Sign in to follow this  
Followers 0
niman

Partial Zika Sequences Portugal ex-Brazil

7 posts in this topic

CEDVI has released partial Zika sequences from Portugal travelers returning from Brazil.

Share this post


Link to post
Share on other sites
LOCUS       KU752545                 205 bp    RNA     linear   VRL 02-MAY-2016
DEFINITION  Zika virus isolate PoHuZV472846 nonstructural protein 5 gene,
            partial cds.
ACCESSION   KU752545
VERSION     KU752545.1  GI:1002634696
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 205)
  AUTHORS   Ze-Ze,L., Prata,M.B., Teixeira,T., Marques,N., Mondragao,A.,
            Fernandes,R., Saraiva da Cunha,J. and Alves,M.J.
  TITLE     Zika virus infections imported from Brazil to Portugal, 2015
  JOURNAL   IDCases 4, 46-49 (2016)
REFERENCE   2  (bases 1 to 205)
  AUTHORS   Ze-Ze,L., Prata,M.B., Marques,N., Saraiva da Cunha,J. and
            Alves,M.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-FEB-2016) Center for Vectors and Infectious Diseases
            Research (CEVDI), National Health Institute Doutor Ricardo Jorge,
            IP (INSA), Avenida Liberdade 5, Aguas de Moura 2965-575, Portugal
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: BioEdit v. 7.0.1
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..205
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="PoHuZV472846"
                     /isolation_source="urine"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Portugal"
                     /collection_date="Dec-2015"
                     /note="imported from Brazil"
     CDS             <1..>205
                     /note="NS5"
                     /codon_start=1
                     /product="nonstructural protein 5"
                     /protein_id="AMN14622.1"
                     /db_xref="GI:1002634697"
                     /translation="WLGARFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEE
                     MSRIPGGRMYADDTAGWDTRISRF"
ORIGIN      
        1 tggctagggg ctagatttct agagttcgaa gcccttggat tcttgaacga ggatcactgg
       61 atgggaagag agaactcagg aggtggtgtt gaagggctgg gattacaaag actcggatat
      121 gtcctagaag agatgagtcg cataccagga ggaaggatgt atgcagatga cactgctggc
      181 tgggacaccc gcatcagcag gtttg

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
370370100%4e-99100%KU752545.1
365365100%2e-9799%KX253996.1
365365100%2e-9799%KX197192.1
365365100%2e-9799%KX185891.1
365365100%2e-9799%KU752544.1
365365100%2e-9799%KX101064.1
365365100%2e-9799%KX101060.1
365365100%2e-9799%KX117076.1
365365100%2e-9799%KX059014.1
365365100%2e-9799%KX059013.1
365365100%2e-9799%KX051563.1
365365100%2e-9799%KU509998.3
365365100%2e-9799%KU963796.1
365365100%2e-9799%KU940228.1
365365100%2e-9799%KU940227.1
365365100%2e-9799%KU940224.1
365365100%2e-9799%KU955589.1
365365100%2e-9799%KU926310.1
365365100%2e-9799%KU926309.1
365365100%2e-9799%KU866423.1
365365100%2e-9799%KU820899.2
365365100%2e-9799%KU729217.2
365365100%2e-9799%KU729218.1
365365100%2e-9799%KU744693.1
365365100%2e-9799%KU497555.1
365365100%2e-9799%KU647676.1
365365100%2e-9799%KU321639.1
365365100%2e-9799%KM078970.1
365365100%2e-9799%KM078961.1
365365100%2e-9799%KM078936.1
365365100%2e-9799%KM078933.1
365365100%2e-9799%KM078930.1
365365100%2e-9799%KM078929.1
365365100%2e-9799%KF993678.1
365365100%2e-9799%KJ776791.1
363363100%6e-9799%KM078971.1
361361100%2e-9699%KX262887.1
361361100%2e-9699%KX247646.1
361361100%2e-9699%KU820897.2
361361100%2e-9699%KX198135.1
361361100%2e-9699%KX156776.1
361361100%2e-9699%KX156775.1
361361100%2e-9699%KX156774.1
361361100%2e-9699%KX087102.1
361361100%2e-9699%KU991811.1
361361100%2e-9699%KU870645.1
361361100%2e-9699%KU853013.1
361361100%2e-9699%KU853012.1
361361100%2e-9699%KU179098.1
361361100%2e-9699%KU707826.1
36136199%2e-9699%KU527068.1
361361100%2e-9699%KU501217.1
361361100%2e-9699%KU501216.1
361361100%2e-9699%KU365780.1
361361100%2e-9699%KU365779.1
361361100%2e-9699%KU365777.1
36036098%8e-9699%KX101067.1
356356100%9e-9599%KX247632.1
356356100%9e-9599%KX087101.2
356356100%9e-9599%KU922960.1
356356100%9e-9599%KU922923.1
356356100%9e-9599%KU820898.1
356356100%9e-9599%KU681081.3
356356100%9e-9599%KU501215.1
356356100%9e-9599%KU365778.1
356356100%9e-9599%KU312312.1
352352100%1e-9398%KX056898.1
352352100%1e-9398%KU955590.1
352352100%1e-9398%KU740184.2
352352100%1e-9398%KU761564.1
347347100%5e-9298%KU937936.1
347347100%5e-9298%KU955593.1
347347100%5e-9298%JN860885.1
343343100%6e-9197%EU545988.1
34034098%7e-9098%KF258813.1
338338100%2e-8997%KU681082.3
32232288%2e-8499%KU556802.1
31631686%8e-8399%KU232300.1
31631686%8e-8399%KU232297.1
31631686%8e-8399%KU232292.1
316316100%8e-8394%HQ234499.1
31531586%3e-8299%KU232294.1
31331386%1e-8199%KU985087.1
30930984%1e-8099%KU232293.1
30930984%1e-8099%KU232290.1
30730784%4e-8099%KU232298.1
30430483%5e-7999%KU232296.1
30030082%6e-7899%KU232295.1
29529580%3e-7699%KU232291.1
29329380%9e-7699%KU232289.1
29329380%9e-7699%KU232288.1
29129180%3e-7599%KU232299.1
29129180%3e-7599%KJ873160.1
248248100%3e-6287%KF383117.1
248248100%3e-6287%KF383116.1
248248100%3e-6287%DQ859059.1
244244100%4e-6186%KX198134.1
244244100%4e-6186%KU955595.1
244244100%4e-6186%KU955592.1
244244100%4e-6186%KU955591.1

Share this post


Link to post
Share on other sites
LOCUS       KU752544                 205 bp    RNA     linear   VRL 02-MAY-2016
DEFINITION  Zika virus isolate PoHuZV469196 nonstructural protein 5 gene,
            partial cds.
ACCESSION   KU752544
VERSION     KU752544.1  GI:1002634694
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 205)
  AUTHORS   Ze-Ze,L., Prata,M.B., Teixeira,T., Marques,N., Mondragao,A.,
            Fernandes,R., Saraiva da Cunha,J. and Alves,M.J.
  TITLE     Zika virus infections imported from Brazil to Portugal, 2015
  JOURNAL   IDCases 4, 46-49 (2016)
REFERENCE   2  (bases 1 to 205)
  AUTHORS   Ze-Ze,L., Prata,M.B., Marques,N., Saraiva da Cunha,J. and
            Alves,M.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-FEB-2016) Center for Vectors and Infectious Diseases
            Research (CEVDI), National Health Institute Doutor Ricardo Jorge,
            IP (INSA), Avenida Liberdade 5, Aguas de Moura 2965-575, Portugal
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: BioEdit v. 7.0.1
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..205
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="PoHuZV469196"
                     /isolation_source="urine"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Portugal"
                     /collection_date="Nov-2015"
                     /note="imported from Brazil"

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
370370100%4e-99100%KX253996.1
370370100%4e-99100%KX197192.1
370370100%4e-99100%KX185891.1
370370100%4e-99100%KU752544.1
370370100%4e-99100%KX101064.1
370370100%4e-99100%KX101060.1
370370100%4e-99100%KX117076.1
370370100%4e-99100%KX059014.1
370370100%4e-99100%KX059013.1
370370100%4e-99100%KX051563.1
370370100%4e-99100%KU509998.3
370370100%4e-99100%KU963796.1
370370100%4e-99100%KU940228.1
370370100%4e-99100%KU940227.1
370370100%4e-99100%KU940224.1
370370100%4e-99100%KU955589.1
370370100%4e-99100%KU926310.1
370370100%4e-99100%KU926309.1
370370100%4e-99100%KU866423.1
370370100%4e-99100%KU820899.2
370370100%4e-99100%KU729217.2
370370100%4e-99100%KU729218.1
370370100%4e-99100%KU744693.1
370370100%4e-99100%KU497555.1
370370100%4e-99100%KU647676.1
370370100%4e-99100%KU321639.1
370370100%4e-99100%KM078970.1
370370100%4e-99100%KM078961.1
370370100%4e-99100%KM078936.1
370370100%4e-99100%KM078933.1
370370100%4e-99100%KM078930.1
370370100%4e-99100%KM078929.1
370370100%4e-99100%KF993678.1
370370100%4e-99100%KJ776791.1
36736799%5e-98100%KU527068.1
367367100%5e-9899%KM078971.1
365365100%2e-9799%KX262887.1
365365100%2e-9799%KX247646.1
365365100%2e-9799%KU820897.2
365365100%2e-9799%KX198135.1
365365100%2e-9799%KU752545.1
365365100%2e-9799%KX156776.1
365365100%2e-9799%KX156775.1
365365100%2e-9799%KX156774.1
36536598%2e-97100%KX101067.1
365365100%2e-9799%KX087102.1
365365100%2e-9799%KU991811.1
365365100%2e-9799%KU870645.1
365365100%2e-9799%KU853013.1
365365100%2e-9799%KU853012.1
365365100%2e-9799%KU179098.1
365365100%2e-9799%KU707826.1
365365100%2e-9799%KU501217.1
365365100%2e-9799%KU501216.1
365365100%2e-9799%KU365780.1
365365100%2e-9799%KU365779.1
365365100%2e-9799%KU365777.1
361361100%2e-9699%KX247632.1
361361100%2e-9699%KX087101.2
361361100%2e-9699%KU922960.1
361361100%2e-9699%KU922923.1
361361100%2e-9699%KU820898.1
361361100%2e-9699%KU681081.3
361361100%2e-9699%KU501215.1
361361100%2e-9699%KU365778.1
361361100%2e-9699%KU312312.1
356356100%9e-9599%KX056898.1
356356100%9e-9599%KU955590.1
356356100%9e-9599%KU740184.2
356356100%9e-9599%KU761564.1
352352100%1e-9398%KU937936.1
352352100%1e-9398%KU955593.1
352352100%1e-9398%JN860885.1
347347100%5e-9298%EU545988.1
34534598%2e-9198%KF258813.1
343343100%6e-9197%KU681082.3
32732788%4e-86100%KU556802.1
32232286%2e-84100%KU232300.1
32232286%2e-84100%KU232297.1
32232286%2e-84100%KU232292.1
32032086%7e-84100%KU232294.1
320320100%7e-8495%HQ234499.1
31631686%8e-8399%KU985087.1
31531584%3e-82100%KU232293.1
31531584%3e-82100%KU232290.1
31331384%1e-81100%KU232298.1
30930983%1e-80100%KU232296.1
30630682%1e-79100%KU232295.1
29829880%2e-77100%KU232289.1
29829880%2e-77100%KU232288.1
29729780%8e-77100%KU232299.1
29729780%8e-77100%KJ873160.1
29129180%3e-7599%KU232291.1
248248100%3e-6287%KX198134.1
248248100%3e-6287%KU955595.1
248248100%3e-6287%KU955592.1
248248100%3e-6287%KU955591.1
248248100%3e-6287%HQ234501.1
244244100%4e-6186%KF383117.1
244244100%4e-6186%KF383116.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.