Sign in to follow this  
Followers 0
niman

2016 Yellow Fever Virus YFV Sequence - First China ex-Angola Case

3 posts in this topic

LOCUS       KU921608               10823 bp    RNA     linear   VRL 20-JUN-2016
DEFINITION  Yellow fever virus isolate CNYF01/2016, complete genome.
ACCESSION   KU921608
VERSION     KU921608.1  GI:1036436399
KEYWORDS    .
SOURCE      Yellow fever virus (YFV)
  ORGANISM  Yellow fever virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus; Yellow fever virus group.
REFERENCE   1  (bases 1 to 10823)
  AUTHORS   Liu,L.
  TITLE     Complete Genome Sequence of Yellow Fever virus isolate CNYF01/2016
            from First Imported Case in China mainland, March 2016
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10823)
  AUTHORS   Liu,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAR-2016) Department of Viral Hemorrhagic Fever,
            National Institute for Viral Diseases Control and Prevention,
            Changbai Road 155, Beijing 102206, China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC genomic Workbench v. 8.5.1
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10823
                     /organism="Yellow fever virus"
                     /mol_type="genomic RNA"
                     /isolate="CNYF01/2016"
                     /isolation_source="serum"
                     /host="Homo sapiens"
                     /db_xref="taxon:11089"
                     /country="China"
                     /collection_date="10-Mar-2016"

Share this post


Link to post
Share on other sites
LOCUS       KU921608               10823 bp    RNA     linear   VRL 20-JUN-2016
DEFINITION  Yellow fever virus isolate CNYF01/2016, complete genome.
ACCESSION   KU921608
VERSION     KU921608.1  GI:1036436399
KEYWORDS    .
SOURCE      Yellow fever virus (YFV)
  ORGANISM  Yellow fever virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus; Yellow fever virus group.
REFERENCE   1  (bases 1 to 10823)
  AUTHORS   Liu,L.
  TITLE     Complete Genome Sequence of Yellow Fever virus isolate CNYF01/2016
            from First Imported Case in China mainland, March 2016
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10823)
  AUTHORS   Liu,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAR-2016) Department of Viral Hemorrhagic Fever,
            National Institute for Viral Diseases Control and Prevention,
            Changbai Road 155, Beijing 102206, China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC genomic Workbench v. 8.5.1
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10823
                     /organism="Yellow fever virus"
                     /mol_type="genomic RNA"
                     /isolate="CNYF01/2016"
                     /isolation_source="serum"
                     /host="Homo sapiens"
                     /db_xref="taxon:11089"
                     /country="China"
                     /collection_date="10-Mar-2016"
     CDS             121..10359
                     /note="contains structural and nonstructural proteins"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ANK35880.1"
                     /db_xref="GI:1036436400"
                     /translation="MSGRKAQGRTLGVNMVRRGVRSLSNKIKQKTKQIGNRPGPSRGV
                     QALIFFFLFNILTGKKLTAHLKKLWRMLDPRQGLAVLRKVKRVVASLMRGLASRKRRS
                     NEMALFPLLLLGLLALSGGVTLVRKNRWLLLNVTAEDLGKTFSVGTGNCTTNILEAKY
                     WCPDSMEYNCPNLSPREEPDDIDCWCYGVENVRVAYGRCDAVGRSKRSRRAIDLPTHE
                     NHGLKTRQEKWMTGRMGERQLQKIERWLVRNPFFAVTALAIAYLVGNNTTQRVVIALL
                     VLAVGPAYSAHCIGITDRDFIEGVHGGTWVSATLEQDKCVTVMAPDKPSLDISLQTVA
                     IDGPAEARKVCYSAVLTHVKINDKCPSTGEAHLAEENDGDNACKRTYSDRGWGNGCGL
                     FGKGSIVACAKFTCAKSMSLFEVDQTKIQYVIRAQLHVGAKQENWNTDIKTLKFDALS
                     GSQEAEFTGYGKATLECQVQTAVDFGNSYIAEMEKDSWIVDRQWAQDLTLPWQSGSGG
                     IWREMHHLVEFEPPHAATIRVLALGNQEGSLKTALTGAMRVTKDENDNNLYKLHGGHV
                     SCRVKLSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADD
                     LTAAVNKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIG
                     KLFTQTMKGAERLAVMGDAAWDFSSAGGFFTSVGKGIHTVFGSAFQGLFGGLSWITKV
                     IMGAVLIWVGINTRNMTMSMSMILVGVIMMFLSLGVGADQGCAVNFGKRELKCGDGIF
                     VFRDSDDWLTKYSYYPEDPVKLASIIKASHEEGKCGLNSVDSLEHEMWRSRADEINAI
                     FEENEVDISVVVQDPKNIYQRGTHPFSRIRDGLQYGWKTWGKNLVFSPGRKNGSFIID
                     GKSRKECPFSNRVWNSFQIEEFGMGVFTTRVFMDATFDYSVDCDGAILGAAVNGKKSA
                     HGSPTFWMGSHEVNGTWMIHTLETLDYKECEWPLTHTIGTSVEESDMFMPRSIGGPVS
                     SHNRIPGYKVQTNGPWMQVPLEVKREVCPGTSVVVDSNCDGRGKSTRSTTDSGKIIPE
                     WCCRSCTMPPVSFHGSDGCWYPMEIRPMKTSDSHLVRSWVTAGEVHAVPFGLVSMMIA
                     MEVVLRRRQGPKQMLVGGVVLLGAMLVGQVTVLDLVKFVVAVGLHFHEINNGGDAMYM
                     ALIASFSIRPGLLMGFGLRTLWSPRERLVMAFGAAMVEIALGGMMGGLWQYLNAVSLC
                     VLTINAISSRKASNMILPLMALMTPMTMHEVRMATMLFCTVVIIGVLHQNSKDTSMQK
                     TIPIVALTLTSYMGLTQPFLGLCAYMSTQVFGRRSIPVNEALAAAGLVGVLAGLAFQD
                     MENFLGPIAVGGILMMLVSVAGRVDGLELRKLGEISWEEEAEISGSSSRYDVALSEQG
                     EFKLLSEDKVPWDQIVMTSLALVGAAIHPFALLLVLGGWILHIKGARRSGDVLWDIPT
                     PKVIEECEHLEDGIYGIFQSTFLGASQRGVGVAQGGVFHTMWHVTRGAFLLRNGKKLV
                     PSWASVKEDLVAYGGSWKLDGRWDGEEEVQLIAAVPGKSVVNVQTKPSLFKVKNGGEI
                     GAVALDYPSGTSGSPIVNRNGEVVGLYGNGILVGDNSFVSAISQTELKEESKEELQEI
                     PTMLKKGMTTILDFHPGAGKTRRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFQG
                     LDVKFHTQAFSAHGSGKEVIDAMCHATLTYRMLEPTRVVNWEVIIMDEAHFLDPASIA
                     ARGWAAHRARANESATILMTATPPGTSDEFPHSNGEIEDVQTDIPSEPWTTGHEWILA
                     DKRPTAWFLPSIRAANVMAASLRKAGKNVVVLNRKTFEKEYPTIKQKKPDFILATDIA
                     EMGANLCVERVLDCRTAYKPVLVDEGKKVAIKGPLRISASSAAQRRGRIGRNPNRDGD
                     SYYYSEPTSEDNAHHVCWLEASMLLDNMEVRGGMVAPLYGIEGTKTPVSPGEMRLRDD
                     QRRVFRELVRGCDLPVWLAWQVAKAGLKTNDRKWCFEGPEEHEILNDNGETVKCRSPG
                     GAKRALRPRWCDERVSSDQSALADFIKFAEGRRGAAEMLVILTELPDFLAKKGGEAMD
                     TISVFLHSEEGSRAYRNALSMMPEAMTIVMLFLLAGLLTSGAVIFFMSPKGMSRMSMA
                     MGTMAGSGYLMFLGGVKPTHISYVMLIFFVLMVVIIPEPGQQRSIQDNQVAYLIIGIL
                     TLLSVVAANELGMLEKTKEDFFGKRDITTPSGAIPWSWPDLDLKPGAAWTVYVGIVTM
                     LSPMLHHWIKVEYGNLSLSGIAQSASVLSFMDKGIPFMKMNISVVILLVSGWNSITVI
                     PLLCGIGGAMLHWTLILPGIKAQQSKLAQKRVFHGVAKNPVVDGNPTADIEEAPEMPA
                     LYEKKLALYLLLALSLMSVAMCRTPFSLAEGIVLSSAALGPLIEGNTSLLWNGPMAVS
                     MTGVMRGNYYAFVGVMYNLWKMKTGRRGRASGKTLGEVWKRELNLLDKQQFEMYKRTD
                     IIEVDRDMARRHLAEGKVDTGVAVSRGTAKLRWFHERGYVKLEGRVTDLGCGRGGWCY
                     YAAAQKEVSGVKGYTLGRDGHEKPMNVQSLGWNIVTFKDKTDIHRLEPLKCETLLCDI
                     GESSPSSATEGERTLRVLDTVEKWLACGVDNFCIKVLAPYMPDVIEKLELLQRRFGGT
                     VIRNPLSRNSTHEMYYVSGARSNITFTVNQTSRLLMRRMRRPTGKVTLEADVILPIGT
                     RSVETDKGPLDKDAIEERVERIKNEYATTWFYDNDNPYRTWHYCGSYVTKTSGSAASM
                     INGVIKILTFPWDRIEEVTRMAMTDTTPFGQQRVFKEKVDTRAKDPPAGTRKIMKVVN
                     RWLFRHLSREKNPRLCTKEEFIAKVRSHAAVGAFLEEQEQWKTANEAVLDPKFWEMVD
                     AERKLHQQGRCQSCVYNMMGKREKKLSEFGKAKGSRAIWYMWLGARFLEFEALGFLNE
                     DHWASRENSGGGVEGIGLQYLGYVIRDLSTKEGGGFYADDTAGWDTRITEADLDDEQE
                     IMSYMSPEQRKLAWAIMEMTYKNKVVKVLRPAPGGKAFMDIISRRDQRGSGQVVTYAL
                     NTITNLKVQLIRMAEAEMVINHQHVQECGENVLERLETWLAENGCDRLSRMAVSGDDC
                     VVRPVDDRFGLALSHLNAMSKVRKDISEWQPSKGWTDWENVPFCSHHFHELVLKDGRK
                     IVVPCRDQDELIGRGRVSPGNGWMIKETACLSKAYANMWSLMYFHKRDMRLLSFAVSS
                     AVPTAWVPSGRTTWSVHGRGEWMTTEDMLDVWNRVWVLNNPHMTDKTTIKEWRDVPYL
                     TKRQDKLCGSLIGMTNRATWASHIHLVIHRIRTLIGQEKFTDYLTVMDRYSVDADLQP
                     GELI"
ORIGIN      
        1 agtaaatccc tgtgtgctaa ttgaggtgca ttggtctgca aatcgagttg ctaggcaata
       61 aacacatttg gattaatttt aatcgctcaa tgagcgatta gcagagaact gaccagagaa
      121 atgtctggtc gaaaagctca gggtagaacc ctgggcgtca atatggtaag acgaggggtt
      181 cgctccttgt caaacaaaat aaaacaaaaa acaaaacaga ttggaaacag acctggccct
      241 tcaagaggtg ttcaagcatt aattttcttc tttttgttta acattctgac tgggaaaaag
      301 ttgactgctc atctaaaaaa actctggagg atgcttgatc caaggcaggg acttgctgta
      361 ctgcgaaagg tcaaaagagt tgtagctagc ttaatgagag gactggcttc caggaaacgt
      421 agatccaatg aaatggcctt gtttccactc ttgttactgg gtttgttggc tctatcagga
      481 ggagtgaccc tcgtcagaaa gaacagatgg ttgctcctga atgtaactgc tgaagacctg
      541 gggaaaacgt tttcagtggg aactgggaat tgcaccacga atattctgga agcaaaatac
      601 tggtgccccg actcaatgga atacaattgc cccaatctca gtccaagaga agagccagat
      661 gacatagatt gctggtgtta tggagtggaa aatgtcagag tggcctatgg aagatgtgat
      721 gcggtagggc gatcaaaacg ctccaggaga gcgattgatc tacccacaca tgagaaccat
      781 ggactaaaga ctcggcagga gaagtggatg acaggcagaa tgggtgagag gcagctccag
      841 aagattgaaa gatggctggt taggaatcca ttttttgcgg tcacagcatt ggcaatagcc
      901 tatctggtgg gtaacaacac gacacaacga gtggtcatag cactactggt tctagcggtt
      961 ggtccagcgt actctgccca ttgcataggg ataaccgaca gagatttcat tgaaggtgtc
     1021 catgggggca cttgggtgtc agccactctg gagcaggaca aatgcgtgac tgtaatggcc
     1081 cctgacaaac cttctctgga catctcacta caaacagtgg caatcgatgg accggctgaa
     1141 gcgaggaagg tttgctacag tgcagtccta acccatgtga agatcaatga caaatgcccg
     1201 agcactggtg aggcccacct tgcagaggaa aatgatggtg acaatgcttg taaacggaca
     1261 tattctgaca gaggctgggg caatggctgt ggtctttttg ggaaaggaag catcgtggct
     1321 tgtgccaagt ttacatgtgc caaatctatg agtctctttg aggtggatca gaccaaaatc
     1381 caatatgtca tcagggccca gctccatgtg ggtgccaaac aggaaaactg gaacacagac
     1441 ataaaaacgc tgaaatttga tgctctttct ggctcacagg aggctgaatt cactggttat
     1501 ggaaaggcaa cactagagtg tcaggtccag actgccgtgg actttgggaa cagctacatc
     1561 gcagagatgg aaaaagatag ctggatcgtt gaccgccaat gggcacagga cttgacactg
     1621 ccatggcaga gtgggagtgg tggcatatgg agagaaatgc accaccttgt tgagtttgag
     1681 cccccacatg ctgccacaat tagggtgctg gccttgggca atcaagaagg ctccttgaag
     1741 accgctctca caggcgctat gcgcgtcacc aaggatgaga atgacaacaa cttgtacaaa
     1801 ctgcacggtg gtcacgtctc ctgtagagtg aaactgtcag ccctcactct caaaggaaca
     1861 tcctacaaga tgtgcacaga caaaatgtca tttgtcaaga atccaacgga tacagggcat
     1921 ggcacagttg tcatgcaagt aaaggtcccc aaaggggccc catgcaagat tcctgtgatt
     1981 gtggcagatg acctaacggc agcagtgaac aaaggcatct tggtcactgt caatcctatt
     2041 gcatccacaa atgatgatga agttctgatt gaggtcaatc ccccttttgg ggatagctac
     2101 atcatagttg ggactggaga ctcacgactg acctatcagt ggcacaaaga agggagttca
     2161 ataggaaaat tgttcacaca gacaatgaaa ggagctgaac gtcttgcagt gatgggtgat
     2221 gctgcttggg attttagttc tgctgggggg ttcttcacat ctgtgggaaa aggaatccat
     2281 accgtgtttg gctcggcctt ccaggggctg tttggtggct tgagttggat cacgaaagtc
     2341 atcatgggag ccgtgctcat ctgggtggga ataaacaccc gcaacatgac catgtccatg
     2401 tccatgatct tggtaggtgt gatcatgatg tttctttcac taggagttgg ggctgaccaa
     2461 ggatgtgctg ttaactttgg gaaacgcgag ctcaaatgcg gagatggcat ctttgtgttt
     2521 agagactctg atgactggct cacaaagtac tcatactatc ctgaagaccc tgtcaaattg
     2581 gcatccatca ttaaagcctc ccacgaggag ggcaaatgtg gattgaattc agttgattcc
     2641 ctcgaacacg agatgtggag gagtagggcg gatgagatca acgccatttt tgaagaaaat
     2701 gaagtagaca tctcggtcgt cgtccaagac ccaaagaaca tctaccaaag agggacccac
     2761 ccgttctcaa ggatccgtga cggattgcag tatggatgga agacctgggg aaaaaacctt
     2821 gttttctcac cagggaggaa gaacggcagc ttcatcattg acgggaagtc acgaaaggag
     2881 tgccccttct ctaacagagt gtggaactca ttccagattg aggagtttgg catgggggtc
     2941 ttcacaacac gagtgtttat ggacgcgacc tttgactatt cagtggactg tgatggagcc
     3001 atcctgggtg cagcggtaaa tggaaagaag agtgcccatg gatcacccac attttggatg
     3061 ggaagtcatg aagtcaatgg aacgtggatg atacacactt tggaaactct tgattacaag
     3121 gagtgtgaat ggccactgac acacactatt ggaacctcag tagaagaaag tgacatgttc
     3181 atgccccggt ccattggagg tccggtgagt tctcacaacc gcatcccggg ttacaaggtg
     3241 caaaccaatg ggccatggat gcaagtcccc ctggaagtaa aaagggaagt ctgtccaggg
     3301 acaagcgtgg tggtggactc caactgtgat ggacgtggaa aatcaacgag atcaaccact
     3361 gacagtggga aaataatccc ggaatggtgt tgcagatctt gtactatgcc tccagtcagc
     3421 ttccatggaa gcgatggttg ttggtatcct atggagatca gacccatgaa aacatccgac
     3481 agccacctag tgagatcctg ggtgactgca ggagaagttc atgcagtacc ctttggactg
     3541 gtgagcatga tgattgccat ggaggtggtg ttgcgcagaa ggcaaggacc aaaacaaatg
     3601 ctggtaggag gagttgtgct gcttggagcg atgttagtgg gacaagtcac agtcttagac
     3661 cttgtgaagt ttgttgtggc agtgggattg cacttccatg aaattaataa cggaggagat
     3721 gccatgtaca tggcattgat tgccagcttt tccatccggc caggcctgct catgggcttt
     3781 gggctgcgca cactgtggag tcctcgcgag cgacttgtaa tggcatttgg agcagccatg
     3841 gttgagattg ccttaggtgg aatgatgggt gggctttggc agtacttgaa cgccgtttca
     3901 ctgtgtgtgc tcaccataaa tgcaatctca tcaaggaagg cctcaaatat gatcctcccc
     3961 ctgatggcac tcatgactcc catgacaatg catgaggtga ggatggcgac gatgctgttc
     4021 tgcactgttg tcataatagg ggtgcttcat cagaattcaa aagacacatc tatgcaaaag
     4081 accattccca ttgtagccct gacactgacc tcatacatgg gcttgaccca gccctttcta
     4141 gggctgtgtg catacatgtc cacgcaggtg tttggcagaa ggagtatacc tgtgaatgaa
     4201 gccttggcag cggctggctt ggtgggagtg ctagcagggc tagccttcca agacatggaa
     4261 aactttttgg gtccaatagc ggtggggggg atcctcatga tgttagttag tgtggcaggg
     4321 agagttgatg gactagagct caggaaactt ggtgaaatct cctgggaaga agaagctgaa
     4381 ataagtggaa gctctagccg ctatgatgtg gcactcagtg agcagggtga atttaaactc
     4441 ctctcagagg acaaagtgcc ctgggaccag atagtaatga catccctagc cctcgtggga
     4501 gcagccatac atccatttgc cctcttgctg gtcttgggag gatggatcct gcacattaaa
     4561 ggtgctagga ggagtgggga tgttctttgg gacattccta cgccaaaggt gattgaggaa
     4621 tgtgagcacc tggaggatgg gatctatggc atatttcagt caaccttcct tggagcctcg
     4681 cagcgaggtg ttggagtggc gcagggaggg gtcttccaca caatgtggca tgtcactagg
     4741 ggggcattcc tcttgaggaa tggaaagaaa ctggttccgt cttgggcttc tgtgaaggag
     4801 gatctggtgg cttatggtgg ttcctggaaa ctagacggga gatgggatgg tgaggaggaa
     4861 gtccaactca tcgctgctgt gcctggaaaa tctgttgtca acgttcaaac aaaaccaagc
     4921 ttgttcaaag tgaaaaatgg tggtgagatt ggagcagttg ctctagacta ccccagtgga
     4981 acctcaggct cccccattgt gaaccgaaat ggtgaagtgg ttgggctcta tggcaatgga
     5041 attctggtgg gtgataactc ctttgtgtct gccatctcac aaactgaatt gaaggaagaa
     5101 tccaaagaag aactgcaaga aataccaact atgctgaaaa aaggaatgac caccatcctt
     5161 gacttccacc ctggggcggg gaaaacccgt aggttcctgc ctcaaatatt ggcggagtgt
     5221 gccagaaggc gtttgcgcac tctggtatta gcacccacca gggttgtttt gtcagagatg
     5281 aaagaagctt ttcaggggtt ggatgtgaaa ttccacacac aagctttctc agcccatggg
     5341 agtgggaagg aggtcattga cgcaatgtgc catgcaaccc ttacatatag aatgctggaa
     5401 ccaacaaggg tagtcaactg ggaggtcatt attatggatg aggcgcactt tctggatcct
     5461 gctagcatag cagcgagagg ctgggcggct catagagcaa gagcaaatga gagcgccacc
     5521 atacttatga ccgccacccc accaggcacc agtgacgaat tccctcactc caatggtgag
     5581 attgaggacg tccagactga catccccagc gagccatgga ccacaggaca tgaatggatc
     5641 ttggcggaca agcgcccaac tgcatggttc cttccatcga tcagagcagc aaatgtcatg
     5701 gcagcctcgc tgcggaaagc gggaaaaaat gtggtggtac tgaataggaa aacctttgaa
     5761 aaggagtacc ccaccattaa gcagaagaaa ccggatttca tccttgccac cgatatcgct
     5821 gagatgggag caaacttgtg tgtggagaga gtcttggact gcagaactgc ctacaagcct
     5881 gtcctggttg atgaagggaa gaaggtggct atcaaagggc cgctacgaat ctcagcgtca
     5941 tcggccgctc agaggagagg acgcattgga cgcaatccca acagagatgg tgactcttac
     6001 tactactcag aacctaccag tgaggacaat gcacaccatg tgtgctggct ggaggcttcc
     6061 atgctcctgg ataacatgga ggttagaggg gggatggttg ctccacttta tggcattgag
     6121 ggaacaaaga ctcccgtctc tccaggagaa atgaggctaa gagatgatca gagaagggtc
     6181 tttagagagt tggtgcgagg gtgtgatttg ccagtgtggt tggcatggca agtggcaaaa
     6241 gccggcctga agaccaatga ccgcaaatgg tgttttgagg gtcccgaaga gcatgaaata
     6301 ctcaatgaca atggtgaaac agtaaagtgt agatctccgg gcggagcaaa aagagcattg
     6361 agacctagat ggtgtgacga gagagtttcc tcagaccaga gtgccttggc tgacttcatt
     6421 aagtttgcag aaggtagaag aggggctgct gagatgcttg tgatcctcac ggagttgccc
     6481 gacttcctgg caaagaaggg tggggaagcc atggatacca tcagtgtgtt cctacattct
     6541 gaagagggtt caagagcgta cagaaatgcc ctgtcaatga tgccagaagc catgaccatt
     6601 gtcatgctct tcctgcttgc cggactcttg acctcaggag cggtgatttt cttcatgtcg
     6661 ccaaaaggca tgagtagaat gtcaatggca atgggtacca tggctggcag tggatatctc
     6721 atgtttctgg ggggagtaaa accaacccac atctcttacg tcatgttaat attctttgtc
     6781 ctcatggtcg tcataattcc cgaaccagga cagcagagat caatccagga taaccaagtt
     6841 gcctacctca taattgggat cttgacattg ttatcagttg tggcagctaa tgaactaggg
     6901 atgctggaga agaccaagga agattttttt ggaaagagag acatcacaac accaagtggg
     6961 gcaatcccat ggagttggcc tgacctggat ctgaaacctg gggcggcctg gacagtctat
     7021 gtgggaatcg tgacgatgtt gtctcccatg ttacaccatt ggataaaagt tgagtatggc
     7081 aatttgtcac tatcgggaat agcccaatct gcctcagttc tttcatttat ggacaaagga
     7141 attcccttca tgaaaatgaa tatatctgtg gtcatacttt tggtcagtgg ctggaattca
     7201 atcacagtga tccctctttt gtgcggcatt ggtggagcca tgctgcactg gacgctcata
     7261 cttcctggga ttaaagccca gcaatcaaag ctggctcaaa aaagagtttt tcatggagtg
     7321 gcaaaaaatc cagttgttga tggcaatcca actgctgaca ttgaggaagc cccagaaatg
     7381 ccagctttat atgaaaagaa gctggctctt tacctccttc tggccctaag cctcatgtca
     7441 gttgccatgt gcagaacccc tttttcctta gcggaaggaa tagtactgtc atctgccgcc
     7501 cttggacctc tcattgaggg gaacactagt ctgttgtgga atggcccaat ggccgtttcc
     7561 atgactggag tcatgcgtgg caactactac gcttttgtgg gagtcatgta caatctctgg
     7621 aaaatgaaaa cagggcgtag agggagagca agtggaaaaa cattgggtga ggtctggaag
     7681 cgtgaactta acttgctaga caaacaacaa tttgaaatgt acaaaagaac agacatcatt
     7741 gaggtggacc gagacatggc acgacgacac ttggcagagg gaaaggtgga cacgggagtg
     7801 gccgtgtcga gagggactgc aaagctgaga tggttccacg agcgtggcta tgtgaagcta
     7861 gaaggaaggg tcaccgatct tgggtgtgga cgtggaggct ggtgctacta tgcagcagct
     7921 caaaaagaag ttagtggtgt gaaggggtat acccttggca gagatggcca tgagaaacct
     7981 atgaatgtcc aaagcttggg atggaatatt gtgactttta aggacaagac tgatattcac
     8041 cgactggagc cactcaagtg tgaaactctc ctctgtgaca tcggagaatc gtccccatcc
     8101 tccgcaactg agggtgagag gaccttaaga gttctggaca cagttgaaaa gtggttggct
     8161 tgtggagtgg ataacttttg catcaaagtt ctggcaccat acatgcccga tgtgatagag
     8221 aaactggagc ttcttcaaag aagattcggt ggaaccgtca tcaggaatcc tctgtccaga
     8281 aattctactc atgaaatgta ctacgtttca ggagcaagaa gtaacatcac attcacagtt
     8341 aaccagacat cacgcctgct gatgcgaagg atgaggcggc ccacaggcaa agttaccttg
     8401 gaagctgatg tcattcttcc gataggcacg cgcagtgtgg aaactgataa aggcccattg
     8461 gataaggatg ctattgagga aagagttgag agaatcaaga atgaatatgc cactacatgg
     8521 ttctatgaca atgacaaccc gtatagaacg tggcattatt gtggctccta tgtgaccaaa
     8581 acgtcaggaa gtgcagccag catgataaat ggagtcatca aaatcttgac ttttccatgg
     8641 gacaggatag aagaagtcac aagaatggca atgactgaca ccacaccttt tggacaacaa
     8701 agagttttca aggagaaagt agacacaaga gcaaaagacc ctcctgctgg aacaaggaag
     8761 atcatgaagg tggtgaatag atggttgttt cggcatctgt ccagggagaa gaaccccagg
     8821 ttgtgcacca aagaagaatt cattgccaaa gtacggagcc atgcagcagt gggggctttt
     8881 ctagaggaac aagagcagtg gaaaacggcc aatgaggcag tccttgatcc aaagttttgg
     8941 gaaatggtcg atgcagaacg caaacttcat cagcaggggc gatgccaatc ctgtgtgtac
     9001 aacatgatgg gaaagaggga aaagaaactc tctgaatttg gaaaggccaa agggagccgt
     9061 gctatctggt acatgtggct tggggcacgg ttccttgagt ttgaagctct tgggttttta
     9121 aatgaagatc actgggcctc ccgggagaac tcggggggag gagttgaggg cataggactc
     9181 cagtacttgg gctatgttat cagggacttg tcaaccaaag aaggtggagg gttttatgcg
     9241 gatgacacgg cagggtggga cacacgcatc acagaagctg acctggatga cgagcaagag
     9301 atcatgagtt acatgagccc tgaacaaagg aagctggcct gggctataat ggaaatgaca
     9361 tacaagaaca aagtggttaa ggtgctgagg ccagccccag gaggcaaggc cttcatggac
     9421 atcatcagcc ggagagacca aagggggtca ggacaagttg tgacatacgc cctcaacacc
     9481 ataaccaatc taaaagtcca gctcataaga atggctgaag ctgaaatggt gatcaaccat
     9541 cagcatgtgc aggagtgtgg tgaaaatgtc ttagagcggc ttgaaacttg gcttgctgaa
     9601 aacggatgtg acagattgag ccgaatggct gtgagtgggg atgattgtgt tgtgagaccg
     9661 gtggatgaca gatttggcct ggccctttcc catcttaatg caatgtccaa agttaggaag
     9721 gacatttcag aatggcaacc ctccaaagga tggacagatt gggaaaatgt tcctttctgc
     9781 tcccaccact tccatgaact ggtgttgaaa gatgggagga agatagtggt gccttgcaga
     9841 gatcaagatg aactgatagg gagagggaga gtgtccccag gaaatggctg gatgatcaag
     9901 gaaacagcct gcctcagcaa agcttacgca aacatgtggt cactgatgta ctttcacaag
     9961 agggacatga ggctactttc attcgctgtc tcctccgctg ttccaacggc ctgggtgccc
    10021 agtggaagga caacgtggtc tgtccacgga agaggggagt ggatgacaac tgaggacatg
    10081 ctagatgtct ggaacagggt gtgggtgttg aataacccgc acatgacgga caaaacaacc
    10141 atcaaggagt ggagagatgt tccctacctc acaaagagac aggataagct ttgcgggtca
    10201 ctgataggaa tgacaaacag ggccacatgg gcatctcaca tccaccttgt gatccaccgg
    10261 atcagaactc taataggtca agagaagttc acagactacc tcaccgtcat ggacaggtat
    10321 tctgttgatg ccgaccttca gccaggagag cttatctgag acattacaac atggaaaacc
    10381 gggataaaaa ctacgggtgg agaaccggac tccccacttg agaaatgtaa ataaaaaacc
    10441 gggataaaaa caacggatgg agaaccggac tccacactga ataggctata aacgtcagcc
    10501 caggatccaa aatttgaatg ggtcttgcca ccgctaagct gtgaggcggt gcgggctggg
    10561 acagccgttt cccgggcaac gacatgcctg gtttctggga cttcccaacc cggagtaaaa
    10621 cgaaggagcc tccgccacca ccctcccacg gggtgttgga aagatggggt ctagaggtta
    10681 gaggagaccc tccagggaaa ttagtgggac catattgacg ccagggaaag accggagtgg
    10741 ttctctgctt ttcctccagg ggtctgcgag cacagtttgc tctagaagaa gcagaccttt
    10801 ggatgacaaa acacaaaacc act

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1846518465100%0.0100%KU921608.1
1834818348100%0.099%KX027336.1
1833918339100%0.099%KX010995.1
1832318323100%0.099%KX010996.1
1804218042100%0.099%KX010994.1
1770317703100%0.098%AY968064.1
1132411324100%0.085%DQ235229.1
1130111301100%0.084%AY968065.1
1129011290100%0.084%JN620362.1
87818781100%0.079%JF912179.1
87638763100%0.079%JF912185.1
87608760100%0.079%AY603338.1
87498749100%0.079%JF912186.1
87428742100%0.079%JF912184.1
87298729100%0.079%AY572535.1
87278727100%0.079%JX898868.1
87278727100%0.079%JF912183.1
87228722100%0.079%JX898873.1
87168716100%0.079%JX898874.1
87138713100%0.079%KM388817.1
87138713100%0.079%JX898875.1
86978697100%0.079%JX898870.1
86958695100%0.079%KM388816.1
86938693100%0.079%JX898880.1
86918691100%0.079%JX898877.1
86918691100%0.079%JF912187.1
86898689100%0.079%JX898878.1
86888688100%0.079%JF912188.1
86808680100%0.079%JF912180.1
86688668100%0.079%JX898876.1
86528652100%0.079%JF912189.1
86528652100%0.079%JF912182.1
86508650100%0.079%JF912190.1
86468646100%0.079%HM582851.1
86418641100%0.079%JX898869.1
86328632100%0.079%KM388815.1
86328632100%0.079%KM388814.1
86308630100%0.079%AY640589.1
86268626100%0.079%KF769016.1
85968596100%0.079%KM388818.1
85798579100%0.079%KF907504.1
85678567100%0.079%U21056.1
85438543100%0.079%JX898872.1
85348534100%0.079%JX898871.1
85278527100%0.079%DQ100292.1
85228522100%0.079%U21055.1
85098509100%0.078%U17066.1
85078507100%0.078%GQ379162.1
85048504100%0.078%X03700.1
85008500100%0.078%KF769015.1
85008500100%0.078%JN811143.1
85008500100%0.078%JX503529.1
85008500100%0.078%JN628279.1
85008500100%0.078%AF052444.1
84958495100%0.078%JX949181.1
84958495100%0.078%GQ379163.1
84958495100%0.078%FJ654700.1
84958495100%0.078%DQ118157.1
84958495100%0.078%X15062.1
84958495100%0.078%AF052446.1
84958495100%0.078%AF052439.1
84958495100%0.078%AF052437.1
84958495100%0.078%U17067.1
84918491100%0.078%JN811141.1
84918491100%0.078%AF052445.1
84918491100%0.078%AF052438.1
84868486100%0.078%JN811142.1
84848484100%0.078%U54798.1
84248424100%0.078%AF094612.1
84158415100%0.078%JF912181.1
8215833097%0.078%DQ322634.1
8215833097%0.078%DQ322633.1
6538686681%0.078%DQ322635.1
3155315534%0.080%D14458.1
2237223726%0.078%AF052443.1
2232223226%0.078%AF052441.1
2228222826%0.078%GU951804.1
2127249327%0.080%AH005112.2
2125212517%0.086%AY960140.1
2118211822%0.080%DQ322638.1
2113211322%0.080%AF052440.1
2113211322%0.080%L06480.1
1916191622%0.078%DQ322642.1
1916191622%0.078%DQ322640.1
1810181014%0.087%U23578.1
1801180114%0.087%U23577.1
1792179214%0.087%DQ068260.1
1786178614%0.087%DQ068264.1
1786178614%0.087%DQ068263.1
1786178614%0.087%DQ068262.1
1786178614%0.087%AY839636.1
1777177714%0.087%AY839634.1
1773177314%0.087%U23573.1
1773177314%0.087%U23569.1
1768176814%0.087%U23575.1
1759175914%0.086%U23571.1
1746174617%0.081%AY960138.1
1745174514%0.086%U23576.1
1707170717%0.081%AY960137.1
1674167417%0.081%AY960139.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.