Jump to content

niman

Administrators
  • Content count

    11,483
  • Joined

  • Last visited

  • Days Won

    1

Everything posted by niman

  1. Isolate detail Isolate name: A/Great Black-backed Gull/Netherlands/1/2017 Isolate ID: EPI_ISL_289500 Passage details/history: Original material (swab) Type: A / H5N6 Lineage: Sample information Collection date: 2017-12-18 Host Larus marinus Additional host information: Domestic status: Wild Is vaccinated: Location: Netherlands / Provincie Noord-Holland Additional location information: Health status: Dead Specimen source: Strain or commercial product name used for vaccination: Institute information Originating lab: Erasmus Medical Center Sample ID given by the sample provider: 320-157 Address: Erasmus Medical Center Department of Virology Dr. Molewaterplein 50 3015GE Rotterdam Netherlands Submitting lab: Erasmus Medical Center Sample ID given by the submitting laboratory: 320-157 Authors: Poen,MJ; Van Der Jeugd,HP; Kelder,L; Scheuer,RD; Bestebroer,TM; Koopmans,MPG; Fouchier,RAM Address: Erasmus Medical Center Department of Virology Dr. Molewaterplein 50 3015GE Rotterdam Netherlands Publication Publication In vivo antiviral resistance Phenotype Genotype Unspecified Antiviral resistance tested by experimental procedures Adamantanes: Unknown Oseltamivir: Unknown Zanamivir: Unknown Peramivir: Unknown Other: Unknown Additional information Antigenic characterization: Note: Sequence segment identifier length accession # INSDC Sequence HA A/Great Black-backed Gull/Netherlands/1/2017 1639 EPI1129916 NA A/Great Black-backed Gull/Netherlands/1/2017 1322 EPI1129917 Submitter information Submitter: Poen, Maria Johanna Submission Date: 2017-12-22 Last modifier: Poen, Maria Johanna Last modified: 2017-12-22 Address: Erasmus Medical Center Department of Virology Dr. Molewaterplein 50 3015GE Rotterdam Netherlands
  2. Descriptions Align Segment-ID Name Score E-Value Identity EPI1129918 A/Great Black-backed Gull/Netherlands/2/2017 (A/H5N6) segment 6 (NA) 2473.8 0.000000e+00 1339/1339 (100%) EPI1129917 A/Great Black-backed Gull/Netherlands/1/2017 (A/H5N6) segment 6 (NA) 2411.0 0.000000e+00 1315/1320 (99%) EPI1122895 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 6 (NA) 2329.7 0.000000e+00 1313/1339 (98%) EPI1122887 A/chicken/Greece/39_2017a/2017 (A/H5N6) segment 6 (NA) 2326.1 0.000000e+00 1312/1339 (97%) EPI1122879 A/chicken/Greece/39_2017/2017 (A/H5N6) segment 6 (NA) 2326.1 0.000000e+00 1312/1339 (97%) EPI1119073 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 6 (NA) 2291.0 0.000000e+00 1306/1339 (97%) EPI1127540 A/mute swan/Shimane/3211A001/2017 (A/H5N6) segment 6 (NA) 2279.9 0.000000e+00 1304/1339 (97%) EPI1011098 A/barnacle goose/Netherlands/2/2014 (A/H3N6) segment 6 (NA) 2268.8 0.000000e+00 1304/1341 (97%) EPI1036189 A/duck/Moscow/4652/2011 (A/H4N6) segment 6 (NA) 2187.6 0.000000e+00 1289/1341 (96%) EPI890326 A/mallard duck/Netherlands/19/2012 (A/H4N6) segment 6 (NA) 2169.1 0.000000e+00 1286/1341 (95%) EPI1036196 A/duck/Moscow/4781/2012 (A/H4N6) segment 6 (NA) 2163.5 0.000000e+00 1285/1341 (95%) EPI891032 A/mallard duck/Netherlands/30/2014 (A/H4N6) segment 6 (NA) 2108.1 0.000000e+00 1276/1342 (95%) EPI823917 A/teal/Chany Lake/106_ cloaca/2012 (A/H4N6) segment 6 (NA) 2108.1 0.000000e+00 1277/1343 (95%) EPI823909 A/teal/Chany Lake/104_ feather/2012 (A/H4N6) segment 6 (NA) 2108.1 0.000000e+00 1277/1343 (95%) EPI823901 A/teal/Chany Lake/104_cloaca/2012 (A/H4N6) segment 6 (NA) 2108.1 0.000000e+00 1277/1343 (95%) EPI823790 A/shoveller/Chany Lake/101/2012 (A/H4N6) segment 6 (NA) 2108.1 0.000000e+00 1277/1343 (95%) EPI485322 A/eurasian wigeon/Mongolia/340V/2009 (A/H4N6) segment 6 (NA) 2102.6 0.000000e+00 1275/1342 (95%) EPI470232 A/duck/Yunnan/87/2007 (A/H7N6) segment 6 (NA) 2102.6 0.000000e+00 1275/1342 (95%) EPI692466 A/duck/Henan/S1091/2010 (A/H4N6) segment 6 (NA) 2097.1 0.000000e+00 1274/1342 (94%) EPI533781 A/Caspian seal/Russia/T1/2012 (A/H4N6) segment 6 (NA) 2097.1 0.000000e+00 1274/1342 (94%) EPI533775 A/Caspian seal/Russia/1884/2002 (A/H4N6) segment 6 (NA) 2097.1 0.000000e+00 1274/1342 (94%) EPI1014700 A/mallard duck/Netherlands/7/2006 (A/H10N6) segment 6 (NA) 2086.0 0.000000e+00 1272/1342 (94%) EPI692506 A/duck/Hunan/S1012/2009 (A/H4N6) segment 6 (NA) 2086.0 0.000000e+00 1272/1342 (94%) EPI1013418 A/mallard duck/Netherlands/8/2006 (A/H10N6) segment 6 (NA) 2080.4 0.000000e+00 1271/1342 (94%) EPI692346 A/chicken/Hunan/S1267/2010 (A/H4N6) segment 6 (NA) 2080.4 0.000000e+00 1271/1342 (94%) EPI692338 A/chicken/Hunan/S1248/2010 (A/H4N6) segment 6 (NA) 2080.4 0.000000e+00 1271/1342 (94%) EPI414148 A/duck/Jiangsu/4/2010 (A/H3N6) segment 6 (NA) 2080.4 0.000000e+00 1271/1342 (94%) EPI401303 A/duck/Korea/DY104/2007 (A/H4N6) segment 6 (NA) 2080.4 0.000000e+00 1271/1342 (94%) EPI296530 A/mallard/Netherlands/4/2006 (A/H10N6) segment 6 (NA) 2080.4 0.000000e+00 1271/1342 (94%) EPI407862 A/Khaki Campbell duck/Karachi/NARC-23963/2010 (A/H4N6) segment 6 (NA) 2076.8 0.000000e+00 1270/1342 (94%) EPI372354 A/teal/Egypt/09888-NAMRU3/2005 (A/H4N6) segment 6 (NA) 2076.8 0.000000e+00 1271/1342 (94%) EPI890683 A/mallard duck/Netherlands/6/2006 (A/H4N6) segment 6 (NA) 2074.9 0.000000e+00 1270/1342 (94%) EPI395392 A/chicken/India/WB-NIV101006/2009 (A/H4N6) segment 6 (NA) 2074.9 0.000000e+00 1270/1342 (94%) EPI243479 A/duck/Vietnam/OIE-2454/2009 (A/H4N6) segment 6 (NA) 2069.4 0.000000e+00 1270/1343 (94%) EPI168523 A/common pochard/Aktau/1455/2006 (A/H4N6) segment 6 (NA) 2058.3 0.000000e+00 1268/1343 (94%) EPI168522 A/coot/Aktau/1454/2006 (A/H4N6) segment 6 (NA) 2052.7 0.000000e+00 1268/1344 (94%) EPI704432 A/duck/Mongolia/769/2015 (A/H4N6) segment 6 (NA) 2047.2 0.000000e+00 1268/1345 (94%) EPI513237 A/mallard/Sweden/104925/2009 (A/H4N6) segment 6 (NA) 2047.2 0.000000e+00 1266/1343 (94%) EPI540366 A/duck/Bangladesh/1521/2009 (A/H4N6) segment 6 (NA) 2041.7 0.000000e+00 1265/1343 (94%) EPI513749 A/mallard/Sweden/79978/2008 (A/H4N6) segment 6 (NA) 2036.1 0.000000e+00 1263/1342 (94%) EPI395393 A/chicken/India/WB-NIV101018/2009 (A/H4N6) segment 6 (NA) 2036.1 0.000000e+00 1264/1343 (94%) EPI485357 A/ruddy shelduck/Mongolia/592/2010 (A/H8N6) segment 6 (NA) 2030.6 0.000000e+00 1263/1343 (94%) EPI284397 A/mallard/Czech Republic/12652/2007 (A/H4N6) segment 6 (NA) 2030.6 0.000000e+00 1262/1342 (94%) EPI704293 A/duck/Mongolia/127/2015 (A/H4N6) segment 6 (NA) 2025.0 0.000000e+00 1264/1345 (93%) EPI704269 A/duck/Mongolia/101/2015 (A/H4N6) segment 6 (NA) 2025.0 0.000000e+00 1264/1345 (93%) EPI513568 A/mallard/Sweden/80348/2008 (A/H0) segment 6 (NA) 2025.0 0.000000e+00 1262/1343 (93%) EPI540374 A/duck/Bangladesh/1283/2008 (A/H4N6) segment 6 (NA) 2019.5 0.000000e+00 1262/1344 (93%) EPI1013677 A/mallard duck/Netherlands/10/2013 (A/H4N6) segment 6 (NA) 2014.0 0.000000e+00 1260/1343 (93%) EPI1011235 A/mallard duck/Netherlands/22/2011 (A/H4N6) segment 6 (NA) 2014.0 0.000000e+00 1260/1343 (93%) EPI965451 A/duck/Bangladesh/26974/2015 (A/H3N6) segment 6 (NA) 2014.0 0.000000e+00 1263/1346 (93%) EPI889824 A/mallard duck/Netherlands/27/2009 (A/H4N6) segment 6 (NA) 2014.0 0.000000e+00 1260/1343 (93%) EPI540358 A/duck/Bangladesh/1766/2010 (A/H4N6) segment 6 (NA) 2014.0 0.000000e+00 1259/1342 (93%) EPI513170 A/mallard/Sweden/105012/2009 (A/H4N6) segment 6 (NA) 2014.0 0.000000e+00 1260/1343 (93%) EPI463388 A/mallard/Sweden/101980/2009 (A/H4N6) segment 6 (NA) 2014.0 0.000000e+00 1260/1343 (93%) EPI463376 A/mallard/Sweden/101310/2009 (A/H4N6) segment 6 (NA) 2014.0 0.000000e+00 1260/1343 (93%) EPI463375 A/mallard/Sweden/101309/2009 (A/H4N6) segment 6 (NA) 2014.0 0.000000e+00 1260/1343 (93%) EPI965498 A/duck/Bangladesh/26920/2015 (A/H3N6) segment 6 (NA) 2008.4 0.000000e+00 1262/1346 (93%) EPI965369 A/duck/Bangladesh/26948/2015 (A/H3N6) segment 6 (NA) 2008.4 0.000000e+00 1262/1346 (93%) EPI965295 A/duck/Bangladesh/26918/2015 (A/H3N6) segment 6 (NA) 2008.4 0.000000e+00 1262/1346 (93%) EPI618783 A/mallard/Sweden/93475/2009 (A/H10N6) segment 6 (NA) 2008.4 0.000000e+00 1260/1344 (93%) EPI513546 A/mallard/Sweden/101010/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI513461 A/mallard/Sweden/101632/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI513454 A/mallard/Sweden/101603/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI513433 A/mallard/Sweden/101564/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI513431 A/mallard/Sweden/101785/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI513415 A/mallard/Sweden/101733/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI513408 A/mallard/Sweden/101663/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI513394 A/mallard/Sweden/101654/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI513358 A/mallard/Sweden/101831/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI513341 A/mallard/Sweden/104681/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI513230 A/mallard/Sweden/104839/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI513163 A/mallard/Sweden/105011/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI470233 A/wild waterfowl/Hong Kong/MPM3375/2011 (A/H7N6) segment 6 (NA) 2008.4 0.000000e+00 1258/1342 (93%) EPI463380 A/mallard/Sweden/101617/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI463379 A/mallard/Sweden/101615/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI463370 A/mallard/Sweden/101022/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI463368 A/mallard/Sweden/100955/2009 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI461617 A/duck/Hunan/S11893/2012 (A/H4N6) segment 6 (NA) 2008.4 0.000000e+00 1259/1343 (93%) EPI692554 A/duck/Jiangxi/S2443/2012 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI540382 A/duck/Bangladesh/1784/2010 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1257/1342 (93%) EPI540350 A/duck/Bangladesh/1783/2010 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1257/1342 (93%) EPI514901 A/mallard/Sweden/105093/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI513514 A/mallard/Sweden/101524/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1259/1344 (93%) EPI513507 A/mallard/Sweden/101504/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI513493 A/mallard/Sweden/101329/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI513475 A/mallard/Sweden/101642/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI513468 A/mallard/Sweden/101640/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1259/1344 (93%) EPI513424 A/mallard/Sweden/101782/2009 (A/H0) segment 6 (NA) 2002.9 0.000000e+00 1259/1344 (93%) EPI513386 A/mallard/Sweden/102029/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI513379 A/mallard/Sweden/102024/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI513334 A/mallard/Sweden/102157/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI513327 A/mallard/Sweden/102124/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1259/1344 (93%) EPI513320 A/mallard/Sweden/102114/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI513306 A/mallard/Sweden/102045/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI513244 A/mallard/Sweden/104931/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI513216 A/mallard/Sweden/104793/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1259/1344 (93%) EPI513209 A/mallard/Sweden/104690/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1259/1344 (93%) EPI513205 A/mallard/Sweden/102250/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1259/1344 (93%) EPI513184 A/mallard/Sweden/105516/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%) EPI513177 A/mallard/Sweden/105137/2009 (A/H4N6) segment 6 (NA) 2002.9 0.000000e+00 1258/1343 (93%)
  3. Descriptions Align Segment-ID Name Score E-Value Identity EPI1129919 A/Great Black-backed Gull/Netherlands/2/2017 (A/H5N6) segment 4 (HA) 3037.0 0.000000e+00 1644/1644 (100%) EPI1129916 A/Great Black-backed Gull/Netherlands/1/2017 (A/H5N6) segment 4 (HA) 2977.9 0.000000e+00 1628/1636 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1632/1644 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1632/1644 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1632/1644 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1632/1644 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1632/1644 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1632/1644 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1632/1644 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1631/1644 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1631/1644 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1631/1644 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1631/1644 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1631/1644 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1631/1644 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1631/1644 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1631/1644 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1630/1644 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1630/1644 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1630/1644 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1630/1644 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1629/1644 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1629/1644 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1629/1644 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1629/1644 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1629/1644 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1629/1644 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1629/1644 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1629/1644 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1629/1644 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1629/1644 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1629/1644 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 2950.2 0.000000e+00 1628/1644 (99%) EPI1045611 A/chicken/Rostov/44/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1628/1644 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1628/1644 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1628/1644 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1628/1644 (99%) EPI961449 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1628/1644 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1628/1644 (99%) EPI942935 A/turkey/England/003778/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1628/1644 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1628/1644 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1628/1644 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1628/1644 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1628/1644 (99%) EPI873659 A/Eurasian wigeon/Netherlands/1/2016 (A/H5N8) segment 4 (HA) 2944.7 0.000000e+00 1627/1644 (98%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1627/1644 (98%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1627/1644 (98%) EPI1019494 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1627/1644 (98%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1627/1644 (98%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1627/1644 (98%) EPI931145 A/duck/Czech Republic/1467-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1627/1644 (98%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1627/1644 (98%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1627/1644 (98%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1627/1644 (98%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1627/1644 (98%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 2939.1 0.000000e+00 1626/1644 (98%) EPI1061371 A/chicken/Belgium/5990/2017 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI909428 A/turkey/Rostov/11/2017 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1626/1644 (98%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 2933.6 0.000000e+00 1625/1644 (98%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 2933.6 0.000000e+00 1625/1644 (98%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 2933.6 0.000000e+00 1625/1644 (98%) EPI1061370 A/Brahma chicken/Belgium/6153/2017 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1021132 A/goose/Czech Republic/1954-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019446 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI1019382 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI964917 A/chicken/Czech Republic/206-17_2/2017 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI954837 A/Mute swan/Hungary/3137/2017 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI954783 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI954671 A/Duck/Hungary/1588/2017 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI922508 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI909420 A/chicken/Voronezh/20/2017 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%) EPI909412 A/chicken/Voronezh/19/2017 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1625/1644 (98%)
  4. Isolate detail Isolate name: A/Great Black-backed Gull/Netherlands/2/2017 Isolate ID: EPI_ISL_289501 Passage details/history: Original material (OM) Type: A / H5N6 Lineage: Sample information Collection date: 2017-12-18 Host Larus marinus Additional host information: Domestic status: Wild Is vaccinated: Location: Netherlands / Provincie Noord-Holland Additional location information: Health status: Dead Specimen source: Strain or commercial product name used for vaccination: Institute information Originating lab: Erasmus Medical Center Sample ID given by the sample provider: 320-161 Address: Erasmus Medical Center Department of Virology Dr. Molewaterplein 50 3015GE Rotterdam Netherlands Submitting lab: Erasmus Medical Center Sample ID given by the submitting laboratory: 320-161 Authors: Poen,MJ; Van Der Jeugd,HP; Kelder,L; Scheuer,RD; Bestebroer,TM; Koopmans,MPG; Fouchier,RAM Address: Erasmus Medical Center Department of Virology Dr. Molewaterplein 50 3015GE Rotterdam Netherlands Publication Publication In vivo antiviral resistance Phenotype Genotype Unspecified Antiviral resistance tested by experimental procedures Adamantanes: Unknown Oseltamivir: Unknown Zanamivir: Unknown Peramivir: Unknown Other: Unknown Additional information Antigenic characterization: Note: Sequence segment identifier length accession # INSDC Sequence HA A/Great Black-backed Gull/Netherlands/2/2017 1644 EPI1129919 NA A/Great Black-backed Gull/Netherlands/2/2017 1339 EPI1129918 Submitter information Submitter: Poen, Maria Johanna Submission Date: 2017-12-22 Last modifier: Poen, Maria Johanna Last modified: 2017-12-22 Address: Erasmus Medical Center Department of Virology Dr. Molewaterplein 50 3015GE Rotterdam Netherlands
  5. http://rense2.gsradio.net/rense/special/rense_122117_hr1.mp3
  6. Interview at 10 PM EDT tonight will include MERS camel sequences & update on South Korea THURSDAY Dr. Henry L. Niman, PhD Flu, Flu, Flu
  7. http://rense2.gsradio.net/rense/special/rense_111617_hr1.mp3
  8. http://www.renseradio.com/listenlive.htm
  9. Tonight at 10 PM ET (H5N6 and H7N9 HPAI) THURSDAY Dr. Henry L. Niman, PhD New Virus Alerts
  10. Descriptions Align Segment-ID Name Score E-Value Identity EPI1127556 A/mute swan/Shimane/3211A001/2017 (A/H5N6) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%) EPI1119075 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%) EPI1081973 A/goose/Italy/17VIR6358-3/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1081921 A/swan/Italy/17VIR7064-1/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1032556 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1032542 A/Goose/Hungary/64909/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1032534 A/Goose/Hungary/63743/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1032526 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1032518 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1032510 A/Goose/Hungary/59763/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1032502 A/Goose/Hungary/17985/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1032494 A/Goose/Hungary/17580/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1032486 A/Goose/Hungary/17051/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1032470 A/Goose/Hungary/17261/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI962038 A/Duck/Hungary/54738/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI959557 A/Rook/Hungary/4975/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI959533 A/Mute swan/Hungary/6276/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI956131 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI954863 A/White_fronted_goose/Hungary/801/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI954831 A/Mute swan/Hungary/3137/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI954815 A/GuineaFowl/Hungary/596/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI954721 A/Mute swan/Hungary/3139/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI954673 A/Greylag_goose/Hungary/1941/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI954633 A/Harris Hawk/Hungary/120/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI954601 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI888092 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI866975 A/chicken/Hungary/59048/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI860533 A/duck/Hungary/55191/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI860520 A/goose/Hungary/55128/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI860517 A/Mulard_duck/Hungary/54494/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI916717 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%) EPI909368 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%) EPI860499 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%) EPI860397 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%) EPI1126358 A/mute swan/Czech Republic/1060-17/2017 (H5N8) (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1093385 A/mute swan/Czech Republic/1058-17/2017 (H5N8) (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1085346 A/goose/Czech Republic/136-17_1/2017 (H5N8) (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1081898 A/turkey/Czech Republic/38-17_1/2017 (H5N8) (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1081886 A/mute swan/Czech Republic/54-17_2/2017 (H5N8) (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1045979 A/unknown/Tatarstan/94/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1045621 A/chicken/Tatarstan/88/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1045599 A/chicken/Shchyolkovo/47/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1040235 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1040230 A/turkey/Italy/17VIR5878-3/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1032478 A/Goose/Hungary/15729/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 833/837 (99%) EPI1019848 A/T_Dk/NL-Zeewolde/16013976-006/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1019824 A/T_Dk/NL-Zeewolde/16013976-004/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1019816 A/T_Dk/NL-Zeewolde/16013976-001-003/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1019808 A/T_Dk/NL-Zeewolde/16013976-001/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1019760 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1019712 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1019624 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1019528 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1019384 A/C_Gull/NL-Slootdorp/16014102-003/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI1007679 A/peacock/Belgium/1017/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI969258 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI962059 A/Turkey/Hungary/53136/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI962048 A/Duck/Hungary/55764/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI961471 A/chicken/Sergiyev Posad/39/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI961463 A/chicken/Sergiyev Posad/38/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI956122 A/Goose/Hungary/59712/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI954839 A/Mallard/Hungary/5821/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI954823 A/Chicken/Hungary/1751/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI954745 A/Chicken/Hungary/2496/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI954713 A/Mute swan/Hungary/2825/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI954705 A/Mute swan/Hungary/2508/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI954585 A/turkey/Italy/17VIR973-2/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI954569 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI953757 A/mallard/Hungary/57857/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI909470 A/chicken/Astrakhan/3131/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI909448 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI909440 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI909424 A/chicken/Voronezh/20/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI909416 A/chicken/Voronezh/19/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI909408 A/chicken/Voronezh/18/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI909400 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI909392 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI909384 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI866979 A/duck/Hungary/60441/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI859211 A/domestic_turkey/Hungary/53433/2016 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 832/836 (99%) EPI959429 A/chicken/Poland/79A/2016 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%) EPI869691 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 831/835 (99%) EPI863869 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 831/835 (99%) EPI1007671 A/chicken/Belgium/807/2017 (A/H5N8) segment 8 (NS) 1519.1 0.000000e+00 831/836 (99%) EPI1122897 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1122889 A/chicken/Greece/39_2017a/2017 (A/H5N6) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1122881 A/chicken/Greece/39_2017/2017 (A/H5N6) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1117257 A/T_Dk/NL-Werkendam/16014159-001/2016 (A/H5N5) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1081891 A/chicken/Czech Republic/55-17_1/2017 (H5N8) (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1045971 A/unknown/Tatarstan/86/2017 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1019872 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1019856 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1019840 A/T_Dk/NL-Zeewolde/16013976-005/2016 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1019832 A/T_Dk/NL-Zeewolde/16013976-004-006/2016 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1019800 A/T_Dk/NL-Werkendam/16014159-003/2016 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1019792 A/T_Dk/NL-Werkendam/16014159-002/2016 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1019784 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1019776 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1019768 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%) EPI1019752 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 831/836 (99%)
  11. Tottori University has released full November 2017 H5N6 mute swan sequence.
  12. Descriptions Align Segment-ID Name Score E-Value Identity EPI1127539 A/mute swan/Shimane/3211A001/2017 (A/H5N6) segment 5 (NP) 2765.6 0.000000e+00 1497/1497 (100%) EPI1119072 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%) EPI1117254 A/T_Dk/NL-Werkendam/16014159-001/2016 (A/H5N5) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1044548 A/mute swan/Kaliningrad/132/2017 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019791 A/T_Dk/NL-Werkendam/16014159-002/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019783 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019775 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019767 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019759 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019751 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019743 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019695 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019687 A/Gull1/NL-Marker Wadden/16014466-011/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019679 A/Gull/NL-Marker Wadden/16014466-020/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019663 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019655 A/Go/NL-Roggebotsluis/16014462-010/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019647 A/G_c_grebe/NL-Monnickendam/16013865-009-010/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019479 A/Dk/NL-Rotterdam/16014008-001-005/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019407 A/Ch/NL-Den Oever/16014231-001/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019383 A/C_Gull/NL-Slootdorp/16014102-003/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019367 A/Bl_H_gull/NL-Slootdorp/16014102-002/2016 (A/H5N8) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%) EPI1019839 A/T_Dk/NL-Zeewolde/16013976-005/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI1019831 A/T_Dk/NL-Zeewolde/16013976-004-006/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI1019799 A/T_Dk/NL-Werkendam/16014159-003/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI1019735 A/Mal/NL-Mastenbroek/16015378-002/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI1019719 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI1019703 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI1019623 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI1019607 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI1019559 A/Eur_Wig/NL-Groningen/16015376-003/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI1019527 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI1019375 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI954776 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI906264 A/chicken/Germany-MV/R8790/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI860394 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%) EPI861394 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 5 (NP) 2728.6 0.000000e+00 1490/1497 (99%) EPI1019863 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1491/1498 (99%) EPI1019855 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1491/1498 (99%) EPI1019847 A/T_Dk/NL-Zeewolde/16013976-006/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019711 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019567 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019463 A/Dk/NL-Biddinghuizen/16015145-021-025/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019455 A/Dk/NL-Biddinghuizen/16015083-016-020/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019447 A/Dk/NL-Biddinghuizen/16014829-011-015/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019439 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019359 A/Bk_swan/NL-Den Oever/16013973-002/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI990779 A/mute swan/Germany-NI/AR1529-L02145/2017 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI988592 A/turkey/Germany-NI/R9807/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI909365 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI906263 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI888670 A/domestic duck/Germany-MV/R9869/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI860402 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI859656 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1122886 A/chicken/Greece/39_2017a/2017 (A/H5N6) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1122878 A/chicken/Greece/39_2017/2017 (A/H5N6) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019871 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019823 A/T_Dk/NL-Zeewolde/16013976-004/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019815 A/T_Dk/NL-Zeewolde/16013976-001-003/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019807 A/T_Dk/NL-Zeewolde/16013976-001/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019591 A/Eur_Wig/NL-Terschelling/16015692-010/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019415 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI961450 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI926626 A/chicken/Germany-MV/R10048/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1488/1497 (99%) EPI909453 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI909421 A/chicken/Voronezh/20/2017 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI909413 A/chicken/Voronezh/19/2017 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI909405 A/chicken/Voronezh/18/2017 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI909397 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI909389 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI909381 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1122894 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI1040234 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI1019535 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI988588 A/domestic duck/Germany-MV/R9764/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI969255 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI954752 A/Peregrine_falcon/Hungary/4882/2017 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI954600 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI954568 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI909461 A/chicken/Kalmykia/2643/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI909437 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI1081970 A/goose/Italy/17VIR6358-3/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1081922 A/swan/Italy/17VIR7064-1/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019615 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019599 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019543 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019511 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019503 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019495 A/Eur_Wig/NL-Akkrum/16015817-003/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019487 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019471 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI954870 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI954854 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI954806 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI954656 A/Goose/Hungary/1030/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI942936 A/turkey/England/003778/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI888089 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI868849 A/turkey/England/052131/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1045609 A/chicken/Rostov/44/2017 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI1019727 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI1019671 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%)
  13. Descriptions Align Segment-ID Name Score E-Value Identity EPI1127537 A/mute swan/Shimane/3211A001/2017 (A/H5N6) segment 3 (PA) 3973.3 0.000000e+00 2151/2151 (100%) EPI1119057 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 3 (PA) 3912.3 0.000000e+00 2138/2148 (99%) EPI1019730 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%) EPI1019634 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%) EPI1019578 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%) EPI1019434 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%) EPI1019426 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%) EPI868847 A/turkey/England/052131/2016 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%) EPI1019674 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%) EPI1019642 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%) EPI1019618 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%) EPI1019602 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%) EPI1019514 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%) EPI1019506 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%) EPI1019474 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%) EPI1019402 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%) EPI990766 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%) EPI942934 A/turkey/England/003778/2017 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%) EPI909427 A/turkey/Rostov/11/2017 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%) EPI1019842 A/T_Dk/NL-Zeewolde/16013976-005/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI1019834 A/T_Dk/NL-Zeewolde/16013976-004-006/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI1019786 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI1019698 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI1019594 A/Eur_Wig/NL-Terschelling/16015692-010/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI1019570 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI1019554 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI1019490 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI1019482 A/Dk/NL-Rotterdam/16014008-001-005/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI969253 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI909459 A/chicken/Kalmykia/2643/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI909451 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI909443 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI860400 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI860235 A/wild duck/Poland/82A/2016 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%) EPI863848 A/Chicken/Sweden/SVA161122KU0453/SZ0209318/2016 (A/H5N8) segment 3 (PA) 3869.9 0.000000e+00 2132/2151 (99%) EPI1122892 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI1045608 A/chicken/Rostov/44/2017 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI1019866 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI1019858 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI1019778 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI1019754 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI1019682 A/Gull/NL-Marker Wadden/16014466-020/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI1019586 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI1019546 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI1019418 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI1019386 A/C_Gull/NL-Slootdorp/16014102-003/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI961448 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI954555 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI881285 A/chicken/Germany-MV/R8790/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI869686 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2133/2152 (99%) EPI863864 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI860392 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI859658 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%) EPI1122884 A/chicken/Greece/39_2017a/2017 (A/H5N6) segment 3 (PA) 3866.2 0.000000e+00 2131/2151 (99%) EPI1122876 A/chicken/Greece/39_2017/2017 (A/H5N6) segment 3 (PA) 3866.2 0.000000e+00 2131/2151 (99%) EPI863833 A/Chicken/Sweden/SVA161122KU0453/SZ0209317/2016 (A/H5N8) segment 3 (PA) 3866.2 0.000000e+00 2131/2151 (99%) EPI863825 A/Chicken/Sweden/SVA161122KU0453/SZ0209316/2016 (A/H5N8) segment 3 (PA) 3866.2 0.000000e+00 2131/2151 (99%) EPI877540 A/domestic duck/Germany-MV/R9869/2016 (A/H5N8) segment 3 (PA) 3864.3 0.000000e+00 2131/2151 (99%) EPI1040236 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI1019874 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI1019762 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI1019610 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI1019538 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI1019522 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2132/2152 (99%) EPI1019498 A/Eur_Wig/NL-Akkrum/16015817-003/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI1019458 A/Dk/NL-Biddinghuizen/16015083-016-020/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI1019394 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI1019362 A/Bk_swan/NL-Den Oever/16013973-002/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI967466 A/turkey/Germany-NI/R9807/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI954873 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI954857 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI954809 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI954779 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI931206 A/chicken/Germany-MV/R10048/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI861185 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%) EPI863856 A/Chicken/Sweden/SVA161122KU0453/SZ0209321/2016 (A/H5N8) segment 3 (PA) 3858.8 0.000000e+00 2129/2151 (98%) EPI1019850 A/T_Dk/NL-Zeewolde/16013976-006/2016 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%) EPI1019826 A/T_Dk/NL-Zeewolde/16013976-004/2016 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%) EPI1019818 A/T_Dk/NL-Zeewolde/16013976-001-003/2016 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%) EPI1019810 A/T_Dk/NL-Zeewolde/16013976-001/2016 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%) EPI1019714 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%) EPI1019530 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%) EPI1019466 A/Dk/NL-Biddinghuizen/16015145-021-025/2016 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%) EPI1019450 A/Dk/NL-Biddinghuizen/16014829-011-015/2016 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%) EPI1019410 A/Ch/NL-Den Oever/16014231-001/2016 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%) EPI1019370 A/Bl_H_gull/NL-Slootdorp/16014102-002/2016 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%) EPI954755 A/Peregrine_falcon/Hungary/4882/2017 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%) EPI942942 A/chicken/Wales/000023/2016 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2129/2151 (98%) EPI909363 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2129/2151 (98%) EPI1045594 A/chicken/Shchyolkovo/47/2017 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%) EPI1019626 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%) EPI1007674 A/peacock/Belgium/1017/2017 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2130/2152 (98%) EPI1007666 A/chicken/Belgium/807/2017 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2130/2152 (98%) EPI990782 A/mute swan/Germany-NI/AR1529-L02145/2017 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%) EPI967670 A/domestic duck/Germany-MV/R9764/2016 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2130/2152 (98%) EPI954603 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%) EPI954571 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%) EPI909435 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%) EPI909419 A/chicken/Voronezh/20/2017 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%) EPI909411 A/chicken/Voronezh/19/2017 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
  14. Descriptions Align Segment-ID Name Score E-Value Identity EPI1127536 A/mute swan/Shimane/3211A001/2017 (A/H5N6) segment 2 (PB1) 4209.6 0.000000e+00 2279/2279 (100%) EPI1119048 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 2 (PB1) 4159.8 0.000000e+00 2271/2280 (99%) EPI909458 A/chicken/Kalmykia/2643/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2263/2281 (99%) EPI909450 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2263/2281 (99%) EPI961447 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2262/2281 (99%) EPI1117251 A/T_Dk/NL-Werkendam/16014159-001/2016 (A/H5N5) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019844 A/T_Dk/NL-Zeewolde/16013976-005/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019836 A/T_Dk/NL-Zeewolde/16013976-004-006/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019788 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019780 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019724 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019716 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019708 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019692 A/Gull1/NL-Marker Wadden/16014466-011/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019684 A/Gull/NL-Marker Wadden/16014466-020/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019652 A/G_c_grebe/NL-Monnickendam/16013865-009-010/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019596 A/Eur_Wig/NL-Terschelling/16015692-010/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019460 A/Dk/NL-Biddinghuizen/16015083-016-020/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019396 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019388 A/C_Gull/NL-Slootdorp/16014102-003/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019380 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019372 A/Bl_H_gull/NL-Slootdorp/16014102-002/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI1019364 A/Bk_swan/NL-Den Oever/16013973-002/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI956130 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI922322 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI860495 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI860390 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI860234 A/wild duck/Poland/82A/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2261/2281 (99%) EPI967462 A/domestic duck/Germany-MV/R9764/2016 (A/H5N8) segment 2 (PB1) 4095.1 0.000000e+00 2260/2281 (99%) EPI1044546 A/mute swan/Kaliningrad/132/2017 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019876 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019868 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019860 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019852 A/T_Dk/NL-Zeewolde/16013976-006/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019828 A/T_Dk/NL-Zeewolde/16013976-004/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019820 A/T_Dk/NL-Zeewolde/16013976-001-003/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019812 A/T_Dk/NL-Zeewolde/16013976-001/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019804 A/T_Dk/NL-Werkendam/16014159-003/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019796 A/T_Dk/NL-Werkendam/16014159-002/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019772 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019756 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019668 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019660 A/Go/NL-Roggebotsluis/16014462-010/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019572 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019564 A/Eur_Wig/NL-Groningen/16015376-003/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019540 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019500 A/Eur_Wig/NL-Akkrum/16015817-003/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019484 A/Dk/NL-Rotterdam/16014008-001-005/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019468 A/Dk/NL-Biddinghuizen/16015145-021-025/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019452 A/Dk/NL-Biddinghuizen/16014829-011-015/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019420 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019412 A/Ch/NL-Den Oever/16014231-001/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI969252 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI954781 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI909362 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI885204 A/domestic duck/Germany-MV/R9869/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI881281 A/chicken/Germany-MV/R8790/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI881276 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI863863 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI860398 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI859659 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2260/2281 (99%) EPI1019764 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 2 (PB1) 4087.8 0.000000e+00 2259/2281 (99%) EPI1019748 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 2 (PB1) 4087.8 0.000000e+00 2259/2281 (99%) EPI1019700 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 2 (PB1) 4087.8 0.000000e+00 2259/2281 (99%) EPI1019628 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 2 (PB1) 4087.8 0.000000e+00 2259/2281 (99%) EPI1019556 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 2 (PB1) 4087.8 0.000000e+00 2259/2281 (99%) EPI1019532 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 2 (PB1) 4087.8 0.000000e+00 2259/2281 (99%) EPI962063 A/Turkey/Hungary/53136/2016 (A/H5N8) segment 2 (PB1) 4087.8 0.000000e+00 2259/2281 (99%) EPI954811 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 2 (PB1) 4087.8 0.000000e+00 2259/2281 (99%) EPI954661 A/Goose/Hungary/1030/2017 (A/H5N8) segment 2 (PB1) 4087.8 0.000000e+00 2259/2281 (99%) EPI931205 A/chicken/Germany-MV/R10048/2016 (A/H5N8) segment 2 (PB1) 4087.8 0.000000e+00 2259/2281 (99%) EPI859205 A/domestic_turkey/Hungary/53433/2016 (A/H5N8) segment 2 (PB1) 4087.8 0.000000e+00 2259/2281 (99%) EPI1122891 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI1122875 A/chicken/Greece/39_2017/2017 (A/H5N6) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI1019740 A/Mal/NL-Mastenbroek/16015378-002/2016 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI1019612 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI1019548 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI1019516 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI1019444 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI1007673 A/peacock/Belgium/1017/2017 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI1007665 A/chicken/Belgium/807/2017 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI954875 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI954867 A/White_fronted_goose/Hungary/801/2017 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI954859 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI954819 A/GuineaFowl/Hungary/596/2017 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI954733 A/Mute swan/Hungary/3513/2017 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI909466 A/chicken/Astrakhan/3131/2016 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI860526 A/goose/Hungary/55128/2016 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI860511 A/Mulard_duck/Hungary/54494/2016 (A/H5N8) segment 2 (PB1) 4082.2 0.000000e+00 2258/2281 (98%) EPI863832 A/Chicken/Sweden/SVA161122KU0453/SZ0209317/2016 (A/H5N8) segment 2 (PB1) 4080.4 0.000000e+00 2257/2281 (98%) EPI863824 A/Chicken/Sweden/SVA161122KU0453/SZ0209316/2016 (A/H5N8) segment 2 (PB1) 4080.4 0.000000e+00 2257/2281 (98%) EPI1122883 A/chicken/Greece/39_2017a/2017 (A/H5N6) segment 2 (PB1) 4078.5 0.000000e+00 2257/2281 (98%) EPI863855 A/Chicken/Sweden/SVA161122KU0453/SZ0209321/2016 (A/H5N8) segment 2 (PB1) 4078.5 0.000000e+00 2257/2281 (98%) EPI1032550 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 2 (PB1) 4076.7 0.000000e+00 2257/2281 (98%) EPI1032490 A/Goose/Hungary/17051/2017 (A/H5N8) segment 2 (PB1) 4076.7 0.000000e+00 2257/2281 (98%) EPI1032474 A/Goose/Hungary/17261/2017 (A/H5N8) segment 2 (PB1) 4076.7 0.000000e+00 2257/2281 (98%) EPI1019588 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 2 (PB1) 4076.7 0.000000e+00 2257/2281 (98%) EPI1019524 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 2 (PB1) 4076.7 0.000000e+00 2257/2281 (98%) EPI1019492 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 2 (PB1) 4076.7 0.000000e+00 2257/2281 (98%) EPI1019436 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 2 (PB1) 4076.7 0.000000e+00 2257/2281 (98%)
  15. Descriptions Align Segment-ID Name Score E-Value Identity EPI1127535 A/mute swan/Shimane/3211A001/2017 (A/H5N6) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%) EPI909433 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 1 (PB2) 4167.2 0.000000e+00 2272/2280 (99%) EPI1119037 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%) EPI1019555 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%) EPI1007672 A/peacock/Belgium/1017/2017 (A/H5N8) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%) EPI1007664 A/chicken/Belgium/807/2017 (A/H5N8) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%) EPI869684 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%) EPI1019675 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%) EPI1019619 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%) EPI1019475 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%) EPI1019427 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%) EPI1019395 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%) EPI954874 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%) EPI954858 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%) EPI1019843 A/T_Dk/NL-Zeewolde/16013976-005/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019835 A/T_Dk/NL-Zeewolde/16013976-004-006/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019779 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019771 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019747 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019739 A/Mal/NL-Mastenbroek/16015378-002/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019731 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019723 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019707 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019699 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019683 A/Gull/NL-Marker Wadden/16014466-020/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019667 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019547 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019523 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019515 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019507 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019467 A/Dk/NL-Biddinghuizen/16015145-021-025/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019459 A/Dk/NL-Biddinghuizen/16015083-016-020/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019451 A/Dk/NL-Biddinghuizen/16014829-011-015/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019411 A/Ch/NL-Den Oever/16014231-001/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019387 A/C_Gull/NL-Slootdorp/16014102-003/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019379 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI1019363 A/Bk_swan/NL-Den Oever/16013973-002/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI954810 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI954756 A/Peregrine_falcon/Hungary/4882/2017 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI881279 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI863846 A/Chicken/Sweden/SVA161122KU0453/SZ0209318/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI863831 A/Chicken/Sweden/SVA161122KU0453/SZ0209317/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI863823 A/Chicken/Sweden/SVA161122KU0453/SZ0209316/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI860233 A/wild duck/Poland/82A/2016 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%) EPI988591 A/turkey/Germany-NI/R9807/2016 (A/H5N8) segment 1 (PB2) 4146.8 0.000000e+00 2268/2280 (99%) EPI942932 A/turkey/England/003778/2017 (A/H5N8) segment 1 (PB2) 4146.8 0.000000e+00 2268/2280 (99%) EPI868845 A/turkey/England/052131/2016 (A/H5N8) segment 1 (PB2) 4146.8 0.000000e+00 2268/2280 (99%) EPI863854 A/Chicken/Sweden/SVA161122KU0453/SZ0209321/2016 (A/H5N8) segment 1 (PB2) 4146.8 0.000000e+00 2268/2280 (99%) EPI1117250 A/T_Dk/NL-Werkendam/16014159-001/2016 (A/H5N5) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019787 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019691 A/Gull1/NL-Marker Wadden/16014466-011/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019659 A/Go/NL-Roggebotsluis/16014462-010/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019643 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019635 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019603 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019587 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019571 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019539 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019491 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019443 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019435 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019419 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019371 A/Bl_H_gull/NL-Slootdorp/16014102-002/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI990767 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI969251 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI961446 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI954660 A/Goose/Hungary/1030/2017 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI942940 A/chicken/Wales/000023/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI926625 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI909457 A/chicken/Kalmykia/2643/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI909449 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI909417 A/chicken/Voronezh/20/2017 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI909409 A/chicken/Voronezh/19/2017 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI909401 A/chicken/Voronezh/18/2017 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI909385 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI909377 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI954556 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 1 (PB2) 4141.3 0.000000e+00 2267/2280 (99%) EPI1122890 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1045592 A/chicken/Shchyolkovo/47/2017 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019875 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019867 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019859 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019851 A/T_Dk/NL-Zeewolde/16013976-006/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019827 A/T_Dk/NL-Zeewolde/16013976-004/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019819 A/T_Dk/NL-Zeewolde/16013976-001-003/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019811 A/T_Dk/NL-Zeewolde/16013976-001/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019803 A/T_Dk/NL-Werkendam/16014159-003/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019755 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019651 A/G_c_grebe/NL-Monnickendam/16013865-009-010/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019579 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI1019563 A/Eur_Wig/NL-Groningen/16015376-003/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI961464 A/chicken/Sergiyev Posad/39/2017 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI954780 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI954580 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI954572 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI916719 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI909393 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI895486 A/domestic duck/Germany-MV/R9869/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI869942 A/herring gull/Poland/84/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI860399 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
  16. Descriptions Align Segment-ID Name Score E-Value Identity EPI1127541 A/mute swan/Shimane/3211A001/2017 (A/H5N6) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%) EPI1119074 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 7 (MP) 1796.1 0.000000e+00 976/978 (99%) EPI1019529 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%) EPI961452 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%) EPI909463 A/chicken/Kalmykia/2643/2016 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%) EPI909455 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%) EPI1117256 A/T_Dk/NL-Werkendam/16014159-001/2016 (A/H5N5) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1044552 A/mute swan/Kaliningrad/132/2017 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019841 A/T_Dk/NL-Zeewolde/16013976-005/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019833 A/T_Dk/NL-Zeewolde/16013976-004-006/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019801 A/T_Dk/NL-Werkendam/16014159-003/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019793 A/T_Dk/NL-Werkendam/16014159-002/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019785 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019777 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019745 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019729 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019721 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019705 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019673 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019657 A/Go/NL-Roggebotsluis/16014462-010/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019641 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019633 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019625 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019617 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019585 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019577 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019561 A/Eur_Wig/NL-Groningen/16015376-003/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019489 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019481 A/Dk/NL-Rotterdam/16014008-001-005/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019457 A/Dk/NL-Biddinghuizen/16015083-016-020/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019449 A/Dk/NL-Biddinghuizen/16014829-011-015/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019441 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019425 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019409 A/Ch/NL-Den Oever/16014231-001/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019385 A/C_Gull/NL-Slootdorp/16014102-003/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019369 A/Bl_H_gull/NL-Slootdorp/16014102-002/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1019361 A/Bk_swan/NL-Den Oever/16013973-002/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI967142 A/turkey/Germany-NI/R9807/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI942946 A/chicken/Wales/000023/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI868851 A/turkey/England/052131/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI860404 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI860237 A/wild duck/Poland/82A/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI859654 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%) EPI1040233 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1032553 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1032527 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1032519 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1032511 A/Goose/Hungary/59763/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1032503 A/Goose/Hungary/17985/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1032495 A/Goose/Hungary/17580/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1032487 A/Goose/Hungary/17051/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1032479 A/Goose/Hungary/15729/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1032471 A/Goose/Hungary/17261/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019873 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019849 A/T_Dk/NL-Zeewolde/16013976-006/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019825 A/T_Dk/NL-Zeewolde/16013976-004/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019817 A/T_Dk/NL-Zeewolde/16013976-001-003/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019809 A/T_Dk/NL-Zeewolde/16013976-001/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019769 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019761 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019753 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019697 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019689 A/Gull1/NL-Marker Wadden/16014466-011/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019681 A/Gull/NL-Marker Wadden/16014466-020/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019665 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019649 A/G_c_grebe/NL-Monnickendam/16013865-009-010/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019601 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019593 A/Eur_Wig/NL-Terschelling/16015692-010/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019569 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019553 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019545 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019537 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019521 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019513 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019505 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019473 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019465 A/Dk/NL-Biddinghuizen/16015145-021-025/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019433 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019417 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019401 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI1019377 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI969257 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI963517 A/domestic duck/Germany-MV/R9764/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 971/979 (99%) EPI962050 A/Duck/Hungary/55764/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI962039 A/Duck/Hungary/54738/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI961503 A/turkey/Italy/17VIR1574-1/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI959534 A/Mute swan/Hungary/6276/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI959427 A/chicken/Poland/79A/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI956123 A/Goose/Hungary/59712/2016 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI954832 A/Mute swan/Hungary/3137/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI954778 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI954730 A/Mute swan/Hungary/3513/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI954722 A/Mute swan/Hungary/3139/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI954714 A/Mute swan/Hungary/2825/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI954690 A/Turkey/Hungary/2030/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI954682 A/Mute swan/Hungary/1955/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI954666 A/Duck/Hungary/1588/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI954650 A/Duck/Hungary/984/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI954634 A/Harris Hawk/Hungary/120/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%) EPI954602 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
  17. Descriptions Align Segment-ID Name Score E-Value Identity EPI1127540 A/mute swan/Shimane/3211A001/2017 (A/H5N6) segment 6 (NA) 2603.0 0.000000e+00 1409/1409 (100%) EPI1119073 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%) EPI1122895 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 6 (NA) 2486.7 0.000000e+00 1388/1409 (98%) EPI1122887 A/chicken/Greece/39_2017a/2017 (A/H5N6) segment 6 (NA) 2483.0 0.000000e+00 1387/1409 (98%) EPI1122879 A/chicken/Greece/39_2017/2017 (A/H5N6) segment 6 (NA) 2483.0 0.000000e+00 1387/1409 (98%) EPI1011098 A/barnacle goose/Netherlands/2/2014 (A/H3N6) segment 6 (NA) 2392.5 0.000000e+00 1373/1411 (97%) EPI1036189 A/duck/Moscow/4652/2011 (A/H4N6) segment 6 (NA) 2300.2 0.000000e+00 1355/1410 (96%) EPI1036196 A/duck/Moscow/4781/2012 (A/H4N6) segment 6 (NA) 2276.2 0.000000e+00 1351/1410 (95%) EPI890326 A/mallard duck/Netherlands/19/2012 (A/H4N6) segment 6 (NA) 2259.6 0.000000e+00 1349/1411 (95%) EPI823917 A/teal/Chany Lake/106_ cloaca/2012 (A/H4N6) segment 6 (NA) 2215.3 0.000000e+00 1342/1412 (95%) EPI823909 A/teal/Chany Lake/104_ feather/2012 (A/H4N6) segment 6 (NA) 2215.3 0.000000e+00 1342/1412 (95%) EPI823901 A/teal/Chany Lake/104_cloaca/2012 (A/H4N6) segment 6 (NA) 2215.3 0.000000e+00 1342/1412 (95%) EPI823790 A/shoveller/Chany Lake/101/2012 (A/H4N6) segment 6 (NA) 2215.3 0.000000e+00 1342/1412 (95%) EPI470232 A/duck/Yunnan/87/2007 (A/H7N6) segment 6 (NA) 2215.3 0.000000e+00 1342/1412 (95%) EPI692466 A/duck/Henan/S1091/2010 (A/H4N6) segment 6 (NA) 2209.7 0.000000e+00 1342/1413 (94%) EPI533781 A/Caspian seal/Russia/T1/2012 (A/H4N6) segment 6 (NA) 2209.7 0.000000e+00 1342/1413 (94%) EPI533775 A/Caspian seal/Russia/1884/2002 (A/H4N6) segment 6 (NA) 2209.7 0.000000e+00 1342/1413 (94%) EPI891032 A/mallard duck/Netherlands/30/2014 (A/H4N6) segment 6 (NA) 2198.6 0.000000e+00 1338/1411 (94%) EPI485322 A/eurasian wigeon/Mongolia/340V/2009 (A/H4N6) segment 6 (NA) 2198.6 0.000000e+00 1339/1412 (94%) EPI692506 A/duck/Hunan/S1012/2009 (A/H4N6) segment 6 (NA) 2193.1 0.000000e+00 1339/1413 (94%) EPI414148 A/duck/Jiangsu/4/2010 (A/H3N6) segment 6 (NA) 2193.1 0.000000e+00 1339/1413 (94%) EPI407862 A/Khaki Campbell duck/Karachi/NARC-23963/2010 (A/H4N6) segment 6 (NA) 2189.4 0.000000e+00 1337/1412 (94%) EPI1014700 A/mallard duck/Netherlands/7/2006 (A/H10N6) segment 6 (NA) 2187.6 0.000000e+00 1337/1412 (94%) EPI692346 A/chicken/Hunan/S1267/2010 (A/H4N6) segment 6 (NA) 2187.6 0.000000e+00 1339/1414 (94%) EPI692338 A/chicken/Hunan/S1248/2010 (A/H4N6) segment 6 (NA) 2187.6 0.000000e+00 1339/1414 (94%) EPI395392 A/chicken/India/WB-NIV101006/2009 (A/H4N6) segment 6 (NA) 2187.6 0.000000e+00 1337/1412 (94%) EPI1013418 A/mallard duck/Netherlands/8/2006 (A/H10N6) segment 6 (NA) 2182.0 0.000000e+00 1336/1412 (94%) EPI296530 A/mallard/Netherlands/4/2006 (A/H10N6) segment 6 (NA) 2182.0 0.000000e+00 1336/1412 (94%) EPI168523 A/common pochard/Aktau/1455/2006 (A/H4N6) segment 6 (NA) 2182.0 0.000000e+00 1336/1412 (94%) EPI372354 A/teal/Egypt/09888-NAMRU3/2005 (A/H4N6) segment 6 (NA) 2178.3 0.000000e+00 1336/1412 (94%) EPI890683 A/mallard duck/Netherlands/6/2006 (A/H4N6) segment 6 (NA) 2176.5 0.000000e+00 1335/1412 (94%) EPI401303 A/duck/Korea/DY104/2007 (A/H4N6) segment 6 (NA) 2176.5 0.000000e+00 1336/1413 (94%) EPI243479 A/duck/Vietnam/OIE-2454/2009 (A/H4N6) segment 6 (NA) 2176.5 0.000000e+00 1336/1413 (94%) EPI168522 A/coot/Aktau/1454/2006 (A/H4N6) segment 6 (NA) 2176.5 0.000000e+00 1335/1412 (94%) EPI513237 A/mallard/Sweden/104925/2009 (A/H4N6) segment 6 (NA) 2170.9 0.000000e+00 1334/1412 (94%) EPI540366 A/duck/Bangladesh/1521/2009 (A/H4N6) segment 6 (NA) 2154.3 0.000000e+00 1332/1413 (94%) EPI513749 A/mallard/Sweden/79978/2008 (A/H4N6) segment 6 (NA) 2148.8 0.000000e+00 1330/1412 (94%) EPI513568 A/mallard/Sweden/80348/2008 (A/H0) segment 6 (NA) 2148.8 0.000000e+00 1330/1412 (94%) EPI395393 A/chicken/India/WB-NIV101018/2009 (A/H4N6) segment 6 (NA) 2143.2 0.000000e+00 1330/1413 (94%) EPI1013677 A/mallard duck/Netherlands/10/2013 (A/H4N6) segment 6 (NA) 2137.7 0.000000e+00 1328/1412 (94%) EPI889824 A/mallard duck/Netherlands/27/2009 (A/H4N6) segment 6 (NA) 2137.7 0.000000e+00 1329/1413 (94%) EPI540374 A/duck/Bangladesh/1283/2008 (A/H4N6) segment 6 (NA) 2137.7 0.000000e+00 1329/1413 (94%) EPI485357 A/ruddy shelduck/Mongolia/592/2010 (A/H8N6) segment 6 (NA) 2137.7 0.000000e+00 1328/1412 (94%) EPI284397 A/mallard/Czech Republic/12652/2007 (A/H4N6) segment 6 (NA) 2137.7 0.000000e+00 1324/1407 (94%) EPI704432 A/duck/Mongolia/769/2015 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI618783 A/mallard/Sweden/93475/2009 (A/H10N6) segment 6 (NA) 2132.2 0.000000e+00 1329/1414 (93%) EPI513546 A/mallard/Sweden/101010/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513461 A/mallard/Sweden/101632/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513454 A/mallard/Sweden/101603/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513447 A/mallard/Sweden/101602/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513433 A/mallard/Sweden/101564/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513431 A/mallard/Sweden/101785/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513415 A/mallard/Sweden/101733/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513408 A/mallard/Sweden/101663/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513394 A/mallard/Sweden/101654/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513358 A/mallard/Sweden/101831/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513341 A/mallard/Sweden/104681/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513230 A/mallard/Sweden/104839/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI513163 A/mallard/Sweden/105011/2009 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1328/1413 (93%) EPI461617 A/duck/Hunan/S11893/2012 (A/H4N6) segment 6 (NA) 2132.2 0.000000e+00 1327/1412 (93%) EPI1011235 A/mallard duck/Netherlands/22/2011 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1326/1412 (93%) EPI692554 A/duck/Jiangxi/S2443/2012 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1326/1412 (93%) EPI540358 A/duck/Bangladesh/1766/2010 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1326/1412 (93%) EPI514901 A/mallard/Sweden/105093/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513514 A/mallard/Sweden/101524/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513507 A/mallard/Sweden/101504/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513493 A/mallard/Sweden/101329/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513475 A/mallard/Sweden/101642/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513468 A/mallard/Sweden/101640/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513424 A/mallard/Sweden/101782/2009 (A/H0) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513386 A/mallard/Sweden/102029/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513379 A/mallard/Sweden/102024/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513334 A/mallard/Sweden/102157/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513327 A/mallard/Sweden/102124/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1328/1414 (93%) EPI513320 A/mallard/Sweden/102114/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513306 A/mallard/Sweden/102045/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513244 A/mallard/Sweden/104931/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513216 A/mallard/Sweden/104793/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1328/1414 (93%) EPI513209 A/mallard/Sweden/104690/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1328/1414 (93%) EPI513205 A/mallard/Sweden/102250/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1328/1414 (93%) EPI513184 A/mallard/Sweden/105516/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513177 A/mallard/Sweden/105137/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI513170 A/mallard/Sweden/105012/2009 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1327/1413 (93%) EPI357825 A/duck/Mongolia/OIE-7438/2011 (A/H4N6) segment 6 (NA) 2126.6 0.000000e+00 1326/1412 (93%) EPI704293 A/duck/Mongolia/127/2015 (A/H4N6) segment 6 (NA) 2121.1 0.000000e+00 1326/1413 (93%) EPI704269 A/duck/Mongolia/101/2015 (A/H4N6) segment 6 (NA) 2121.1 0.000000e+00 1326/1413 (93%) EPI513313 A/mallard/Sweden/102056/2009 (A/H4N6) segment 6 (NA) 2121.1 0.000000e+00 1326/1413 (93%) EPI470233 A/wild waterfowl/Hong Kong/MPM3375/2011 (A/H7N6) segment 6 (NA) 2121.1 0.000000e+00 1326/1413 (93%) EPI222097 A/garganey/Altai/1216/2007 (A/H3N6) segment 6 (NA) 2117.4 0.000000e+00 1325/1413 (93%) EPI540382 A/duck/Bangladesh/1784/2010 (A/H4N6) segment 6 (NA) 2115.5 0.000000e+00 1324/1412 (93%) EPI540350 A/duck/Bangladesh/1783/2010 (A/H4N6) segment 6 (NA) 2115.5 0.000000e+00 1324/1412 (93%) EPI316770 A/mallard/Czech Republic/13579-84K/2010 (A/H4N6) segment 6 (NA) 2115.5 0.000000e+00 1323/1410 (93%) EPI222166 A/mallard/Altai/1208/2007 (A/H3N6) segment 6 (NA) 2115.5 0.000000e+00 1325/1413 (93%) EPI965451 A/duck/Bangladesh/26974/2015 (A/H3N6) segment 6 (NA) 2110.0 0.000000e+00 1325/1414 (93%) EPI513198 A/mallard/Sweden/124418/2010 (A/H4N6) segment 6 (NA) 2110.0 0.000000e+00 1323/1412 (93%) EPI475927 A/mallard/Iceland/1007/2011 (A/H3N6) segment 6 (NA) 2110.0 0.000000e+00 1323/1412 (93%) EPI965498 A/duck/Bangladesh/26920/2015 (A/H3N6) segment 6 (NA) 2104.5 0.000000e+00 1324/1414 (93%) EPI965444 A/duck/Bangladesh/25891/2015 (A/H4N6) segment 6 (NA) 2104.5 0.000000e+00 1323/1413 (93%) EPI965369 A/duck/Bangladesh/26948/2015 (A/H3N6) segment 6 (NA) 2104.5 0.000000e+00 1324/1414 (93%) EPI965295 A/duck/Bangladesh/26918/2015 (A/H3N6) segment 6 (NA) 2104.5 0.000000e+00 1324/1414 (93%)
  18. Descriptions Align Segment-ID Name Score E-Value Identity EPI1127538 A/mute swan/Shimane/3211A001/2017 (A/H5N6) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1119065 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1704 (99%) EPI1045611 A/chicken/Rostov/44/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3061.0 0.000000e+00 1688/1704 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019446 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1019382 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI954783 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI863865 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI861224 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI860393 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3055.5 0.000000e+00 1687/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3055.5 0.000000e+00 1686/1702 (99%) EPI1021132 A/goose/Czech Republic/1954-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1021130 A/mute swan/Czech Republic/1848-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%) EPI1021129 A/mute swan/Czech Republic/1848-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019742 A/Mal/NL-Mastenbroek/16015378-002/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019686 A/Gull/NL-Marker Wadden/16014466-020/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019566 A/Eur_Wig/NL-Groningen/16015376-003/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019502 A/Eur_Wig/NL-Akkrum/16015817-003/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019486 A/Dk/NL-Rotterdam/16014008-001-005/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019470 A/Dk/NL-Biddinghuizen/16015145-021-025/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019462 A/Dk/NL-Biddinghuizen/16015083-016-020/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019454 A/Dk/NL-Biddinghuizen/16014829-011-015/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019422 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019414 A/Ch/NL-Den Oever/16014231-001/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019374 A/Bl_H_gull/NL-Slootdorp/16014102-002/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI1019366 A/Bk_swan/NL-Den Oever/16013973-002/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI963516 A/domestic duck/Germany-MV/R9764/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI961449 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI942935 A/turkey/England/003778/2017 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI931145 A/duck/Czech Republic/1467-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI909428 A/turkey/Rostov/11/2017 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
  19. LOCUS LC335983 1741 bp cRNA linear VRL 30-NOV-2017 DEFINITION Influenza A virus (A/mute swan/Shimane/3211A001/2017(H5N6)) viral cRNA, segment 4, complete sequence. ACCESSION LC335983 VERSION LC335983.1 KEYWORDS . SOURCE Influenza A virus ORGANISM Influenza A virus Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 AUTHORS Soda,K., Ito,H., Usui,T., Ozaki,H., Murase,T., Yamaguchi,T. and Ito,T. TITLE H5N6 highly pathogenic avian influenza virus isolates in Japan in 2017-18 JOURNAL Unpublished REFERENCE 2 (bases 1 to 1741) AUTHORS Ito,H., Soda,K., Usui,T., Ozaki,H., Murase,T., Yamaguchi,T. and Ito,T. TITLE Direct Submission JOURNAL Submitted (19-NOV-2017) Contact:Kosuke Soda Tottori University, Avian Zoonosis Research Center, Faculty of Agriculture; Koyama-Minami 4-101, Tottori, Tottori 680-8553, Japan URL :http://www.tottori-u.ac.jp/ FEATURES Location/Qualifiers source 1..1741 /organism="Influenza A virus" /mol_type="viral cRNA" /strain="A/mute swan/Shimane/3211A001/2017" /serotype="H5N6" /host="Cygnus olor" /db_xref="taxon:11320" /segment="4" /country="Japan:Shimane" /collection_date="2017-11-05" gene 15..1718 /gene="HA" CDS 15..1718 /gene="HA" /codon_start=1 /product="hemagglutinin" /protein_id="BBB21614.1" /translation="MENIVLLLAIISLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLINKNDAYPTIKISYNNTNREDLLILWGIHHPNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSGVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC I" ORIGIN 1 ttcactctgt caaaatggag aacatagtgc ttcttcttgc aataattagc cttgttaaaa 61 gtgatcagat ttgcattggt taccatgcaa acaactcgac agagcaagtt gacacgataa 121 tggaaaagaa cgtcactgtt acacatgccc aagacatact ggaaaaaaca cacaacggga 181 agctctgcga tctaaatggg gtgaagcctc tgattttaaa ggattgtagt gtagctggat 241 ggctcctcgg gaacccaatg tgcgacgaat tcatcagagt gccggaatgg tcttacatag 301 tggagagggc taatccagct aatgacctct gttacccagg gagtctcaat gactatgaag 361 aactgaaaca cctgttgagc agaataaatc attttgagaa gattctgatc atccccaaga 421 gttcttggcc caatcatgaa acatcattag gggtgagcgc agcttgtcca taccagggaa 481 caccctcctt tttcagaaat gtggtatggc ttatcaataa gaacgatgca tacccaacaa 541 taaagataag ctacaataat accaatcggg aagatctctt gatactgtgg gggattcatc 601 atcccaacaa tgcggaagag cagacaaatc tttataaaaa cccaaccacc tatatttcag 661 ttggaacatc aacattaaac cagagattgg taccaaaaat agctactaga tcccaagtaa 721 acgggcaacg tggaagaatg gacttcttct ggacaatttt aaaaccgaat gatgcaatcc 781 atttcgagag taatggaaat ttcattgctc cagaatatgc atacaaaatt gtcaagaaag 841 gggactcaac aattatgaaa agtggagtgg aatatggcca ctgcaacacc aaatgtcaaa 901 ccccagtagg agcgataaac tctagtatgc cgttccacaa tatacatcct ctcaccatcg 961 gggaatgccc caaatacgtg aagtcaaaca agttggtcct tgcgactggg ctcagaaata 1021 gtcctctaag agaaaggaga agaaagagag ggctgtttgg ggctatagca ggttttatag 1081 agggaggatg gcagggaatg gttgatggtt ggtatgggta ccaccatagc aatgagcagg 1141 gaagtggata cgctgcagac aaagaatcca cccaaaaggc aatagatgga gttaccaata 1201 aggtcaactc gatcattgac aaaatgaaca ctcaatttga ggcagttgga agggagttta 1261 ataacttaga aaggaggata gagaatttga acaagaaaat ggaagacgga ttcctagatg 1321 tctggaccta taatgctgaa cttctagttc tcatggaaaa cgagaggact ctagatttcc 1381 atgactcaaa tgtcaagaac ctttacgaca aagtcagact gcagcttagg gataatgcaa 1441 aggagctggg taacggttgt ttcgaattct atcacaaatg tgataatgaa tgtatggaaa 1501 gtgtgagaaa tgggacgtat gactaccctc agtattcaga agaagcaaga ttaaaaagag 1561 aagaaataag cggagtgaaa ttagaatcaa taggaactta ccaaatactg tcaatttatt 1621 caacagtggc gagttcccta gcactggcaa tcatggtggc tggtctatct ttatggatgt 1681 gctccaatgg gtcgttacag tgcagaattt gcatttaaat ttgtgagctc agattgtagt 1741 t
  20. Descriptions Align Segment-ID Name Score E-Value Identity EPI1119075 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%) EPI1081973 A/goose/Italy/17VIR6358-3/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI1081921 A/swan/Italy/17VIR7064-1/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI1032556 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI1032542 A/Goose/Hungary/64909/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI1032534 A/Goose/Hungary/63743/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI1032526 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI1032518 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI1032510 A/Goose/Hungary/59763/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI1032502 A/Goose/Hungary/17985/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI1032494 A/Goose/Hungary/17580/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI1032486 A/Goose/Hungary/17051/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI1032470 A/Goose/Hungary/17261/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI962038 A/Duck/Hungary/54738/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI959557 A/Rook/Hungary/4975/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI959533 A/Mute swan/Hungary/6276/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI956131 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI954863 A/White_fronted_goose/Hungary/801/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI954831 A/Mute swan/Hungary/3137/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI954815 A/GuineaFowl/Hungary/596/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI954721 A/Mute swan/Hungary/3139/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI954673 A/Greylag_goose/Hungary/1941/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI954633 A/Harris Hawk/Hungary/120/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI954601 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI888092 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI866975 A/chicken/Hungary/59048/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI860533 A/duck/Hungary/55191/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI860520 A/goose/Hungary/55128/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI860517 A/Mulard_duck/Hungary/54494/2016 (A/H5N8) segment 8 (NS) 1539.4 0.000000e+00 835/836 (99%) EPI916717 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%) EPI909368 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%) EPI860499 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%) EPI860397 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%) EPI1126358 A/mute swan/Czech Republic/1060-17/2017 (H5N8) (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1093385 A/mute swan/Czech Republic/1058-17/2017 (H5N8) (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1085346 A/goose/Czech Republic/136-17_1/2017 (H5N8) (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1081898 A/turkey/Czech Republic/38-17_1/2017 (H5N8) (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1081886 A/mute swan/Czech Republic/54-17_2/2017 (H5N8) (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1045979 A/unknown/Tatarstan/94/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1045621 A/chicken/Tatarstan/88/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1045599 A/chicken/Shchyolkovo/47/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1040235 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1040230 A/turkey/Italy/17VIR5878-3/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1032478 A/Goose/Hungary/15729/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1019848 A/T_Dk/NL-Zeewolde/16013976-006/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1019824 A/T_Dk/NL-Zeewolde/16013976-004/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1019816 A/T_Dk/NL-Zeewolde/16013976-001-003/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1019808 A/T_Dk/NL-Zeewolde/16013976-001/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1019760 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1019712 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1019624 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1019528 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI1007679 A/peacock/Belgium/1017/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI969258 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI962059 A/Turkey/Hungary/53136/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI962048 A/Duck/Hungary/55764/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI961471 A/chicken/Sergiyev Posad/39/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI961463 A/chicken/Sergiyev Posad/38/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI956122 A/Goose/Hungary/59712/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI954839 A/Mallard/Hungary/5821/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI954823 A/Chicken/Hungary/1751/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI954745 A/Chicken/Hungary/2496/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI954713 A/Mute swan/Hungary/2825/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI954705 A/Mute swan/Hungary/2508/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI954585 A/turkey/Italy/17VIR973-2/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI954569 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI953757 A/mallard/Hungary/57857/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI909470 A/chicken/Astrakhan/3131/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI909448 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI909440 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI909424 A/chicken/Voronezh/20/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI909416 A/chicken/Voronezh/19/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI909408 A/chicken/Voronezh/18/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI909400 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI909392 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI909384 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI866979 A/duck/Hungary/60441/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI859211 A/domestic_turkey/Hungary/53433/2016 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 834/836 (99%) EPI959429 A/chicken/Poland/79A/2016 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%) EPI869691 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 833/835 (99%) EPI863869 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 833/835 (99%) EPI1007671 A/chicken/Belgium/807/2017 (A/H5N8) segment 8 (NS) 1530.1 0.000000e+00 833/836 (99%) EPI1122897 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1122889 A/chicken/Greece/39_2017a/2017 (A/H5N6) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1122881 A/chicken/Greece/39_2017/2017 (A/H5N6) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1117257 A/T_Dk/NL-Werkendam/16014159-001/2016 (A/H5N5) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1081891 A/chicken/Czech Republic/55-17_1/2017 (H5N8) (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1045971 A/unknown/Tatarstan/86/2017 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019872 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019856 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019840 A/T_Dk/NL-Zeewolde/16013976-005/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019832 A/T_Dk/NL-Zeewolde/16013976-004-006/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019800 A/T_Dk/NL-Werkendam/16014159-003/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019792 A/T_Dk/NL-Werkendam/16014159-002/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019784 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019776 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019768 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019752 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019688 A/Gull1/NL-Marker Wadden/16014466-011/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%) EPI1019680 A/Gull/NL-Marker Wadden/16014466-020/2016 (A/H5N8) segment 8 (NS) 1528.3 0.000000e+00 833/836 (99%)
  21. Animal Health Research Institute in Taipai, Taiwan has released a full H5N6 sequence from a black-faced spoonbill collected December 1, 2017. The sequence was closely related to H5N6 isolated in Greece in February. That sequence was closely related to H5N8, with the exception of the N6 which was closely related to low path N6 isolates circulating in Eurasian wild birds.
  22. Descriptions Align Segment-ID Name Score E-Value Identity EPI1119072 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 5 (NP) 2765.6 0.000000e+00 1497/1497 (100%) EPI1117254 A/T_Dk/NL-Werkendam/16014159-001/2016 (A/H5N5) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1044548 A/mute swan/Kaliningrad/132/2017 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019791 A/T_Dk/NL-Werkendam/16014159-002/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019783 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019775 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019767 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019759 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019751 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019743 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019695 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019687 A/Gull1/NL-Marker Wadden/16014466-011/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019679 A/Gull/NL-Marker Wadden/16014466-020/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019663 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019655 A/Go/NL-Roggebotsluis/16014462-010/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019647 A/G_c_grebe/NL-Monnickendam/16013865-009-010/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019479 A/Dk/NL-Rotterdam/16014008-001-005/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019407 A/Ch/NL-Den Oever/16014231-001/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019383 A/C_Gull/NL-Slootdorp/16014102-003/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019367 A/Bl_H_gull/NL-Slootdorp/16014102-002/2016 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%) EPI1019839 A/T_Dk/NL-Zeewolde/16013976-005/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019831 A/T_Dk/NL-Zeewolde/16013976-004-006/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019799 A/T_Dk/NL-Werkendam/16014159-003/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019735 A/Mal/NL-Mastenbroek/16015378-002/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019719 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019703 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019623 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019607 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019559 A/Eur_Wig/NL-Groningen/16015376-003/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019527 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI1019375 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI954776 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI906264 A/chicken/Germany-MV/R8790/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI860394 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%) EPI861394 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 5 (NP) 2717.5 0.000000e+00 1488/1497 (99%) EPI1019863 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1489/1498 (99%) EPI1019855 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1489/1498 (99%) EPI1019847 A/T_Dk/NL-Zeewolde/16013976-006/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI1019711 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI1019567 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI1019463 A/Dk/NL-Biddinghuizen/16015145-021-025/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI1019455 A/Dk/NL-Biddinghuizen/16015083-016-020/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI1019447 A/Dk/NL-Biddinghuizen/16014829-011-015/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI1019439 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI1019359 A/Bk_swan/NL-Den Oever/16013973-002/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI990779 A/mute swan/Germany-NI/AR1529-L02145/2017 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI988592 A/turkey/Germany-NI/R9807/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI909365 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI906263 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI888670 A/domestic duck/Germany-MV/R9869/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI860402 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI859656 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%) EPI1122886 A/chicken/Greece/39_2017a/2017 (A/H5N6) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1122878 A/chicken/Greece/39_2017/2017 (A/H5N6) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019871 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019823 A/T_Dk/NL-Zeewolde/16013976-004/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019815 A/T_Dk/NL-Zeewolde/16013976-001-003/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019807 A/T_Dk/NL-Zeewolde/16013976-001/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019591 A/Eur_Wig/NL-Terschelling/16015692-010/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1019415 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI961450 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI926626 A/chicken/Germany-MV/R10048/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1486/1497 (99%) EPI909453 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI909421 A/chicken/Voronezh/20/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI909413 A/chicken/Voronezh/19/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI909405 A/chicken/Voronezh/18/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI909397 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI909389 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI909381 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%) EPI1122894 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI1040234 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI1019535 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI988588 A/domestic duck/Germany-MV/R9764/2016 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI969255 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI954752 A/Peregrine_falcon/Hungary/4882/2017 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI954600 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI954568 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI909461 A/chicken/Kalmykia/2643/2016 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI909437 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%) EPI1081970 A/goose/Italy/17VIR6358-3/2017 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI1081922 A/swan/Italy/17VIR7064-1/2017 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI1019615 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI1019599 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI1019543 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI1019511 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI1019503 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI1019495 A/Eur_Wig/NL-Akkrum/16015817-003/2016 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI1019487 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI1019471 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI954870 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI954854 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI954806 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI954656 A/Goose/Hungary/1030/2017 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI942936 A/turkey/England/003778/2017 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI888089 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI868849 A/turkey/England/052131/2016 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%) EPI1045609 A/chicken/Rostov/44/2017 (A/H5N8) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%) EPI1019727 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%) EPI1019671 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%) EPI1019639 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
  23. Descriptions Align Segment-ID Name Score E-Value Identity EPI1119057 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 3 (PA) 3936.3 0.000000e+00 2131/2131 (100%) EPI1019730 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 3 (PA) 3858.8 0.000000e+00 2117/2131 (99%) EPI1019634 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 3 (PA) 3858.8 0.000000e+00 2117/2131 (99%) EPI1019578 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 3 (PA) 3858.8 0.000000e+00 2117/2131 (99%) EPI1019434 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 3 (PA) 3858.8 0.000000e+00 2117/2131 (99%) EPI1019426 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 3 (PA) 3858.8 0.000000e+00 2117/2131 (99%) EPI868847 A/turkey/England/052131/2016 (A/H5N8) segment 3 (PA) 3858.8 0.000000e+00 2117/2131 (99%) EPI1019674 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2116/2131 (99%) EPI1019642 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2116/2131 (99%) EPI1019618 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2116/2131 (99%) EPI1019602 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2116/2131 (99%) EPI1019514 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2116/2131 (99%) EPI1019506 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2116/2131 (99%) EPI1019474 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2116/2131 (99%) EPI1019402 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2116/2131 (99%) EPI990766 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2116/2131 (99%) EPI942934 A/turkey/England/003778/2017 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2116/2131 (99%) EPI909427 A/turkey/Rostov/11/2017 (A/H5N8) segment 3 (PA) 3853.2 0.000000e+00 2116/2131 (99%) EPI1019842 A/T_Dk/NL-Zeewolde/16013976-005/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI1019834 A/T_Dk/NL-Zeewolde/16013976-004-006/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI1019786 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI1019698 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI1019594 A/Eur_Wig/NL-Terschelling/16015692-010/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI1019570 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI1019554 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI1019490 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI1019482 A/Dk/NL-Rotterdam/16014008-001-005/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI969253 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI909459 A/chicken/Kalmykia/2643/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI909451 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI909443 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI860400 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI860235 A/wild duck/Poland/82A/2016 (A/H5N8) segment 3 (PA) 3847.7 0.000000e+00 2115/2131 (99%) EPI863848 A/Chicken/Sweden/SVA161122KU0453/SZ0209318/2016 (A/H5N8) segment 3 (PA) 3844.0 0.000000e+00 2114/2131 (99%) EPI1122892 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1045608 A/chicken/Rostov/44/2017 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1019866 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1019858 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1019778 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1019754 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1019682 A/Gull/NL-Marker Wadden/16014466-020/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1019586 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1019546 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1019498 A/Eur_Wig/NL-Akkrum/16015817-003/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1019418 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1019386 A/C_Gull/NL-Slootdorp/16014102-003/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI961448 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI954555 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI881285 A/chicken/Germany-MV/R8790/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI869686 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2115/2132 (99%) EPI863864 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI860392 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI859658 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2114/2131 (99%) EPI1122884 A/chicken/Greece/39_2017a/2017 (A/H5N6) segment 3 (PA) 3840.3 0.000000e+00 2113/2131 (99%) EPI1122876 A/chicken/Greece/39_2017/2017 (A/H5N6) segment 3 (PA) 3840.3 0.000000e+00 2113/2131 (99%) EPI863833 A/Chicken/Sweden/SVA161122KU0453/SZ0209317/2016 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2113/2131 (99%) EPI863825 A/Chicken/Sweden/SVA161122KU0453/SZ0209316/2016 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2113/2131 (99%) EPI877540 A/domestic duck/Germany-MV/R9869/2016 (A/H5N8) segment 3 (PA) 3838.5 0.000000e+00 2113/2131 (99%) EPI1040236 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI1019874 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI1019762 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI1019610 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI1019538 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI1019522 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2114/2132 (99%) EPI1019458 A/Dk/NL-Biddinghuizen/16015083-016-020/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI1019394 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI1019362 A/Bk_swan/NL-Den Oever/16013973-002/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI967670 A/domestic duck/Germany-MV/R9764/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI967466 A/turkey/Germany-NI/R9807/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI954873 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI954857 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI954809 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI954779 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI931206 A/chicken/Germany-MV/R10048/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI861185 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2113/2131 (99%) EPI863856 A/Chicken/Sweden/SVA161122KU0453/SZ0209321/2016 (A/H5N8) segment 3 (PA) 3832.9 0.000000e+00 2111/2131 (99%) EPI1019850 A/T_Dk/NL-Zeewolde/16013976-006/2016 (A/H5N8) segment 3 (PA) 3831.1 0.000000e+00 2112/2131 (99%) EPI1019826 A/T_Dk/NL-Zeewolde/16013976-004/2016 (A/H5N8) segment 3 (PA) 3831.1 0.000000e+00 2112/2131 (99%) EPI1019818 A/T_Dk/NL-Zeewolde/16013976-001-003/2016 (A/H5N8) segment 3 (PA) 3831.1 0.000000e+00 2112/2131 (99%) EPI1019810 A/T_Dk/NL-Zeewolde/16013976-001/2016 (A/H5N8) segment 3 (PA) 3831.1 0.000000e+00 2112/2131 (99%) EPI1019714 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 3 (PA) 3831.1 0.000000e+00 2112/2131 (99%) EPI1019530 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 3 (PA) 3831.1 0.000000e+00 2112/2131 (99%) EPI1019466 A/Dk/NL-Biddinghuizen/16015145-021-025/2016 (A/H5N8) segment 3 (PA) 3831.1 0.000000e+00 2112/2131 (99%) EPI1019450 A/Dk/NL-Biddinghuizen/16014829-011-015/2016 (A/H5N8) segment 3 (PA) 3831.1 0.000000e+00 2112/2131 (99%) EPI1019410 A/Ch/NL-Den Oever/16014231-001/2016 (A/H5N8) segment 3 (PA) 3831.1 0.000000e+00 2112/2131 (99%) EPI1019370 A/Bl_H_gull/NL-Slootdorp/16014102-002/2016 (A/H5N8) segment 3 (PA) 3831.1 0.000000e+00 2112/2131 (99%) EPI954755 A/Peregrine_falcon/Hungary/4882/2017 (A/H5N8) segment 3 (PA) 3831.1 0.000000e+00 2112/2131 (99%) EPI942942 A/chicken/Wales/000023/2016 (A/H5N8) segment 3 (PA) 3827.4 0.000000e+00 2111/2131 (99%) EPI909363 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 3 (PA) 3827.4 0.000000e+00 2111/2131 (99%) EPI1045594 A/chicken/Shchyolkovo/47/2017 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2111/2131 (99%) EPI1019626 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2111/2131 (99%) EPI1007674 A/peacock/Belgium/1017/2017 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2112/2132 (99%) EPI1007666 A/chicken/Belgium/807/2017 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2112/2132 (99%) EPI990782 A/mute swan/Germany-NI/AR1529-L02145/2017 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2111/2131 (99%) EPI954603 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2111/2131 (99%) EPI954571 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2111/2131 (99%) EPI909435 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2111/2131 (99%) EPI909419 A/chicken/Voronezh/20/2017 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2111/2131 (99%) EPI909411 A/chicken/Voronezh/19/2017 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2111/2131 (99%) EPI909403 A/chicken/Voronezh/18/2017 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2111/2131 (99%)
  24. Descriptions Align Segment-ID Name Score E-Value Identity EPI1119048 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 2 (PB1) 4209.6 0.000000e+00 2279/2279 (100%) EPI909458 A/chicken/Kalmykia/2643/2016 (A/H5N8) segment 2 (PB1) 4126.5 0.000000e+00 2265/2280 (99%) EPI909450 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 2 (PB1) 4126.5 0.000000e+00 2265/2280 (99%) EPI961447 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 2 (PB1) 4121.0 0.000000e+00 2264/2280 (99%) EPI1117251 A/T_Dk/NL-Werkendam/16014159-001/2016 (A/H5N5) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019844 A/T_Dk/NL-Zeewolde/16013976-005/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019836 A/T_Dk/NL-Zeewolde/16013976-004-006/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019788 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019780 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019724 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019716 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019708 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019692 A/Gull1/NL-Marker Wadden/16014466-011/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019684 A/Gull/NL-Marker Wadden/16014466-020/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019652 A/G_c_grebe/NL-Monnickendam/16013865-009-010/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019596 A/Eur_Wig/NL-Terschelling/16015692-010/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019460 A/Dk/NL-Biddinghuizen/16015083-016-020/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019396 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019388 A/C_Gull/NL-Slootdorp/16014102-003/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019380 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019372 A/Bl_H_gull/NL-Slootdorp/16014102-002/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI1019364 A/Bk_swan/NL-Den Oever/16013973-002/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI956130 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI922322 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI860495 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI860390 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI860234 A/wild duck/Poland/82A/2016 (A/H5N8) segment 2 (PB1) 4115.5 0.000000e+00 2263/2280 (99%) EPI967462 A/domestic duck/Germany-MV/R9764/2016 (A/H5N8) segment 2 (PB1) 4111.8 0.000000e+00 2262/2280 (99%) EPI1044546 A/mute swan/Kaliningrad/132/2017 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019876 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019868 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019860 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019852 A/T_Dk/NL-Zeewolde/16013976-006/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019828 A/T_Dk/NL-Zeewolde/16013976-004/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019820 A/T_Dk/NL-Zeewolde/16013976-001-003/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019812 A/T_Dk/NL-Zeewolde/16013976-001/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019804 A/T_Dk/NL-Werkendam/16014159-003/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019796 A/T_Dk/NL-Werkendam/16014159-002/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019772 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019756 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019668 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019660 A/Go/NL-Roggebotsluis/16014462-010/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019572 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019564 A/Eur_Wig/NL-Groningen/16015376-003/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019540 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019500 A/Eur_Wig/NL-Akkrum/16015817-003/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019484 A/Dk/NL-Rotterdam/16014008-001-005/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019468 A/Dk/NL-Biddinghuizen/16015145-021-025/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019452 A/Dk/NL-Biddinghuizen/16014829-011-015/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019420 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019412 A/Ch/NL-Den Oever/16014231-001/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI969252 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI954781 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI909362 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI885204 A/domestic duck/Germany-MV/R9869/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI881281 A/chicken/Germany-MV/R8790/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI881276 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI863863 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI860398 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI859659 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2262/2280 (99%) EPI1019764 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2261/2280 (99%) EPI1019748 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2261/2280 (99%) EPI1019700 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2261/2280 (99%) EPI1019628 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2261/2280 (99%) EPI1019556 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2261/2280 (99%) EPI1019532 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2261/2280 (99%) EPI962063 A/Turkey/Hungary/53136/2016 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2261/2280 (99%) EPI954811 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2261/2280 (99%) EPI954661 A/Goose/Hungary/1030/2017 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2261/2280 (99%) EPI931205 A/chicken/Germany-MV/R10048/2016 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2261/2280 (99%) EPI859205 A/domestic_turkey/Hungary/53433/2016 (A/H5N8) segment 2 (PB1) 4104.4 0.000000e+00 2261/2280 (99%) EPI1122891 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI1122875 A/chicken/Greece/39_2017/2017 (A/H5N6) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI1019740 A/Mal/NL-Mastenbroek/16015378-002/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI1019612 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI1019548 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI1019516 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI1019444 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI1007673 A/peacock/Belgium/1017/2017 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI1007665 A/chicken/Belgium/807/2017 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI954875 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI954867 A/White_fronted_goose/Hungary/801/2017 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI954859 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI954819 A/GuineaFowl/Hungary/596/2017 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI954733 A/Mute swan/Hungary/3513/2017 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI909466 A/chicken/Astrakhan/3131/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI860526 A/goose/Hungary/55128/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI860511 A/Mulard_duck/Hungary/54494/2016 (A/H5N8) segment 2 (PB1) 4098.8 0.000000e+00 2260/2280 (99%) EPI863832 A/Chicken/Sweden/SVA161122KU0453/SZ0209317/2016 (A/H5N8) segment 2 (PB1) 4097.0 0.000000e+00 2259/2280 (99%) EPI863824 A/Chicken/Sweden/SVA161122KU0453/SZ0209316/2016 (A/H5N8) segment 2 (PB1) 4097.0 0.000000e+00 2259/2280 (99%) EPI1122883 A/chicken/Greece/39_2017a/2017 (A/H5N6) segment 2 (PB1) 4095.1 0.000000e+00 2259/2280 (99%) EPI863855 A/Chicken/Sweden/SVA161122KU0453/SZ0209321/2016 (A/H5N8) segment 2 (PB1) 4095.1 0.000000e+00 2259/2280 (99%) EPI1032550 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2259/2280 (99%) EPI1032490 A/Goose/Hungary/17051/2017 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2259/2280 (99%) EPI1032474 A/Goose/Hungary/17261/2017 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2259/2280 (99%) EPI1019588 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2259/2280 (99%) EPI1019524 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2259/2280 (99%) EPI1019492 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2259/2280 (99%) EPI1019436 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2259/2280 (99%) EPI1019428 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 2 (PB1) 4093.3 0.000000e+00 2259/2280 (99%)
  25. Align Segment-ID Name Score E-Value Identity EPI1119037 A/spoonbill/Taiwan/DB645/2017 (A/H5N6) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%) EPI1019555 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1007672 A/peacock/Belgium/1017/2017 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1007664 A/chicken/Belgium/807/2017 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%) EPI1019395 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI954874 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI954858 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI909433 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%) EPI954810 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%) EPI954756 A/Peregrine_falcon/Hungary/4882/2017 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%) EPI869684 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%) EPI1019675 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%) EPI1019619 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%) EPI1019475 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%) EPI1019427 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%) EPI954660 A/Goose/Hungary/1030/2017 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%) EPI926625 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%) EPI954556 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 1 (PB2) 4124.7 0.000000e+00 2264/2280 (99%) EPI1045592 A/chicken/Shchyolkovo/47/2017 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019843 A/T_Dk/NL-Zeewolde/16013976-005/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019835 A/T_Dk/NL-Zeewolde/16013976-004-006/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019779 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019771 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019747 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019739 A/Mal/NL-Mastenbroek/16015378-002/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019731 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019723 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019707 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019699 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019683 A/Gull/NL-Marker Wadden/16014466-020/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019667 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019547 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019523 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019515 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019507 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019467 A/Dk/NL-Biddinghuizen/16015145-021-025/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019459 A/Dk/NL-Biddinghuizen/16015083-016-020/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019451 A/Dk/NL-Biddinghuizen/16014829-011-015/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019411 A/Ch/NL-Den Oever/16014231-001/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019387 A/C_Gull/NL-Slootdorp/16014102-003/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019379 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI1019363 A/Bk_swan/NL-Den Oever/16013973-002/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI961464 A/chicken/Sergiyev Posad/39/2017 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI954572 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI881279 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI863846 A/Chicken/Sweden/SVA161122KU0453/SZ0209318/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI863831 A/Chicken/Sweden/SVA161122KU0453/SZ0209317/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI863823 A/Chicken/Sweden/SVA161122KU0453/SZ0209316/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI860233 A/wild duck/Poland/82A/2016 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%) EPI988591 A/turkey/Germany-NI/R9807/2016 (A/H5N8) segment 1 (PB2) 4119.1 0.000000e+00 2263/2280 (99%) EPI942932 A/turkey/England/003778/2017 (A/H5N8) segment 1 (PB2) 4119.1 0.000000e+00 2263/2280 (99%) EPI868845 A/turkey/England/052131/2016 (A/H5N8) segment 1 (PB2) 4119.1 0.000000e+00 2263/2280 (99%) EPI863854 A/Chicken/Sweden/SVA161122KU0453/SZ0209321/2016 (A/H5N8) segment 1 (PB2) 4119.1 0.000000e+00 2263/2280 (99%) EPI1117250 A/T_Dk/NL-Werkendam/16014159-001/2016 (A/H5N5) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1044543 A/mute swan/Kaliningrad/132/2017 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1040238 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019787 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019691 A/Gull1/NL-Marker Wadden/16014466-011/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019659 A/Go/NL-Roggebotsluis/16014462-010/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019643 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019635 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019603 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019587 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019571 A/Eur_Wig/NL-Leeuwarden/16015699-002/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019539 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019491 A/Dk/NL-Stolwijk/16016291-016-020/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019443 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019435 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019419 A/Ch/NL-Hiaure/16016112-001-005/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1019371 A/Bl_H_gull/NL-Slootdorp/16014102-002/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI990767 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI969251 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI961455 A/chicken/Sergiyev Posad/38/2017 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI961446 A/gadwall/Kurgan/2442/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI942940 A/chicken/Wales/000023/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI909457 A/chicken/Kalmykia/2643/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI909449 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI909441 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI909417 A/chicken/Voronezh/20/2017 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI909409 A/chicken/Voronezh/19/2017 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI909401 A/chicken/Voronezh/18/2017 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI909385 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI909377 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI888085 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%) EPI1122890 A/chicken/Greece/39_2017b/2017 (A/H5N6) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1045972 A/unknown/Tatarstan/94/2017 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1045964 A/unknown/Tatarstan/86/2017 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1045614 A/chicken/Tatarstan/88/2017 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019875 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019867 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019859 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019851 A/T_Dk/NL-Zeewolde/16013976-006/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019827 A/T_Dk/NL-Zeewolde/16013976-004/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019819 A/T_Dk/NL-Zeewolde/16013976-001-003/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019811 A/T_Dk/NL-Zeewolde/16013976-001/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019803 A/T_Dk/NL-Werkendam/16014159-003/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019755 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019651 A/G_c_grebe/NL-Monnickendam/16013865-009-010/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019579 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%) EPI1019563 A/Eur_Wig/NL-Groningen/16015376-003/2016 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
×