.6 0.000000e+00 1691/1700 (99%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019446 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019382 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI954783 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909420 A/chicken/Voronezh/20/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909412 A/chicken/Voronezh/19/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI863865 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI861224 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI860393 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1691/1702 (99%) EPI1040225 A/turkey/Italy/17VIR5878-3/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%)
  12. LOCUS MF166574 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/turkey/Israel/1045/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166574 VERSION MF166574.1 KEYWORDS . SOURCE Influenza A virus (A/turkey/Israel/1045/2016(H5N8)) ORGANISM Influenza A virus (A/turkey/Israel/1045/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/turkey/Israel/1045/2016(H5N8))" /mol_type="viral cRNA" /strain="A/turkey/Israel/1045/2016" /serotype="H5N8" /host="turkey" /db_xref="taxon:2005438" /segment="4" /country="Israel" /collection_date="20-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45890.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNNAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSGVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVFATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctttgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaat 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt aagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggctcat caaaaagaac aatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggaa ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg gagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccgtt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtctttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg aattctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  13. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176519 A/chicken/Israel/1048/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI1159825 A/Cygnus atratus/Hubei/HF-1/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1006681 A/common teal/Korea/W549/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1006680 A/common teal/Korea/W547/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836614 A/common tern /Uvs-Nuur Lake/26/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836606 A/grey heron /Uvs-Nuur Lake/20/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774394 A/Bar-headed Goose/Qinghai/BTY17-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774386 A/Bar-headed Goose/Qinghai/BTY17-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774310 A/Bar-headed Goose/Qinghai/BTY12-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774242 A/Bar-headed Goose/Qinghai/BTY8-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774234 A/Bar-headed Goose/Qinghai/BTY8-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774121 A/Bar-headed Goose/Qinghai/BTY1-LV/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774113 A/Bar-headed Goose/Qinghai/BTY1-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1176518 A/chicken/Israel/881/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1159817 A/Cygnus atratus/Hubei/2Z2-O/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006705 A/common teal/Korea/W555/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006704 A/common teal/Korea/W550/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006703 A/common teal/Korea/W548/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774475 A/Brown-headed Gull/Qinghai/ZTO5-K/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774458 A/Brown-headed Gull/Qinghai/ZTO4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774450 A/Brown-headed Gull/Qinghai/ZTO3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774402 A/Bar-headed Goose/Qinghai/BTY18-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774378 A/Bar-headed Goose/Qinghai/BTY16-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774326 A/Bar-headed Goose/Qinghai/BTY13-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774318 A/Bar-headed Goose/Qinghai/BTY13-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774302 A/Bar-headed Goose/Qinghai/BTY12-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774277 A/Bar-headed Goose/Qinghai/BTY10-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774267 A/Bar-headed Goose/Qinghai/BTY10-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774259 A/Bar-headed Goose/Qinghai/BTY9-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774251 A/Bar-headed Goose/Qinghai/BTY9-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774226 A/Bar-headed Goose/Qinghai/BTY7-LU2/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774218 A/Bar-headed Goose/Qinghai/BTY7-LU1/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774210 A/Bar-headed Goose/Qinghai/BTY7-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774201 A/Bar-headed Goose/Qinghai/BTY6-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774193 A/Bar-headed Goose/Qinghai/BTY6-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774185 A/Bar-headed Goose/Qinghai/BTY5-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774176 A/Bar-headed Goose/Qinghai/BTY4-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774168 A/Bar-headed Goose/Qinghai/BTY4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774159 A/Bar-headed Goose/Qinghai/BTY3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774150 A/Bar-headed Goose/Qinghai/BTY3-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 3068.4 0.000000e+00 1689/1704 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1704 (99%) EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032484 A/Goose/Hungary/15729/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032476 A/Goose/Hungary/17261/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1021135 A/quail/Czech Republic/2063-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1021132 A/goose/Czech Republic/1954-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI964917 A/chicken/Czech Republic/206-17_2/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI962046 A/Duck/Hungary/54738/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI961525 A/chicken/Italy/17VIR1751-3/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI961500 A/shelduck/Italy/17VIR1572-24/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI959539 A/Mute swan/Hungary/6276/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI954655 A/Duck/Hungary/984/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI954639 A/Harris Hawk/Hungary/120/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI952639 A/chicken/Korea/H903/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI930838 A/mute swan/Czech Republic/54-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI919636 A/chicken/Czech Republic/585-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI891670 A/greylag goose/Croatia/33/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI887468 A/chicken/Czech Republic/206-17_2/2017(H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI881901 A/mute swan/Croatia/15/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI869929 A/mute swan/Poland/108/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI866978 A/duck/Hungary/60441/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
  14. LOCUS MF166579 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/chicken/Israel/1048/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166579 VERSION MF166579.1 KEYWORDS . SOURCE Influenza A virus (A/chicken/Israel/1048/2016(H5N8)) ORGANISM Influenza A virus (A/chicken/Israel/1048/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/chicken/Israel/1048/2016(H5N8))" /mol_type="viral cRNA" /strain="A/chicken/Israel/1048/2016" /serotype="H5N8" /host="chicken" /db_xref="taxon:2005431" /segment="4" /country="Israel" /collection_date="20-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45895.1" /translation="MEKIVLLLAIVGLVKSDPICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttggccttg ttaaaagtga tccgatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgattta 181 aatggggtga aacctctgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaac 301 cccgctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt gagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggcttat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggga ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcggttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttttggac aattttaaaa ccgaatgatg caatccactt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg aagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaagcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg agttctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  15. http://rense2.gsradio.net/rense/special/rense_021518_hr2.mp3
  16. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176530 A/peregrine falcon/Israel/1086/2016 (A/H5N8) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%) EPI1006681 A/common teal/Korea/W549/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI1006680 A/common teal/Korea/W547/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI1006705 A/common teal/Korea/W555/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1006704 A/common teal/Korea/W550/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1006703 A/common teal/Korea/W548/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI952639 A/chicken/Korea/H903/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1034974 A/grey heron/W779/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI954567 A/turkey/Italy/17VIR538-1/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI952782 A/mallard duck/Korea/WA137/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI926613 A/domestic duck/Siberia/103/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI926605 A/domestic duck/Siberia/50K/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI925956 A/gadwall/Chany/97/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774458 A/Brown-headed Gull/Qinghai/ZTO4-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774450 A/Brown-headed Gull/Qinghai/ZTO3-LU/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774402 A/Bar-headed Goose/Qinghai/BTY18-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774378 A/Bar-headed Goose/Qinghai/BTY16-LU/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774326 A/Bar-headed Goose/Qinghai/BTY13-LU/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774318 A/Bar-headed Goose/Qinghai/BTY13-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774277 A/Bar-headed Goose/Qinghai/BTY10-LU/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774267 A/Bar-headed Goose/Qinghai/BTY10-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774226 A/Bar-headed Goose/Qinghai/BTY7-LU2/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774218 A/Bar-headed Goose/Qinghai/BTY7-LU1/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774210 A/Bar-headed Goose/Qinghai/BTY7-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774201 A/Bar-headed Goose/Qinghai/BTY6-LU/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774193 A/Bar-headed Goose/Qinghai/BTY6-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1691/1702 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1010500 A/green-winged teal/Egypt/877/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI881901 A/mute swan/Croatia/15/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI858844 A/painted stork/India/10CA03/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI836614 A/common tern /Uvs-Nuur Lake/26/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI836606 A/grey heron /Uvs-Nuur Lake/20/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774490 A/Brown-headed Gull/Qinghai/ZTO6-SP/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774483 A/Brown-headed Gull/Qinghai/ZTO6-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774434 A/Brown-headed Gull/Qinghai/ZTO1-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774410 A/Bar-headed Goose/Qinghai/BTY18-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774394 A/Bar-headed Goose/Qinghai/BTY17-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774386 A/Bar-headed Goose/Qinghai/BTY17-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774369 A/Bar-headed Goose/Qinghai/BTY16-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774335 A/Bar-headed Goose/Qinghai/BTY14-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774310 A/Bar-headed Goose/Qinghai/BTY12-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774294 A/Bar-headed Goose/Qinghai/BTY11-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774286 A/Bar-headed Goose/Qinghai/BTY11-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774242 A/Bar-headed Goose/Qinghai/BTY8-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774234 A/Bar-headed Goose/Qinghai/BTY8-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774142 A/Bar-headed Goose/Qinghai/BTY2-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774133 A/Bar-headed Goose/Qinghai/BTY2-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774121 A/Bar-headed Goose/Qinghai/BTY1-LV/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774113 A/Bar-headed Goose/Qinghai/BTY1-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1159825 A/Cygnus atratus/Hubei/HF-1/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1010489 A/green-winged teal/Egypt/871/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI964917 A/chicken/Czech Republic/206-17_2/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI887468 A/chicken/Czech Republic/206-17_2/2017(H5N8) (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774475 A/Brown-headed Gull/Qinghai/ZTO5-K/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774442 A/Brown-headed Gull/Qinghai/ZTO3-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI774352 A/Bar-headed Goose/Qinghai/BTY15-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774302 A/Bar-headed Goose/Qinghai/BTY12-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774259 A/Bar-headed Goose/Qinghai/BTY9-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774251 A/Bar-headed Goose/Qinghai/BTY9-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774185 A/Bar-headed Goose/Qinghai/BTY5-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774176 A/Bar-headed Goose/Qinghai/BTY4-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774168 A/Bar-headed Goose/Qinghai/BTY4-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774159 A/Bar-headed Goose/Qinghai/BTY3-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774150 A/Bar-headed Goose/Qinghai/BTY3-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 3073.9 0.000000e+00 1690/1704 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 3072.1 0.000000e+00 1690/1704 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032484 A/Goose/Hungary/15729/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032476 A/Goose/Hungary/17261/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1021135 A/quail/Czech Republic/2063-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
  17. LOCUS MF166578 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/turkey/Israel/1076/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166578 VERSION MF166578.1 KEYWORDS . SOURCE Influenza A virus (A/turkey/Israel/1076/2016(H5N8)) ORGANISM Influenza A virus (A/turkey/Israel/1076/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/turkey/Israel/1076/2016(H5N8))" /mol_type="viral cRNA" /strain="A/turkey/Israel/1076/2016" /serotype="H5N8" /host="tyrkey" /db_xref="taxon:2005439" /segment="4" /country="Israel" /collection_date="24-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45894.1" /translation="MEKIVLLLAIVSLVESDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NNPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHQCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttgaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctctgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaac 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt gagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggcttat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggga ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgggga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccactt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg aagtggaata tggccactgc aacaccaaat gtcaaacccc agtgggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaataatcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccat catagcaatg agcagggaag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg agttctatca ccaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  18. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176525 A/great egret/Israel/1088/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176517 A/turkey/Israel/1045/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%) EPI1176528 A/great egret/Israel/1084/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1699/1705 (99%) EPI1176524 A/cormorant/Israel/1035/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1698/1706 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1694/1705 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI922508 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1693/1706 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909428 A/turkey/Rostov-on-Don/11/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI860509 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1023562 A/Eurasian_Wigeon/Netherlands/11/2016 (A/H5N8) segment 4 (HA) 3073.9 0.000000e+00 1689/1701 (99%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 3072.1 0.000000e+00 1691/1705 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3072.1 0.000000e+00 1691/1705 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3072.1 0.000000e+00 1691/1705 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019446 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019382 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI954783 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI909420 A/chicken/Voronezh/20/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI909412 A/chicken/Voronezh/19/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI863865 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI861224 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI860393 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1703 (99%) EPI1040225 A/turkey/Italy/17VIR5878-3/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
  19. LOCUS MF166573 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/great egret/Israel/1088/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166573 VERSION MF166573.1 KEYWORDS . SOURCE Influenza A virus (A/great egret/Israel/1088/2016(H5N8)) ORGANISM Influenza A virus (A/great egret/Israel/1088/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/great egret/Israel/1088/2016(H5N8))" /mol_type="viral cRNA" /strain="A/great egret/Israel/1088/2016" /serotype="H5N8" /host="great egret" /db_xref="taxon:2005435" /segment="4" /country="Israel" /collection_date="25-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45889.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSGVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATRLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESMGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctttgat tttaaaggat tgtagtgtag ctggatggct cctcggaaat 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaat 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt aagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggaa ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg gagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccgtt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtcttggcg actaggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg aattctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatggg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  20. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176528 A/great egret/Israel/1084/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176517 A/turkey/Israel/1045/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%) EPI1176525 A/great egret/Israel/1088/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1699/1705 (99%) EPI1176524 A/cormorant/Israel/1035/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1699/1705 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3099.8 0.000000e+00 1695/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI922508 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019422 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI931145 A/duck/Czech Republic/1467-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909428 A/turkey/Rostov-on-Don/11/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI860509 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1023562 A/Eurasian_Wigeon/Netherlands/11/2016 (A/H5N8) segment 4 (HA) 3085.0 0.000000e+00 1690/1700 (99%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI1023581 A/Back-headed_Gull/Netherlands/9/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019598 A/Eur_Wig/NL-Terschelling/16015692-010/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019574 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019446 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019382 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI959460 A/Eurasian Wigeon/Netherlands/9/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954783 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI909420 A/chicken/Voronezh/20/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI909412 A/chicken/Voronezh/19/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI863865 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI861224 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%)
  21. LOCUS MF166580 1721 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/great egret/Israel/1084/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166580 VERSION MF166580.1 KEYWORDS . SOURCE Influenza A virus (A/great egret/Israel/1084/2016(H5N8)) ORGANISM Influenza A virus (A/great egret/Israel/1084/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1721) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1721) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1721 /organism="Influenza A virus (A/great egret/Israel/1084/2016(H5N8))" /mol_type="viral cRNA" /strain="A/great egret/Israel/1084/2016" /serotype="H5N8" /host="great egret" /db_xref="taxon:2005434" /segment="4" /country="Israel" /collection_date="25-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45896.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSGVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctttgat tttaaaggat tgtagtgtag ctggatggct cctcggaaat 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaat 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt aagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggaa ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg gagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt atgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg aattctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgg gagctcagat g
  22. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176530 A/peregrine falcon/Israel/1086/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%) EPI1006681 A/common teal/Korea/W549/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1006680 A/common teal/Korea/W547/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1006705 A/common teal/Korea/W555/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1006704 A/common teal/Korea/W550/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1006703 A/common teal/Korea/W548/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI952639 A/chicken/Korea/H903/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1034974 A/grey heron/W779/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954567 A/turkey/Italy/17VIR538-1/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI952782 A/mallard duck/Korea/WA137/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI926613 A/domestic duck/Siberia/103/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI926605 A/domestic duck/Siberia/50K/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI925956 A/gadwall/Chany/97/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774458 A/Brown-headed Gull/Qinghai/ZTO4-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774450 A/Brown-headed Gull/Qinghai/ZTO3-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774402 A/Bar-headed Goose/Qinghai/BTY18-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774378 A/Bar-headed Goose/Qinghai/BTY16-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774326 A/Bar-headed Goose/Qinghai/BTY13-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774318 A/Bar-headed Goose/Qinghai/BTY13-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774277 A/Bar-headed Goose/Qinghai/BTY10-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774267 A/Bar-headed Goose/Qinghai/BTY10-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774226 A/Bar-headed Goose/Qinghai/BTY7-LU2/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774218 A/Bar-headed Goose/Qinghai/BTY7-LU1/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774210 A/Bar-headed Goose/Qinghai/BTY7-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774201 A/Bar-headed Goose/Qinghai/BTY6-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774193 A/Bar-headed Goose/Qinghai/BTY6-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1010500 A/green-winged teal/Egypt/877/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI881901 A/mute swan/Croatia/15/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI858844 A/painted stork/India/10CA03/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836614 A/common tern /Uvs-Nuur Lake/26/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836606 A/grey heron /Uvs-Nuur Lake/20/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774490 A/Brown-headed Gull/Qinghai/ZTO6-SP/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774483 A/Brown-headed Gull/Qinghai/ZTO6-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774434 A/Brown-headed Gull/Qinghai/ZTO1-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774410 A/Bar-headed Goose/Qinghai/BTY18-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774394 A/Bar-headed Goose/Qinghai/BTY17-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774386 A/Bar-headed Goose/Qinghai/BTY17-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774369 A/Bar-headed Goose/Qinghai/BTY16-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774335 A/Bar-headed Goose/Qinghai/BTY14-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774310 A/Bar-headed Goose/Qinghai/BTY12-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774294 A/Bar-headed Goose/Qinghai/BTY11-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774286 A/Bar-headed Goose/Qinghai/BTY11-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774242 A/Bar-headed Goose/Qinghai/BTY8-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774234 A/Bar-headed Goose/Qinghai/BTY8-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774142 A/Bar-headed Goose/Qinghai/BTY2-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774133 A/Bar-headed Goose/Qinghai/BTY2-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774121 A/Bar-headed Goose/Qinghai/BTY1-LV/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774113 A/Bar-headed Goose/Qinghai/BTY1-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1159825 A/Cygnus atratus/Hubei/HF-1/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1010489 A/green-winged teal/Egypt/871/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI964917 A/chicken/Czech Republic/206-17_2/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI887468 A/chicken/Czech Republic/206-17_2/2017(H5N8) (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774475 A/Brown-headed Gull/Qinghai/ZTO5-K/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774442 A/Brown-headed Gull/Qinghai/ZTO3-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI774352 A/Bar-headed Goose/Qinghai/BTY15-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774302 A/Bar-headed Goose/Qinghai/BTY12-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774259 A/Bar-headed Goose/Qinghai/BTY9-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774251 A/Bar-headed Goose/Qinghai/BTY9-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774185 A/Bar-headed Goose/Qinghai/BTY5-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774176 A/Bar-headed Goose/Qinghai/BTY4-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774168 A/Bar-headed Goose/Qinghai/BTY4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774159 A/Bar-headed Goose/Qinghai/BTY3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774150 A/Bar-headed Goose/Qinghai/BTY3-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 3068.4 0.000000e+00 1689/1704 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1704 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032484 A/Goose/Hungary/15729/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032476 A/Goose/Hungary/17261/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1021135 A/quail/Czech Republic/2063-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
  23. LOCUS MF166577 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/peregrine falcon/Israel/1086/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166577 VERSION MF166577.1 KEYWORDS . SOURCE Influenza A virus (A/peregrine falcon/Israel/1086/2016(H5N8)) ORGANISM Influenza A virus (A/peregrine falcon/Israel/1086/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/peregrine falcon/Israel/1086/2016(H5N8))" /mol_type="viral cRNA" /strain="A/peregrine falcon/Israel/1086/2016" /serotype="H5N8" /host="peregrine falcon" /db_xref="taxon:2005437" /segment="4" /country="Israel" /collection_date="25-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45893.1" /translation="MEKIVLLLAIVSLVESDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NNPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHQCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttgaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctctgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaac 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt gagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggcttat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggga ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgggga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccactt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg aagtggaata tggccactgc aacaccaaat gtcaaacccc agtgggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaataatcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccat catagcaatg agcagggaag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcgata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg agttctatca ccaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  24. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3125.7 0.000000e+00 1700/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3125.7 0.000000e+00 1700/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI931145 A/duck/Czech Republic/1467-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI1176528 A/great egret/Israel/1084/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI959460 A/Eurasian Wigeon/Netherlands/9/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3105.3 0.000000e+00 1696/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954759 A/Peregrine_falcon/Hungary/4882/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1023562 A/Eurasian_Wigeon/Netherlands/11/2016 (A/H5N8) segment 4 (HA) 3101.6 0.000000e+00 1693/1700 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3099.8 0.000000e+00 1695/1704 (99%) EPI1176524 A/cormorant/Israel/1035/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3094.3 0.000000e+00 1693/1702 (99%) EPI1176517 A/turkey/Israel/1045/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1023578 A/Eurasian_Wigeon/Netherlands/23/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1686/1692 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019422 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI961449 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI942935 A/turkey/England/003778/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909428 A/turkey/Rostov-on-Don/11/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1159825 A/Cygnus atratus/Hubei/HF-1/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1023581 A/Back-headed_Gull/Netherlands/9/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019598 A/Eur_Wig/NL-Terschelling/16015692-010/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019574 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019494 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
  25. LOCUS MF166576 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/turkey/Israel/184/2017(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166576 VERSION MF166576.1 KEYWORDS . SOURCE Influenza A virus (A/turkey/Israel/184/2017(H5N8)) ORGANISM Influenza A virus (A/turkey/Israel/184/2017(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/turkey/Israel/184/2017(H5N8))" /mol_type="viral cRNA" /strain="A/turkey/Israel/184/2017" /serotype="H5N8" /host="tyrkey" /db_xref="taxon:2005440" /segment="4" /country="Israel" /collection_date="05-Feb-2017" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45892.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSGVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ttcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctctgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaat 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt gagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggcttat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggga ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaggggga ctcaacaatt 841 atgaaaagtg gagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt atgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg aattctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  26. edit Name Isolate ID Subtype Passage PB2 PB1 PA HA NP NA MP NS HE P3 Collection date edit Name Isolate ID Subtype Passage PB2 PB1 PA HA NP NA MP NS HE P3 Collection date A/turkey/Israel/184/2017 EPI_ISL_298649 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2017-02-05 A/peregrine falcon/Israel/1086/2016 EPI_ISL_298653 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-25 A/great egret/Israel/1084/2016 EPI_ISL_298651 H5N8 passage details: E1 --- --- --- 1721 --- --- --- --- --- --- 2016-12-25 A/great egret/Israel/1088/2016 EPI_ISL_298648 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-25 A/turkey/Israel/1076/2016 EPI_ISL_298650 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-24 A/chicken/Israel/1048/2016 EPI_ISL_298642 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-20 A/turkey/Israel/1045/2016 EPI_ISL_298640 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-20 A/cormorant/Israel/1035/2016 EPI_ISL_298647 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-19 A/grey goose/Israel/986/2016 EPI_ISL_298652 H5N8 passage details: E1 --- --- --- 1629 --- --- --- --- --- --- 2016-12-12 A/chicken/Israel/881/2016 EPI_ISL_298641 H5N8 passage details: E1 --- --- --- 1717 --- --- --- --- --- --- 2016-12-07
  1. Load more activity
×