Sign in to follow this  
Followers 0
niman

Partial 2016 Zika Sequences Germany ex-Puerto Rico

10 posts in this topic

Bernhard Nocht Institute for Tropical Medicine release partial 2016 sequence from a traveler from Puerto Rico and his sexual contact in Germany.

Share this post


Link to post
Share on other sites
LOCUS       KX253995                 377 bp    RNA     linear   VRL 13-JUN-2016
DEFINITION  Zika virus isolate ZIKV/Homo sapiens/GER/GER-BNI-P1/2016
            polyprotein gene, partial cds.
ACCESSION   KX253995
VERSION     KX253995.1  GI:1029979491
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 377)
  AUTHORS   Frank,C., Cadar,D., Schlaphof,A., Neddersen,N., Gunther,S.,
            Schimdt-Chanasit,J. and Tappe,D.
  TITLE     Sexual transmission of Zika virus in Germany, April 2016
  JOURNAL   Euro Surveill. 21 (23), 13-16 (2016)
REFERENCE   2  (bases 1 to 377)
  AUTHORS   Cadar,D., Tappe,D. and Schimdt-Chanasit,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Virology, Bernhard Nocht Institute for
            Tropical Medicine, Bernhard-Nocht-Str. 74, Hamburg 20359, Germany
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..377
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="ZIKV/Homo sapiens/GER/GER-BNI-P1/2016"
                     /isolation_source="urine"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Germany"
                     /collection_date="21-Apr-2016"
                     /note="sexual transmission"
     CDS             <1..>377
                     /note="NS5"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ANF28867.1"
                     /db_xref="GI:1029979492"
                     /translation="YQNKVVKVLRPAEKGKTVMDIISRQDQRGSGQVVTYALNTFTNL
                     VVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDRLKRMAVSGDDCVVKPIDDR
                     FAHALRFLNDMGKVRKDTQEWKPS"
ORIGIN      
        1 taccaaaaca aagtggtaaa ggtccttaga ccagctgaaa aagggaaaac agttatggac
       61 attatttcga gacaagacca aagggggagc ggacaagttg tcacttacgc tcttaacaca
      121 tttaccaacc tagtggtgca actcattcgg aatatggagg ctgaggaagt tctagagatg
      181 caagacttgt ggctgctgcg gaggtcagag aaagtgacca actggttgca gagcaacgga
      241 tgggataggc tcaaacgaat ggcagtcagt ggagatgatt gcgttgtgaa gccaattgat
      301 gataggtttg cacatgccct caggttcttg aatgatatgg gaaaagttag gaaggacaca
      361 caagagtgga aaccctc

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
681681100%0.0100%KU724098.1
681681100%0.0100%KU724097.1
681681100%0.0100%KU724096.1
681681100%0.0100%KU820897.3
681681100%0.0100%KU758877.1
681681100%0.0100%KX262887.1
681681100%0.0100%KX247646.1
681681100%0.0100%KX247632.1
681681100%0.0100%KX087101.2
681681100%0.0100%KX198135.1
681681100%0.0100%KU937936.1
681681100%0.0100%KX156776.1
681681100%0.0100%KX156775.1
681681100%0.0100%KX156774.1
681681100%0.0100%KX087102.1
681681100%0.0100%KX056898.1
681681100%0.0100%KU991811.1
681681100%0.0100%KU985087.1
681681100%0.0100%KU955590.1
681681100%0.0100%KU870645.1
681681100%0.0100%KU922960.1
681681100%0.0100%KU922923.1
681681100%0.0100%KU820898.1
681681100%0.0100%KU740184.2
681681100%0.0100%KU853013.1
681681100%0.0100%KU853012.1
681681100%0.0100%KU729217.2
681681100%0.0100%KU761564.1
681681100%0.0100%KU497555.1
681681100%0.0100%KU707826.1
681681100%0.0100%KU527068.1
681681100%0.0100%KU232299.1
681681100%0.0100%KU232298.1
681681100%0.0100%KU232296.1
681681100%0.0100%KU232295.1
681681100%0.0100%KU232294.1
681681100%0.0100%KU232293.1
681681100%0.0100%KU232291.1
681681100%0.0100%KU232290.1
681681100%0.0100%KU232289.1
681681100%0.0100%KU232288.1
681681100%0.0100%KU556802.1
681681100%0.0100%KU647676.1
681681100%0.0100%KU501215.1
681681100%0.0100%KU365780.1
681681100%0.0100%KU365779.1
681681100%0.0100%KU365777.1
677677100%0.099%KU232300.1
675675100%0.099%KX280026.1
675675100%0.099%KX197192.1
675675100%0.099%KX059014.1
675675100%0.099%KX059013.1
675675100%0.099%KX051563.1
675675100%0.099%KU509998.3
675675100%0.099%KU926310.1
675675100%0.099%KU926309.1
675675100%0.099%KU232297.1
675675100%0.099%KU232292.1
675675100%0.099%KU501217.1
675675100%0.099%KU501216.1
675675100%0.099%KU365778.1
675675100%0.099%KU312312.1
675675100%0.099%KU321639.1
675675100%0.099%KM078961.1
675675100%0.099%KM078936.1
675675100%0.099%KM078933.1
675675100%0.099%KJ873161.1
675675100%0.099%KJ873160.1
675675100%0.099%KJ776791.1
672672100%0.099%KU940228.1
672672100%0.099%KU940224.1
672672100%0.099%KU729218.1
672672100%0.099%KU681081.3
672672100%0.099%KM851039.1
672672100%0.099%KM078971.1
672672100%0.099%KM078930.1
668668100%0.099%KM078970.1
666666100%0.099%KM078929.1
663663100%0.099%KX117076.1
663663100%0.099%KU744693.1
663663100%0.099%KU179098.1
657657100%0.099%KX253996.1
657657100%0.099%KX185891.1
657657100%0.099%KU963796.1
657657100%0.099%KU955589.1
657657100%0.099%KU866423.1
657657100%0.099%KU820899.2
657657100%0.099%KF993678.1
64564595%0.099%KU724099.1
645645100%0.098%KU955593.1
645645100%0.098%JN860885.1
639639100%1e-17998%EU545988.1
636636100%1e-17897%KU681082.3
636636100%1e-17897%KM851038.1
58058085%9e-16299%KU724100.1
576576100%1e-16094%HQ234499.1
53153179%4e-14799%KX101061.1
531531100%4e-14791%KF268949.1
513513100%1e-14190%KF383118.1
513513100%1e-14190%KF383103.1

Share this post


Link to post
Share on other sites
LOCUS       KX253994                 447 bp    RNA     linear   VRL 13-JUN-2016
DEFINITION  Zika virus isolate ZIKV/Homo sapiens/PRI/PRI-BNI-P2/2016
            polyprotein gene, partial cds.
ACCESSION   KX253994
VERSION     KX253994.1  GI:1029979489
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 447)
  AUTHORS   Frank,C., Cadar,D., Schlaphof,A., Neddersen,N., Gunther,S.,
            Schimdt-Chanasit,J. and Tappe,D.
  TITLE     Sexual transmission of Zika virus in Germany, April 2016
  JOURNAL   Euro Surveill. 21 (23), 13-16 (2016)
REFERENCE   2  (bases 1 to 447)
  AUTHORS   Cadar,D., Tappe,D. and Schimdt-Chanasit,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Virology, Bernhard Nocht Institute for
            Tropical Medicine, Bernhard-Nocht-Str. 74, Hamburg 20359, Germany
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..447
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="ZIKV/Homo sapiens/PRI/PRI-BNI-P2/2016"
                     /isolation_source="urine"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Germany"
                     /collection_date="21-Apr-2016"
                     /note="imported from Puerto Rico; sexual trasmission"
     CDS             <1..>447
                     /note="NS5"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ANF28866.1"
                     /db_xref="GI:1029979490"
                     /translation="NEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMD
                     IISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQS
                     NGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKP"
ORIGIN      
        1 aatgaagctc taatcaccaa ccaaatggag aaagggcaca gggccttggc attggccata
       61 atcaagtaca cataccaaaa caaagtggta aaggtcctta gaccagctga aaaagggaaa
      121 acagttatgg acattatttc gagacaagac caaaggggga gcggacaagt tgtcacttac
      181 gctcttaaca catttaccaa cctagtggtg caactcattc ggaatatgga ggctgaggaa
      241 gttctagaga tgcaagactt gtggctgctg cggaggtcag agaaagtgac caactggttg
      301 cagagcaacg gatgggatag gctcaaacga atggcagtca gtggagatga ttgcgttgtg
      361 aagccaattg atgataggtt tgcacatgcc ctcaggttct tgaatgatat gggaaaagtt
      421 aggaaggaca cacaagagtg gaaaccc

Share this post


Link to post
Share on other sites

S

equences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
807807100%0.0100%KU724096.1
807807100%0.0100%KU820897.3
807807100%0.0100%KU758877.1
807807100%0.0100%KX262887.1
807807100%0.0100%KX247646.1
807807100%0.0100%KX247632.1
807807100%0.0100%KX087101.2
807807100%0.0100%KX198135.1
807807100%0.0100%KU937936.1
807807100%0.0100%KX156776.1
807807100%0.0100%KX156775.1
807807100%0.0100%KX156774.1
807807100%0.0100%KX087102.1
807807100%0.0100%KX056898.1
807807100%0.0100%KU991811.1
807807100%0.0100%KU985087.1
807807100%0.0100%KU955590.1
807807100%0.0100%KU870645.1
807807100%0.0100%KU922960.1
807807100%0.0100%KU922923.1
807807100%0.0100%KU820898.1
807807100%0.0100%KU740184.2
807807100%0.0100%KU853013.1
807807100%0.0100%KU853012.1
807807100%0.0100%KU761564.1
807807100%0.0100%KU497555.1
807807100%0.0100%KU232299.1
807807100%0.0100%KU232298.1
807807100%0.0100%KU232296.1
807807100%0.0100%KU232295.1
807807100%0.0100%KU232294.1
807807100%0.0100%KU232290.1
807807100%0.0100%KU232289.1
807807100%0.0100%KU232288.1
807807100%0.0100%KU556802.1
807807100%0.0100%KU647676.1
807807100%0.0100%KU501215.1
803803100%0.099%KU232300.1
801801100%0.099%KX280026.1
801801100%0.099%KX197192.1
801801100%0.099%KX059014.1
801801100%0.099%KX059013.1
801801100%0.099%KX051563.1
801801100%0.099%KU509998.3
801801100%0.099%KU926310.1
801801100%0.099%KU926309.1
801801100%0.099%KU729217.2
801801100%0.099%KU707826.1
801801100%0.099%KU527068.1
801801100%0.099%KU232297.1
801801100%0.099%KU232293.1
801801100%0.099%KU232292.1
801801100%0.099%KU232291.1
801801100%0.099%KU501217.1
801801100%0.099%KU501216.1
801801100%0.099%KU365780.1
801801100%0.099%KU365779.1
801801100%0.099%KU365778.1
801801100%0.099%KU365777.1
801801100%0.099%KU312312.1
801801100%0.099%KU321639.1
801801100%0.099%KM078936.1
801801100%0.099%KJ873161.1
801801100%0.099%KJ873160.1
801801100%0.099%KJ776791.1
800800100%0.099%KM078961.1
79879898%0.0100%KU724097.1
798798100%0.099%KU940228.1
798798100%0.099%KU940224.1
798798100%0.099%KM078971.1
798798100%0.099%KM078930.1
794794100%0.099%KM078970.1
794794100%0.099%KM078933.1
792792100%0.099%KU729218.1
792792100%0.099%KM078929.1
789789100%0.099%KX117076.1
789789100%0.099%KU681081.3
789789100%0.099%KU744693.1
789789100%0.099%KM851039.1
783783100%0.099%KX253996.1
783783100%0.099%KX185891.1
783783100%0.099%KU963796.1
783783100%0.099%KU955589.1
783783100%0.099%KU866423.1
783783100%0.099%KU820899.2
783783100%0.099%KU179098.1
783783100%0.099%KF993678.1
771771100%0.098%KU955593.1
771771100%0.098%JN860885.1
765765100%0.098%EU545988.1
762762100%0.098%KU681082.3
762762100%0.098%KM851038.1
72672690%0.099%KU724098.1
693693100%0.094%HQ234499.1
66166182%0.099%KX101061.1
64164179%4e-18099%KU724099.1

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
807807100%0.0100%KX253994.1
807807100%0.0100%KU724096.1
807807100%0.0100%KU820897.3
807807100%0.0100%KU758877.1
807807100%0.0100%KX262887.1
807807100%0.0100%KX247646.1
807807100%0.0100%KX247632.1
807807100%0.0100%KX087101.2
807807100%0.0100%KX198135.1
807807100%0.0100%KU937936.1
807807100%0.0100%KX156776.1
807807100%0.0100%KX156775.1
807807100%0.0100%KX156774.1
807807100%0.0100%KX087102.1
807807100%0.0100%KX056898.1
807807100%0.0100%KU991811.1
807807100%0.0100%KU985087.1
807807100%0.0100%KU955590.1
807807100%0.0100%KU870645.1
807807100%0.0100%KU922960.1
807807100%0.0100%KU922923.1
807807100%0.0100%KU820898.1
807807100%0.0100%KU740184.2
807807100%0.0100%KU853013.1
807807100%0.0100%KU853012.1
807807100%0.0100%KU761564.1
807807100%0.0100%KU497555.1
807807100%0.0100%KU232299.1
807807100%0.0100%KU232298.1
807807100%0.0100%KU232296.1
807807100%0.0100%KU232295.1
807807100%0.0100%KU232294.1
807807100%0.0100%KU232290.1
807807100%0.0100%KU232289.1
807807100%0.0100%KU232288.1
807807100%0.0100%KU556802.1
807807100%0.0100%KU647676.1
807807100%0.0100%KU501215.1
803803100%0.099%KU232300.1
801801100%0.099%KX280026.1
801801100%0.099%KX197192.1
801801100%0.099%KX059014.1
801801100%0.099%KX059013.1
801801100%0.099%KX051563.1
801801100%0.099%KU509998.3
801801100%0.099%KU926310.1
801801100%0.099%KU926309.1
801801100%0.099%KU729217.2
801801100%0.099%KU707826.1
801801100%0.099%KU527068.1
801801100%0.099%KU232297.1
801801100%0.099%KU232293.1
801801100%0.099%KU232292.1
801801100%0.099%KU232291.1
801801100%0.099%KU501217.1
801801100%0.099%KU501216.1
801801100%0.099%KU365780.1
801801100%0.099%KU365779.1
801801100%0.099%KU365778.1
801801100%0.099%KU365777.1
801801100%0.099%KU312312.1
801801100%0.099%KU321639.1
801801100%0.099%KM078936.1
801801100%0.099%KJ873161.1
801801100%0.099%KJ873160.1
801801100%0.099%KJ776791.1
800800100%0.099%KM078961.1
79879898%0.0100%KU724097.1
798798100%0.099%KU940228.1
798798100%0.099%KU940224.1
798798100%0.099%KM078971.1
798798100%0.099%KM078930.1
794794100%0.099%KM078970.1
794794100%0.099%KM078933.1
792792100%0.099%KU729218.1
792792100%0.099%KM078929.1
789789100%0.099%KX117076.1
789789100%0.099%KU681081.3
789789100%0.099%KU744693.1
789789100%0.099%KM851039.1
783783100%0.099%KU866423.2
783783100%0.099%KX253996.1
783783100%0.099%KX185891.1
783783100%0.099%KU963796.1
783783100%0.099%KU955589.1
783783100%0.099%KU820899.2
783783100%0.099%KU179098.1
783783100%0.099%KF993678.1
771771100%0.098%KU955593.1
771771100%0.098%JN860885.1
765765100%0.098%EU545988.1
762762100%0.098%KU681082.3
762762100%0.098%KM851038.1
72672690%0.099%KU724098.1
693693100%0.094%HQ234499.1
67767783%0.0100%KX253995.1
66166182%0.099%KX101061.1
64164179%4e-18099%KU724099.1

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
681681100%0.0100%KX253995.1
681681100%0.0100%KU724098.1
681681100%0.0100%KU724097.1
681681100%0.0100%KU724096.1
681681100%0.0100%KU820897.3
681681100%0.0100%KU758877.1
681681100%0.0100%KX262887.1
681681100%0.0100%KX247646.1
681681100%0.0100%KX247632.1
681681100%0.0100%KX087101.2
681681100%0.0100%KX198135.1
681681100%0.0100%KU937936.1
681681100%0.0100%KX156776.1
681681100%0.0100%KX156775.1
681681100%0.0100%KX156774.1
681681100%0.0100%KX087102.1
681681100%0.0100%KX056898.1
681681100%0.0100%KU991811.1
681681100%0.0100%KU985087.1
681681100%0.0100%KU955590.1
681681100%0.0100%KU870645.1
681681100%0.0100%KU922960.1
681681100%0.0100%KU922923.1
681681100%0.0100%KU820898.1
681681100%0.0100%KU740184.2
681681100%0.0100%KU853013.1
681681100%0.0100%KU853012.1
681681100%0.0100%KU729217.2
681681100%0.0100%KU761564.1
681681100%0.0100%KU497555.1
681681100%0.0100%KU707826.1
681681100%0.0100%KU527068.1
681681100%0.0100%KU232299.1
681681100%0.0100%KU232298.1
681681100%0.0100%KU232296.1
681681100%0.0100%KU232295.1
681681100%0.0100%KU232294.1
681681100%0.0100%KU232293.1
681681100%0.0100%KU232291.1
681681100%0.0100%KU232290.1
681681100%0.0100%KU232289.1
681681100%0.0100%KU232288.1
681681100%0.0100%KU556802.1
681681100%0.0100%KU647676.1
681681100%0.0100%KU501215.1
681681100%0.0100%KU365780.1
681681100%0.0100%KU365779.1
681681100%0.0100%KU365777.1
67767799%0.0100%KX253994.1
677677100%0.099%KU232300.1
675675100%0.099%KX280026.1
675675100%0.099%KX197192.1
675675100%0.099%KX059014.1
675675100%0.099%KX059013.1
675675100%0.099%KX051563.1
675675100%0.099%KU509998.3
675675100%0.099%KU926310.1
675675100%0.099%KU926309.1
675675100%0.099%KU232297.1
675675100%0.099%KU232292.1
675675100%0.099%KU501217.1
675675100%0.099%KU501216.1
675675100%0.099%KU365778.1
675675100%0.099%KU312312.1
675675100%0.099%KU321639.1
675675100%0.099%KM078961.1
675675100%0.099%KM078936.1
675675100%0.099%KM078933.1
675675100%0.099%KJ873161.1
675675100%0.099%KJ873160.1
675675100%0.099%KJ776791.1
672672100%0.099%KU940228.1
672672100%0.099%KU940224.1
672672100%0.099%KU729218.1
672672100%0.099%KU681081.3
672672100%0.099%KM851039.1
672672100%0.099%KM078971.1
672672100%0.099%KM078930.1
668668100%0.099%KM078970.1
666666100%0.099%KM078929.1
663663100%0.099%KX117076.1
663663100%0.099%KU744693.1
663