Jump to content

All Activity

This stream auto-updates     

  1. Yesterday
  2. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176518 A/chicken/Israel/881/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1159825 A/Cygnus atratus/Hubei/HF-1/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI1159817 A/Cygnus atratus/Hubei/2Z2-O/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1006681 A/common teal/Korea/W549/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1006680 A/common teal/Korea/W547/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI858836 A/duck/India/10CA01/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836614 A/common tern /Uvs-Nuur Lake/26/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836606 A/grey heron /Uvs-Nuur Lake/20/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774394 A/Bar-headed Goose/Qinghai/BTY17-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774386 A/Bar-headed Goose/Qinghai/BTY17-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774310 A/Bar-headed Goose/Qinghai/BTY12-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774242 A/Bar-headed Goose/Qinghai/BTY8-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774234 A/Bar-headed Goose/Qinghai/BTY8-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774121 A/Bar-headed Goose/Qinghai/BTY1-LV/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774113 A/Bar-headed Goose/Qinghai/BTY1-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1176519 A/chicken/Israel/1048/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006705 A/common teal/Korea/W555/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006704 A/common teal/Korea/W550/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006703 A/common teal/Korea/W548/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774475 A/Brown-headed Gull/Qinghai/ZTO5-K/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774458 A/Brown-headed Gull/Qinghai/ZTO4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774450 A/Brown-headed Gull/Qinghai/ZTO3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774402 A/Bar-headed Goose/Qinghai/BTY18-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774378 A/Bar-headed Goose/Qinghai/BTY16-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774326 A/Bar-headed Goose/Qinghai/BTY13-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774318 A/Bar-headed Goose/Qinghai/BTY13-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774302 A/Bar-headed Goose/Qinghai/BTY12-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774277 A/Bar-headed Goose/Qinghai/BTY10-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774267 A/Bar-headed Goose/Qinghai/BTY10-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774259 A/Bar-headed Goose/Qinghai/BTY9-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774251 A/Bar-headed Goose/Qinghai/BTY9-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774226 A/Bar-headed Goose/Qinghai/BTY7-LU2/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774218 A/Bar-headed Goose/Qinghai/BTY7-LU1/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774210 A/Bar-headed Goose/Qinghai/BTY7-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774201 A/Bar-headed Goose/Qinghai/BTY6-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774193 A/Bar-headed Goose/Qinghai/BTY6-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774185 A/Bar-headed Goose/Qinghai/BTY5-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774176 A/Bar-headed Goose/Qinghai/BTY4-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774168 A/Bar-headed Goose/Qinghai/BTY4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774159 A/Bar-headed Goose/Qinghai/BTY3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774150 A/Bar-headed Goose/Qinghai/BTY3-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 3068.4 0.000000e+00 1689/1704 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1704 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1704 (99%) EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
  3. LOCUS MF166575 1717 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/chicken/Israel/881/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166575 VERSION MF166575.1 KEYWORDS . SOURCE Influenza A virus (A/chicken/Israel/881/2016(H5N8)) ORGANISM Influenza A virus (A/chicken/Israel/881/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1717) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1717) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1717 /organism="Influenza A virus (A/chicken/Israel/881/2016(H5N8))" /mol_type="viral cRNA" /strain="A/chicken/Israel/881/2016" /serotype="H5N8" /host="chicken" /db_xref="taxon:2005432" /segment="4" /country="Israel" /collection_date="07-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45891.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSDGSLQCRVC V" sig_peptide 1..48 /gene="HA" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga aacctctgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaac 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagctc ttggcccaat 421 catgaaacat cattaggggt gagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggcttat caaaaagaac gatgcatatc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggga ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg aagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg gggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg agttctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc cgatgggtcg 1681 ttacagtgca gagtttgcgt ttaaatttgt gagatca
  4. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176529 A/grey goose/Israel/986/2016 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1629/1629 (100%) EPI1176519 A/chicken/Israel/1048/2016 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1626/1629 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1621/1630 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI1021132 A/goose/Czech Republic/1954-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI964917 A/chicken/Czech Republic/206-17_2/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI887468 A/chicken/Czech Republic/206-17_2/2017(H5N8) (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI859207 A/domestic_turkey/Hungary/53433/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032484 A/Goose/Hungary/15729/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032476 A/Goose/Hungary/17261/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1021135 A/quail/Czech Republic/2063-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI978863 A/grey heron/Germany-TH/R1125/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI962066 A/Turkey/Hungary/53136/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI962046 A/Duck/Hungary/54738/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI959539 A/Mute swan/Hungary/6276/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI959531 A/Mute swan/Hungary/6092/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI954655 A/Duck/Hungary/984/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI954639 A/Harris Hawk/Hungary/120/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI952782 A/mallard duck/Korea/WA137/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI952639 A/chicken/Korea/H903/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI930838 A/mute swan/Czech Republic/54-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI919636 A/chicken/Czech Republic/585-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI891670 A/greylag goose/Croatia/33/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI881901 A/mute swan/Croatia/15/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI869929 A/mute swan/Poland/108/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI866978 A/duck/Hungary/60441/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI861572 A/mute swan/Croatia/78/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 2946.5 0.000000e+00 1614/1624 (99%) EPI1021086 A/mute swan/Czech Republic/54-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2944.7 0.000000e+00 1617/1629 (99%) EPI869926 A/domestic goose/Poland/72/2016 (A/H5N8) segment 4 (HA) 2944.7 0.000000e+00 1617/1629 (99%) EPI1176530 A/peregrine falcon/Israel/1086/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1169885 A/chicken/Republic of Macedonia/466/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1605/1611 (99%) EPI1081894 A/turkey/Czech Republic/38-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032548 A/Goose/Hungary/64909/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032540 A/Goose/Hungary/63743/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032516 A/Goose/Hungary/59763/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032500 A/Goose/Hungary/17580/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021139 A/mallard/Czech Republic/2641-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021126 A/mute swan/Czech Republic/1691-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021125 A/mallard/Czech Republic/1690-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021103 A/mallard/Czech Republic/1219-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021098 A/mute swan/Czech Republic/1155-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021097 A/mute swan/Czech Republic/1060-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021088 A/mallard/Czech Republic/136-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021087 A/goose/Czech Republic/136-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI987882 A/chicken/Republic of Macedonia/AR1167-L02131/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI969265 A/chicken/Czech Republic/2644-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI961484 A/mute swan/Czech Republic/581-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI961475 A/mute swan/Czech Republic/499-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI959555 A/Pheasant/Hungary/7685/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%)
  5. LOCUS MF166581 1629 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/grey goose/Israel/986/2016(H5N8)) segment 4 hemagglutinin (HA) gene, partial cds. ACCESSION MF166581 VERSION MF166581.1 KEYWORDS . SOURCE Influenza A virus (A/grey goose/Israel/986/2016(H5N8)) ORGANISM Influenza A virus (A/grey goose/Israel/986/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1629) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1629) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (29-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1629 /organism="Influenza A virus (A/grey goose/Israel/986/2016(H5N8))" /mol_type="viral cRNA" /strain="A/grey goose/Israel/986/2016" /serotype="H5N8" /host="grey goose" /db_xref="taxon:2005436" /segment="4" /country="Israel" /collection_date="12-Dec-2016" /note="passage details: E1" gene <1..1611 /gene="HA" CDS <1..1611 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45897.1" /translation="VDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILKDCSVAG WLLGNPMCDEFIRVPEWSYIVERANPANDLCYPGSLNDYEELKHLLSRINHFEKILII PKSSWPNHETSLGVSAACPYQGTPSFFRNVVWLIKKNDAYPTIKISYNNTNREDLLIL WGIHHSNNAEEQTNLYKNPTTYISVGTSTLNQRLVPKIATRSQVNGQRGRMDFFWTIL KPNDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSEVEYGHCNTKCQTPVGAINSSMPF HNIHPLTIGECPKYVKSNKLVLATGLRNSPLREKRRKRGLFGAIAGFIEGGWQGMVDG WYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIE NLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNG CFEFYHKCDNECMESVRNGTYDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVA SSLALAIMVAGLSLWMCSNGSLQCRICI" mat_peptide <1..942 /gene="HA" /product="HA1" mat_peptide 943..1608 /gene="HA" /product="HA2" ORIGIN 1 gttgacacga taatggaaaa gaacgtcact gttacacatg cccaagacat actggaaaaa 61 acacacaacg ggaagctctg cgatctaaat ggggtgaaac ctctgatttt aaaggattgt 121 agtgtagctg gatggctcct cggaaaccca atgtgcgacg aattcatcag agtgccggaa 181 tggtcttaca tagtggagag ggctaacccc gctaatgacc tctgttaccc agggagcctc 241 aatgactatg aagaactgaa acacctgttg agcagaataa atcattttga gaagattctg 301 atcatcccca agagttcttg gcccaatcat gaaacatcat taggggtgag cgcagcttgt 361 ccataccagg gaacgccctc ctttttcaga aatgtggtat ggcttatcaa aaagaacgat 421 gcatacccaa caataaagat aagctacaat aataccaatc gggaagatct cttgatactg 481 tgggggattc atcattccaa caatgcagaa gagcagacaa atctctataa aaacccaacc 541 acctatattt cggttggaac atcaacatta aaccagagat tggtaccaaa aatagctact 601 agatcccaag taaacgggca acgtggaaga atggacttct tctggacaat tttaaaaccg 661 aatgatgcaa tccacttcga gagtaatgga aatttcattg ctccagaata tgcatacaaa 721 attgtcaaga aaggggactc aacaattatg aaaagtgaag tggaatatgg ccactgcaac 781 accaaatgtc aaaccccagt aggagcgata aactctagta tgccattcca caatatacat 841 cctctcacca tcggggaatg ccccaaatac gtgaagtcaa acaagttggt ccttgcgact 901 gggctcagaa atagtcctct aagagaaaag agaagaaaaa gagggctgtt tggggctata 961 gcaggtttta tagagggagg atggcaggga atggttgatg gttggtatgg gtaccaccat 1021 agcaatgagc aggggagtgg gtacgctgca gacaaagaat ccacccaaaa agcaatagat 1081 ggagttacca ataaggtcaa ctcgatcatt gacaaaatga acactcaatt tgaggcagtt 1141 ggaagggagt ttaataactt agaaaggagg atagagaatt tgaacaagaa aatggaagac 1201 ggattcctag atgtctggac ctataatgct gaacttctag ttctcatgga aaacgagagg 1261 actctagatt tccatgactc aaatgtcaag aacctttacg acaaagtcag actgcagctt 1321 agggataatg caaaggagct gggtaacggt tgtttcgagt tctatcacaa atgtgataat 1381 gaatgtatgg aaagtgtgag aaatgggacg tatgactacc ctcagtattc agaagaagca 1441 agattaaaaa gagaagaaat aagcggagtg aaattagaat caataggaac ttaccaaata 1501 ctgtcaattt attcaacagt ggcgagttcc ctagcactgg caatcatggt ggctggtcta 1561 tctttatgga tgtgctccaa tgggtcgtta cagtgcagaa tttgcattta aatttgggag 1621 ctcagattg
  6. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176524 A/cormorant/Israel/1035/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176517 A/turkey/Israel/1045/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1700/1705 (99%) EPI1176528 A/great egret/Israel/1084/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1699/1705 (99%) EPI1176525 A/great egret/Israel/1088/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1698/1706 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3099.8 0.000000e+00 1696/1705 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI922508 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909428 A/turkey/Rostov-on-Don/11/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI860509 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1023562 A/Eurasian_Wigeon/Netherlands/11/2016 (A/H5N8) segment 4 (HA) 3085.0 0.000000e+00 1691/1701 (99%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1693/1705 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1693/1705 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1693/1705 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019446 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019382 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI954783 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI909420 A/chicken/Voronezh/20/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI909412 A/chicken/Voronezh/19/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI863865 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI861224 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI860393 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1691/1703 (99%) EPI1040225 A/turkey/Italy/17VIR5878-3/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
  7. LOCUS MF166572 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/cormorant/Israel/1035/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166572 VERSION MF166572.1 KEYWORDS . SOURCE Influenza A virus (A/cormorant/Israel/1035/2016(H5N8)) ORGANISM Influenza A virus (A/cormorant/Israel/1035/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/cormorant/Israel/1035/2016(H5N8))" /mol_type="viral cRNA" /strain="A/cormorant/Israel/1035/2016" /serotype="H5N8" /host="cormorant" /db_xref="taxon:2005433" /segment="4" /country="Israel" /collection_date="19-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45888.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAKEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKR DSTIMKSGVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctttgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaat 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt aagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggaa ttcatcattc caacaatgca 601 aaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaagaggga ctcaacaatt 841 atgaaaagtg gagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccgtt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg aattctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  8. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176517 A/turkey/Israel/1045/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176528 A/great egret/Israel/1084/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%) EPI1176525 A/great egret/Israel/1088/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%) EPI1176524 A/cormorant/Israel/1035/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1700/1705 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3105.3 0.000000e+00 1696/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI922508 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909428 A/turkey/Rostov-on-Don/11/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI860509 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1023562 A/Eurasian_Wigeon/Netherlands/11/2016 (A/H5N8) segment 4 (HA) 3090.6 0.000000e+00 1691/1700 (99%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019446 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019382 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI954783 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909420 A/chicken/Voronezh/20/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909412 A/chicken/Voronezh/19/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI863865 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI861224 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI860393 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1691/1702 (99%) EPI1040225 A/turkey/Italy/17VIR5878-3/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%)
  9. LOCUS MF166574 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/turkey/Israel/1045/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166574 VERSION MF166574.1 KEYWORDS . SOURCE Influenza A virus (A/turkey/Israel/1045/2016(H5N8)) ORGANISM Influenza A virus (A/turkey/Israel/1045/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/turkey/Israel/1045/2016(H5N8))" /mol_type="viral cRNA" /strain="A/turkey/Israel/1045/2016" /serotype="H5N8" /host="turkey" /db_xref="taxon:2005438" /segment="4" /country="Israel" /collection_date="20-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45890.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNNAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSGVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVFATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctttgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaat 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt aagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggctcat caaaaagaac aatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggaa ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg gagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccgtt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtctttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg aattctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  10. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176519 A/chicken/Israel/1048/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI1159825 A/Cygnus atratus/Hubei/HF-1/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1006681 A/common teal/Korea/W549/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1006680 A/common teal/Korea/W547/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836614 A/common tern /Uvs-Nuur Lake/26/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836606 A/grey heron /Uvs-Nuur Lake/20/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774394 A/Bar-headed Goose/Qinghai/BTY17-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774386 A/Bar-headed Goose/Qinghai/BTY17-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774310 A/Bar-headed Goose/Qinghai/BTY12-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774242 A/Bar-headed Goose/Qinghai/BTY8-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774234 A/Bar-headed Goose/Qinghai/BTY8-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774121 A/Bar-headed Goose/Qinghai/BTY1-LV/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774113 A/Bar-headed Goose/Qinghai/BTY1-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1176518 A/chicken/Israel/881/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1159817 A/Cygnus atratus/Hubei/2Z2-O/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006705 A/common teal/Korea/W555/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006704 A/common teal/Korea/W550/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006703 A/common teal/Korea/W548/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774475 A/Brown-headed Gull/Qinghai/ZTO5-K/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774458 A/Brown-headed Gull/Qinghai/ZTO4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774450 A/Brown-headed Gull/Qinghai/ZTO3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774402 A/Bar-headed Goose/Qinghai/BTY18-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774378 A/Bar-headed Goose/Qinghai/BTY16-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774326 A/Bar-headed Goose/Qinghai/BTY13-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774318 A/Bar-headed Goose/Qinghai/BTY13-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774302 A/Bar-headed Goose/Qinghai/BTY12-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774277 A/Bar-headed Goose/Qinghai/BTY10-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774267 A/Bar-headed Goose/Qinghai/BTY10-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774259 A/Bar-headed Goose/Qinghai/BTY9-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774251 A/Bar-headed Goose/Qinghai/BTY9-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774226 A/Bar-headed Goose/Qinghai/BTY7-LU2/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774218 A/Bar-headed Goose/Qinghai/BTY7-LU1/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774210 A/Bar-headed Goose/Qinghai/BTY7-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774201 A/Bar-headed Goose/Qinghai/BTY6-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774193 A/Bar-headed Goose/Qinghai/BTY6-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774185 A/Bar-headed Goose/Qinghai/BTY5-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774176 A/Bar-headed Goose/Qinghai/BTY4-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774168 A/Bar-headed Goose/Qinghai/BTY4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774159 A/Bar-headed Goose/Qinghai/BTY3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774150 A/Bar-headed Goose/Qinghai/BTY3-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 3068.4 0.000000e+00 1689/1704 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1704 (99%) EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032484 A/Goose/Hungary/15729/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032476 A/Goose/Hungary/17261/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1021135 A/quail/Czech Republic/2063-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1021132 A/goose/Czech Republic/1954-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI964917 A/chicken/Czech Republic/206-17_2/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI962046 A/Duck/Hungary/54738/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI961525 A/chicken/Italy/17VIR1751-3/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI961500 A/shelduck/Italy/17VIR1572-24/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI959539 A/Mute swan/Hungary/6276/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI954655 A/Duck/Hungary/984/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI954639 A/Harris Hawk/Hungary/120/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI952639 A/chicken/Korea/H903/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI930838 A/mute swan/Czech Republic/54-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI919636 A/chicken/Czech Republic/585-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI891670 A/greylag goose/Croatia/33/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI887468 A/chicken/Czech Republic/206-17_2/2017(H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI881901 A/mute swan/Croatia/15/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI869929 A/mute swan/Poland/108/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI866978 A/duck/Hungary/60441/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
  11. LOCUS MF166579 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/chicken/Israel/1048/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166579 VERSION MF166579.1 KEYWORDS . SOURCE Influenza A virus (A/chicken/Israel/1048/2016(H5N8)) ORGANISM Influenza A virus (A/chicken/Israel/1048/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/chicken/Israel/1048/2016(H5N8))" /mol_type="viral cRNA" /strain="A/chicken/Israel/1048/2016" /serotype="H5N8" /host="chicken" /db_xref="taxon:2005431" /segment="4" /country="Israel" /collection_date="20-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45895.1" /translation="MEKIVLLLAIVGLVKSDPICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttggccttg ttaaaagtga tccgatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgattta 181 aatggggtga aacctctgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaac 301 cccgctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt gagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggcttat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggga ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcggttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttttggac aattttaaaa ccgaatgatg caatccactt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg aagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaagcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg agttctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  12. Last week
  13. http://rense2.gsradio.net/rense/special/rense_021518_hr2.mp3
  14. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176530 A/peregrine falcon/Israel/1086/2016 (A/H5N8) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%) EPI1006681 A/common teal/Korea/W549/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI1006680 A/common teal/Korea/W547/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI1006705 A/common teal/Korea/W555/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1006704 A/common teal/Korea/W550/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1006703 A/common teal/Korea/W548/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI952639 A/chicken/Korea/H903/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1034974 A/grey heron/W779/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI954567 A/turkey/Italy/17VIR538-1/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI952782 A/mallard duck/Korea/WA137/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI926613 A/domestic duck/Siberia/103/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI926605 A/domestic duck/Siberia/50K/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI925956 A/gadwall/Chany/97/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774458 A/Brown-headed Gull/Qinghai/ZTO4-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774450 A/Brown-headed Gull/Qinghai/ZTO3-LU/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774402 A/Bar-headed Goose/Qinghai/BTY18-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774378 A/Bar-headed Goose/Qinghai/BTY16-LU/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774326 A/Bar-headed Goose/Qinghai/BTY13-LU/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774318 A/Bar-headed Goose/Qinghai/BTY13-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774277 A/Bar-headed Goose/Qinghai/BTY10-LU/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774267 A/Bar-headed Goose/Qinghai/BTY10-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774226 A/Bar-headed Goose/Qinghai/BTY7-LU2/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774218 A/Bar-headed Goose/Qinghai/BTY7-LU1/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774210 A/Bar-headed Goose/Qinghai/BTY7-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774201 A/Bar-headed Goose/Qinghai/BTY6-LU/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI774193 A/Bar-headed Goose/Qinghai/BTY6-B/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1691/1702 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1010500 A/green-winged teal/Egypt/877/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI881901 A/mute swan/Croatia/15/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI858844 A/painted stork/India/10CA03/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI836614 A/common tern /Uvs-Nuur Lake/26/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI836606 A/grey heron /Uvs-Nuur Lake/20/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774490 A/Brown-headed Gull/Qinghai/ZTO6-SP/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774483 A/Brown-headed Gull/Qinghai/ZTO6-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774434 A/Brown-headed Gull/Qinghai/ZTO1-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774410 A/Bar-headed Goose/Qinghai/BTY18-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774394 A/Bar-headed Goose/Qinghai/BTY17-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774386 A/Bar-headed Goose/Qinghai/BTY17-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774369 A/Bar-headed Goose/Qinghai/BTY16-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774335 A/Bar-headed Goose/Qinghai/BTY14-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774310 A/Bar-headed Goose/Qinghai/BTY12-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774294 A/Bar-headed Goose/Qinghai/BTY11-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774286 A/Bar-headed Goose/Qinghai/BTY11-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774242 A/Bar-headed Goose/Qinghai/BTY8-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774234 A/Bar-headed Goose/Qinghai/BTY8-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774142 A/Bar-headed Goose/Qinghai/BTY2-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774133 A/Bar-headed Goose/Qinghai/BTY2-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774121 A/Bar-headed Goose/Qinghai/BTY1-LV/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774113 A/Bar-headed Goose/Qinghai/BTY1-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1159825 A/Cygnus atratus/Hubei/HF-1/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1010489 A/green-winged teal/Egypt/871/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI964917 A/chicken/Czech Republic/206-17_2/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI887468 A/chicken/Czech Republic/206-17_2/2017(H5N8) (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774475 A/Brown-headed Gull/Qinghai/ZTO5-K/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774442 A/Brown-headed Gull/Qinghai/ZTO3-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI774352 A/Bar-headed Goose/Qinghai/BTY15-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774302 A/Bar-headed Goose/Qinghai/BTY12-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774259 A/Bar-headed Goose/Qinghai/BTY9-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774251 A/Bar-headed Goose/Qinghai/BTY9-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774185 A/Bar-headed Goose/Qinghai/BTY5-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774176 A/Bar-headed Goose/Qinghai/BTY4-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774168 A/Bar-headed Goose/Qinghai/BTY4-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774159 A/Bar-headed Goose/Qinghai/BTY3-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774150 A/Bar-headed Goose/Qinghai/BTY3-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 3073.9 0.000000e+00 1690/1704 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 3072.1 0.000000e+00 1690/1704 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032484 A/Goose/Hungary/15729/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1032476 A/Goose/Hungary/17261/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1021135 A/quail/Czech Republic/2063-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
  15. LOCUS MF166578 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/turkey/Israel/1076/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166578 VERSION MF166578.1 KEYWORDS . SOURCE Influenza A virus (A/turkey/Israel/1076/2016(H5N8)) ORGANISM Influenza A virus (A/turkey/Israel/1076/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/turkey/Israel/1076/2016(H5N8))" /mol_type="viral cRNA" /strain="A/turkey/Israel/1076/2016" /serotype="H5N8" /host="tyrkey" /db_xref="taxon:2005439" /segment="4" /country="Israel" /collection_date="24-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45894.1" /translation="MEKIVLLLAIVSLVESDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NNPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHQCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttgaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctctgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaac 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt gagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggcttat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggga ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgggga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccactt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg aagtggaata tggccactgc aacaccaaat gtcaaacccc agtgggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaataatcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccat catagcaatg agcagggaag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg agttctatca ccaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  16. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176525 A/great egret/Israel/1088/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176517 A/turkey/Israel/1045/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%) EPI1176528 A/great egret/Israel/1084/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1699/1705 (99%) EPI1176524 A/cormorant/Israel/1035/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1698/1706 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1694/1705 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI922508 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1693/1706 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909428 A/turkey/Rostov-on-Don/11/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI860509 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1023562 A/Eurasian_Wigeon/Netherlands/11/2016 (A/H5N8) segment 4 (HA) 3073.9 0.000000e+00 1689/1701 (99%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 3072.1 0.000000e+00 1691/1705 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3072.1 0.000000e+00 1691/1705 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3072.1 0.000000e+00 1691/1705 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019446 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019382 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI954783 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI909420 A/chicken/Voronezh/20/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI909412 A/chicken/Voronezh/19/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI863865 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI861224 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI860393 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1703 (99%) EPI1040225 A/turkey/Italy/17VIR5878-3/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
  17. LOCUS MF166573 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/great egret/Israel/1088/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166573 VERSION MF166573.1 KEYWORDS . SOURCE Influenza A virus (A/great egret/Israel/1088/2016(H5N8)) ORGANISM Influenza A virus (A/great egret/Israel/1088/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/great egret/Israel/1088/2016(H5N8))" /mol_type="viral cRNA" /strain="A/great egret/Israel/1088/2016" /serotype="H5N8" /host="great egret" /db_xref="taxon:2005435" /segment="4" /country="Israel" /collection_date="25-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45889.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSGVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATRLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESMGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctttgat tttaaaggat tgtagtgtag ctggatggct cctcggaaat 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaat 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt aagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggaa ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg gagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccgtt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtcttggcg actaggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg aattctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatggg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  18. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176528 A/great egret/Israel/1084/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176517 A/turkey/Israel/1045/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%) EPI1176525 A/great egret/Israel/1088/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1699/1705 (99%) EPI1176524 A/cormorant/Israel/1035/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1699/1705 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3099.8 0.000000e+00 1695/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI922508 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019422 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI931145 A/duck/Czech Republic/1467-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909428 A/turkey/Rostov-on-Don/11/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI860509 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1023562 A/Eurasian_Wigeon/Netherlands/11/2016 (A/H5N8) segment 4 (HA) 3085.0 0.000000e+00 1690/1700 (99%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI1023581 A/Back-headed_Gull/Netherlands/9/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019598 A/Eur_Wig/NL-Terschelling/16015692-010/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019574 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019446 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1019382 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI959460 A/Eurasian Wigeon/Netherlands/9/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954783 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI909420 A/chicken/Voronezh/20/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI909412 A/chicken/Voronezh/19/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI863865 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI861224 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%)
  19. LOCUS MF166580 1721 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/great egret/Israel/1084/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166580 VERSION MF166580.1 KEYWORDS . SOURCE Influenza A virus (A/great egret/Israel/1084/2016(H5N8)) ORGANISM Influenza A virus (A/great egret/Israel/1084/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1721) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1721) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1721 /organism="Influenza A virus (A/great egret/Israel/1084/2016(H5N8))" /mol_type="viral cRNA" /strain="A/great egret/Israel/1084/2016" /serotype="H5N8" /host="great egret" /db_xref="taxon:2005434" /segment="4" /country="Israel" /collection_date="25-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45896.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSGVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctttgat tttaaaggat tgtagtgtag ctggatggct cctcggaaat 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaat 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt aagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggaa ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg gagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt atgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg aattctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgg gagctcagat g
  20. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176530 A/peregrine falcon/Israel/1086/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%) EPI1006681 A/common teal/Korea/W549/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1006680 A/common teal/Korea/W547/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1006705 A/common teal/Korea/W555/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1006704 A/common teal/Korea/W550/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1006703 A/common teal/Korea/W548/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI952639 A/chicken/Korea/H903/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI1034974 A/grey heron/W779/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954567 A/turkey/Italy/17VIR538-1/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI952782 A/mallard duck/Korea/WA137/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI926613 A/domestic duck/Siberia/103/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI926605 A/domestic duck/Siberia/50K/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI925956 A/gadwall/Chany/97/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774458 A/Brown-headed Gull/Qinghai/ZTO4-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774450 A/Brown-headed Gull/Qinghai/ZTO3-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774402 A/Bar-headed Goose/Qinghai/BTY18-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774378 A/Bar-headed Goose/Qinghai/BTY16-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774326 A/Bar-headed Goose/Qinghai/BTY13-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774318 A/Bar-headed Goose/Qinghai/BTY13-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774277 A/Bar-headed Goose/Qinghai/BTY10-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774267 A/Bar-headed Goose/Qinghai/BTY10-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774226 A/Bar-headed Goose/Qinghai/BTY7-LU2/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774218 A/Bar-headed Goose/Qinghai/BTY7-LU1/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774210 A/Bar-headed Goose/Qinghai/BTY7-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774201 A/Bar-headed Goose/Qinghai/BTY6-LU/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI774193 A/Bar-headed Goose/Qinghai/BTY6-B/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1010500 A/green-winged teal/Egypt/877/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI881901 A/mute swan/Croatia/15/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI858844 A/painted stork/India/10CA03/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836614 A/common tern /Uvs-Nuur Lake/26/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836606 A/grey heron /Uvs-Nuur Lake/20/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774490 A/Brown-headed Gull/Qinghai/ZTO6-SP/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774483 A/Brown-headed Gull/Qinghai/ZTO6-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774434 A/Brown-headed Gull/Qinghai/ZTO1-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774410 A/Bar-headed Goose/Qinghai/BTY18-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774394 A/Bar-headed Goose/Qinghai/BTY17-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774386 A/Bar-headed Goose/Qinghai/BTY17-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774369 A/Bar-headed Goose/Qinghai/BTY16-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774335 A/Bar-headed Goose/Qinghai/BTY14-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774310 A/Bar-headed Goose/Qinghai/BTY12-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774294 A/Bar-headed Goose/Qinghai/BTY11-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774286 A/Bar-headed Goose/Qinghai/BTY11-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774242 A/Bar-headed Goose/Qinghai/BTY8-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774234 A/Bar-headed Goose/Qinghai/BTY8-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774142 A/Bar-headed Goose/Qinghai/BTY2-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774133 A/Bar-headed Goose/Qinghai/BTY2-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774121 A/Bar-headed Goose/Qinghai/BTY1-LV/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774113 A/Bar-headed Goose/Qinghai/BTY1-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1159825 A/Cygnus atratus/Hubei/HF-1/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1010489 A/green-winged teal/Egypt/871/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI964917 A/chicken/Czech Republic/206-17_2/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI887468 A/chicken/Czech Republic/206-17_2/2017(H5N8) (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774475 A/Brown-headed Gull/Qinghai/ZTO5-K/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774442 A/Brown-headed Gull/Qinghai/ZTO3-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI774352 A/Bar-headed Goose/Qinghai/BTY15-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774302 A/Bar-headed Goose/Qinghai/BTY12-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774259 A/Bar-headed Goose/Qinghai/BTY9-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774251 A/Bar-headed Goose/Qinghai/BTY9-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774185 A/Bar-headed Goose/Qinghai/BTY5-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774176 A/Bar-headed Goose/Qinghai/BTY4-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774168 A/Bar-headed Goose/Qinghai/BTY4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774159 A/Bar-headed Goose/Qinghai/BTY3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774150 A/Bar-headed Goose/Qinghai/BTY3-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 3068.4 0.000000e+00 1689/1704 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1704 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032484 A/Goose/Hungary/15729/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032476 A/Goose/Hungary/17261/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1021135 A/quail/Czech Republic/2063-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
  21. LOCUS MF166577 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/peregrine falcon/Israel/1086/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166577 VERSION MF166577.1 KEYWORDS . SOURCE Influenza A virus (A/peregrine falcon/Israel/1086/2016(H5N8)) ORGANISM Influenza A virus (A/peregrine falcon/Israel/1086/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/peregrine falcon/Israel/1086/2016(H5N8))" /mol_type="viral cRNA" /strain="A/peregrine falcon/Israel/1086/2016" /serotype="H5N8" /host="peregrine falcon" /db_xref="taxon:2005437" /segment="4" /country="Israel" /collection_date="25-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45893.1" /translation="MEKIVLLLAIVSLVESDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NNPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHQCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttgaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctctgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaac 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt gagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggcttat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggga ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgggga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccactt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg aagtggaata tggccactgc aacaccaaat gtcaaacccc agtgggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaataatcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccat catagcaatg agcagggaag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcgata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg agttctatca ccaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  22. Descriptions Align Segment-ID Name Score E-Value Identity EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3125.7 0.000000e+00 1700/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3125.7 0.000000e+00 1700/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI931145 A/duck/Czech Republic/1467-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%) EPI1176528 A/great egret/Israel/1084/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI959460 A/Eurasian Wigeon/Netherlands/9/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3105.3 0.000000e+00 1696/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954759 A/Peregrine_falcon/Hungary/4882/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%) EPI1023562 A/Eurasian_Wigeon/Netherlands/11/2016 (A/H5N8) segment 4 (HA) 3101.6 0.000000e+00 1693/1700 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3099.8 0.000000e+00 1695/1704 (99%) EPI1176524 A/cormorant/Israel/1035/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3094.3 0.000000e+00 1693/1702 (99%) EPI1176517 A/turkey/Israel/1045/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1023578 A/Eurasian_Wigeon/Netherlands/23/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1686/1692 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1019422 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI961449 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI942935 A/turkey/England/003778/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909428 A/turkey/Rostov-on-Don/11/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3088.7 0.000000e+00 1693/1704 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1159825 A/Cygnus atratus/Hubei/HF-1/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1023581 A/Back-headed_Gull/Netherlands/9/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019598 A/Eur_Wig/NL-Terschelling/16015692-010/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019574 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI1019494 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
  23. LOCUS MF166576 1748 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/turkey/Israel/184/2017(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166576 VERSION MF166576.1 KEYWORDS . SOURCE Influenza A virus (A/turkey/Israel/184/2017(H5N8)) ORGANISM Influenza A virus (A/turkey/Israel/184/2017(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1748) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1748 /organism="Influenza A virus (A/turkey/Israel/184/2017(H5N8))" /mol_type="viral cRNA" /strain="A/turkey/Israel/184/2017" /serotype="H5N8" /host="tyrkey" /db_xref="taxon:2005440" /segment="4" /country="Israel" /collection_date="05-Feb-2017" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45892.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSGVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ttcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga agcctctgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaat 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagttc ttggcccaat 421 catgaaacat cattaggggt gagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggcttat caaaaagaac gatgcatacc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggga ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaggggga ctcaacaatt 841 atgaaaagtg gagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg aggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt atgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg aattctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc caatgggtcg 1681 ttacagtgca gaatttgcat ttaaatttgt gagctcagat tgtagttaaa aacacccttg 1741 tttctact
  24. edit Name Isolate ID Subtype Passage PB2 PB1 PA HA NP NA MP NS HE P3 Collection date edit Name Isolate ID Subtype Passage PB2 PB1 PA HA NP NA MP NS HE P3 Collection date A/turkey/Israel/184/2017 EPI_ISL_298649 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2017-02-05 A/peregrine falcon/Israel/1086/2016 EPI_ISL_298653 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-25 A/great egret/Israel/1084/2016 EPI_ISL_298651 H5N8 passage details: E1 --- --- --- 1721 --- --- --- --- --- --- 2016-12-25 A/great egret/Israel/1088/2016 EPI_ISL_298648 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-25 A/turkey/Israel/1076/2016 EPI_ISL_298650 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-24 A/chicken/Israel/1048/2016 EPI_ISL_298642 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-20 A/turkey/Israel/1045/2016 EPI_ISL_298640 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-20 A/cormorant/Israel/1035/2016 EPI_ISL_298647 H5N8 passage details: E1 --- --- --- 1748 --- --- --- --- --- --- 2016-12-19 A/grey goose/Israel/986/2016 EPI_ISL_298652 H5N8 passage details: E1 --- --- --- 1629 --- --- --- --- --- --- 2016-12-12 A/chicken/Israel/881/2016 EPI_ISL_298641 H5N8 passage details: E1 --- --- --- 1717 --- --- --- --- --- --- 2016-12-07
  25. Kimron Veterinary Institute in Israel has release 10 H5 wild bird and poultry sequences collected between December 2016 and February 2017 which are largely most closely to isolates from China and South Korea.
  26. Human H7N4 Case Changzhou Jiangsu 68F

    CHP notified of human case of avian influenza A (H7N4) in Mainland ****************************************************** The Centre for Health Protection (CHP) of the Department of Health (DH) today (February 14) received notification from the National Health and Family Planning Commission (NHFPC) that a human case of avian influenza A (H7N4) was confirmed from February 10 to 14, and reminded the public to maintain strict personal, food and environmental hygiene both locally and during travel. According to the NHFPC, this is the first case of human infection with avian influenza A (H7N4) in the world. The case involved a 68-year-old female patient living in Liyang in Changzhou of Jiangsu Province who developed symptoms on December 25, 2017. She was admitted to hospital for medical treatment on January 1 and was discharged on January 22. She had contact with live poultry before the onset of symptoms. All her close contacts did not have any symptoms during the medical surveillance period. According to a report from the Chinese Center for Disease Control and Prevention, upon analysis, the genes of the virus were determined to be of avian origin. "All novel influenza A infections, including H7N4, are notifiable infectious diseases in Hong Kong," the spokesman for the CHP said. "Based on the seasonal pattern, the activity of avian influenza viruses is expected to be higher in winter. Travellers to the Mainland or other affected areas must avoid visiting wet markets, live poultry markets or farms. They should be alert to the presence of backyard poultry when visiting relatives and friends. They should also avoid purchasing live or freshly slaughtered poultry, and avoid touching poultry/birds or their droppings. They should strictly observe personal and hand hygiene when visiting any place with live poultry," the spokesman reminded. Travellers returning from affected areas should consult a doctor promptly if symptoms develop, and inform the doctor of their travel history for prompt diagnosis and treatment of potential diseases. It is essential to tell the doctor if they have seen any live poultry during travel, which may imply possible exposure to contaminated environments. This will enable the doctor to assess the possibility of avian influenza and arrange necessary investigations and appropriate treatment in a timely manner. While local surveillance, prevention and control measures are in place, the CHP will remain vigilant and work closely with the World Health Organization and relevant health authorities to monitor the latest developments. The CHP's Port Health Office conducts health surveillance measures at all boundary control points. Thermal imaging systems are in place for body temperature checks on inbound travellers. Suspected cases will be immediately referred to public hospitals for follow-up. The display of posters and broadcasting of health messages in departure and arrival halls as health education for travellers is under way. The travel industry and other stakeholders are regularly updated on the latest information. The public should maintain strict personal, hand, food and environmental hygiene and take heed of the advice below if handling poultry: Avoid touching poultry, birds, animals or their droppings; When buying live chickens, do not touch them and their droppings. Do not blow at their bottoms. Wash eggs with detergent if soiled with faecal matter and cook and consume the eggs immediately. Always wash hands thoroughly with soap and water after handling chickens and eggs; Eggs should be cooked well until the white and yolk become firm. Do not eat raw eggs or dip cooked food into any sauce with raw eggs. Poultry should be cooked thoroughly. If there is pinkish juice running from the cooked poultry or the middle part of its bone is still red, the poultry should be cooked again until fully done; Wash hands frequently, especially before touching the mouth, nose or eyes, before handling food or eating, and after going to the toilet, touching public installations or equipment such as escalator handrails, elevator control panels or door knobs, or when hands are dirtied by respiratory secretions after coughing or sneezing; and Wear a mask if fever or respiratory symptoms develop, when going to a hospital or clinic, or while taking care of patients with fever or respiratory symptoms. The public may visit the CHP's pages for more information: the avian influenza page, the weekly Avian Influenza Report, global statistics and affected areas of avian influenza, the Facebook Page and the YouTube Channel. Ends/Wednesday, February 14, 2018 Issued at HKT 18:43 NNNN http://www.info.gov.hk/gia/general/201802/14/P2018021400759.htm
  27. First human H7N4 case (68F) confirmed in Changzhou Jiangsu
  1. Load more activity
×