Jump to content
Sign in to follow this  
niman

Another Full PRVABC-59 Zika Sequence

Recommended Posts

LOCUS       KX377337               10807 bp    RNA     linear   VRL 22-JUN-2016
DEFINITION  Zika virus strain PRVABC-59, complete genome.
ACCESSION   KX377337
VERSION     KX377337.1  GI:1036637434
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10807)
  AUTHORS   Yun,S.-I., Song,B.-H., Frank,J.C., Julander,J.G., Polejaeva,I.A.,
            Davies,C.J., White,K.L. and Lee,Y.-M.
  TITLE     Complete Genome Sequences of Three Historically Important,
            Spatiotemporally Distinct, and Genetically Divergent Strains of
            Zika Virus: MR-766, P6-740, and PRVABC-59
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10807)
  AUTHORS   Yun,S.-I., Song,B.-H., Frank,J.C., Julander,J.G., Polejaeva,I.A.,
            Davies,C.J., White,K.L. and Lee,Y.-M.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUN-2016) Department of Animal, Dairy, and Veterinary
            Sciences (ADVS), College of Agriculture and Applied Sciences, Utah
            State University, UMC 9830 Old Main Hill, Logan, UT 84322, USA
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10807
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="PRVABC-59"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Puerto Rico"
                     /collection_date="Dec-2015"
                     /note="genotype: Asian lineage"
     CDS             108..10379
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ANK57897.1"
                     /db_xref="GI:1036637435"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMETIKKFKKDLAAMLRIINARKEKK
                     RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMGRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYVATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 agttgttgat ctgtgtgaat cagactgcga cagttcgagt ttgaagcgaa agctagcaac
       61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa
      121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga
      181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca
      241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc
      301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaacaata aagaagttca
      361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag
      421 gcgcagatac tagtgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg
      481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca
      541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac
      601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag
      661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc
      721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacca
      781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga
      841 ttagagtcga aaattggata ttcaggaacc ctggcttcgc gttagcagca gctgccatcg
      901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga
      961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta
     1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg
     1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg
     1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttctgac agccgctgcc
     1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa
     1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga
     1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc
     1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg
     1441 acacaggaca tgaaactgat gagaatagag cgaaagttga gataacgccc aattcaccga
     1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag
     1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca
     1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac
     1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg
     1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg
     1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa
     1861 tggataaact tagattgaag ggcgtgtcat actccttgtg tactgcagcg ttcacattca
     1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga
     1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag
     2041 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga
     2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga
     2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg
     2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg
     2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat
     2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt
     2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt
     2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga
     2521 aggagacgag atgcggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca
     2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg
     2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag
     2701 tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg
     2761 gatctgtaaa aaaccccatg gggagaggtc cacagagatt gcccgtgcct gtgaacgagc
     2821 tgccccacgg ctggaaggct tgggggaaat cgtatttcgt cagagcagca aagacaaata
     2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcaaacat agagcatgga
     2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg
     3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa
     3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga
     3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat
     3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac
     3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg
     3301 aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg gaggaaacat
     3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat
     3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttccg ggctaaagat ggctgttggt
     3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcaatggtga
     3541 ctgcaggatc aactgatcac atggaccact tctcccttgg agtgcttgtg atcctgctca
     3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg
     3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa
     3721 ttttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc
     3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt
     3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct
     3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa
     3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga
     4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg
     4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca
     4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt
     4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc
     4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg
     4321 ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca
     4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc
     4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc
     4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag
     4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg
     4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt
     4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag
     4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag
     4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat
     4861 ggaagctaga tgccgcctgg gatgggcaca gcgaggtgca gctcttggcc gtgccccccg
     4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca
     4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt
     5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaacggg agttatgtta
     5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccctcga
     5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga
     5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag
     5281 ctccaaccag ggttgtcgct gctgaaatgg aggaggccct tagagggctt ccagtgcgtt
     5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc
     5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata
     5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa
     5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc
     5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga
     5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg
     5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg
     5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt
     5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg
     5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg
     5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga
     6001 atcccaacaa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag
     6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc
     6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca
     6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg
     6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct
     6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca
     6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc
     6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag
     6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg
     6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg
     6601 cccaattgcc ggagacccta gagaccataa tgcttttggg gttgctggga acagtctcgc
     6661 tgggaatctt cttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg
     6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg
     6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc
     6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg
     6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc
     6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggacatt gacctgcggc
     7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac
     7081 atgcagtgac cacctcatac aacaactact ccttaatggc gatggccacg caagctggag
     7141 tgttgtttgg catgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc
     7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc
     7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc
     7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg
     7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca
     7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg
     7501 gggctctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga
     7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt
     7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag
     7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct
     7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca
     7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt
     7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag
     7921 ggggctggag ttactacgtc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa
     7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aacatagtcc
     8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt
     8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc
     8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt
     8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag
     8281 gattggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag
     8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg
     8401 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg
     8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga
     8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg
     8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg
     8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga
     8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc
     8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag
     8821 agctaggcaa acacaaacgg ccacgagtct gcaccaaaga agagttcatc aacaaggttc
     8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg
     8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga
     9001 gaggagagtg ccagagctgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg
     9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc
     9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag
     9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc
     9241 gtataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcattagca
     9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct
     9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag
     9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac
     9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata
     9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag
     9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag
     9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg
     9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact
     9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt
     9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag
     9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc
     9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg
    10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat
    10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc
    10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg
    10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca
    10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact
    10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag
    10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc
    10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg
    10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca
    10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg
    10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc
    10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc
    10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca
    10801 tgggtct

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1865118651100%0.0100%KX377337.1
1864218642100%0.099%KU501215.1
1863718637100%0.099%KX087101.2
1854318543100%0.099%KU365778.1
1853418534100%0.099%KU937936.1
1852918529100%0.099%KU365779.1
1852118521100%0.099%KU707826.1
1851618516100%0.099%KU365780.1
1851118511100%0.099%KU365777.1
184981849899%0.099%KU758877.1
1848918489100%0.099%KU509998.3
1848418484100%0.099%KX280026.1
1848418484100%0.099%KU991811.1
1848018480100%0.099%KX262887.1
1848018480100%0.099%KX051563.1
1847618476100%0.099%KU321639.1
184741847499%0.099%KU740184.2
1847418474100%0.099%KU729218.1
1847118471100%0.099%KX198135.1
1847118471100%0.099%KX197192.1
1847118471100%0.099%KU926309.1
1846218462100%0.099%KX247646.1
1846218462100%0.099%KX247632.1
184621846299%0.099%KU312312.1
1845818458100%0.099%KU940228.1
1845318453100%0.099%KX087102.1
184511845199%0.099%KJ776791.1
184491844999%0.099%KU761564.1
184491844999%0.099%KU497555.1
1844718447100%0.099%KU729217.2
1844718447100%0.099%KU527068.1
1844418444100%0.099%KU820897.3
184441844499%0.099%KX156774.1
1843818438100%0.099%KU870645.1
184371843799%0.099%KU955590.1
1843518435100%0.099%KU926310.1
184311843199%0.099%KX156776.1
1842618426100%0.099%KU853013.1
1842418424100%0.099%KU853012.1
184221842299%0.099%KX156775.1
184151841599%0.099%KU647676.1
1840218402100%0.099%KX117076.1
183971839799%0.099%KU922960.1
183931839399%0.099%KU922923.1
1839018390100%0.099%KX253996.1
1839018390100%0.099%KU820899.2
183721837299%0.099%KU963796.1
183721837299%0.099%KU820898.1
183661836699%0.099%KX056898.1
183361833699%0.099%KU955589.1
183361833699%0.099%KU501217.1
183301833099%0.099%KU501216.1
182671826799%0.099%KX185891.1
182581825899%0.099%KU866423.2
1825118251100%0.099%KU744693.1
182451824598%0.099%KU940224.1
1815918159100%0.099%KU681081.3
1785817858100%0.098%KU955593.1
177301773099%0.098%JN860885.1
176791767998%0.099%KF993678.1
175761757699%0.098%EU545988.1
1755117551100%0.098%KU681082.3
1653616536100%0.095%KX377336.1
164151641599%0.095%HQ234499.1
1343613436100%0.089%KU720415.1
1342113421100%0.089%KX377335.1
1342013420100%0.089%KF268949.1
1341613416100%0.089%KF268948.1
1341213412100%0.089%LC002520.1
1340913409100%0.089%KU955595.1
1340913409100%0.089%KF268950.1
1340013400100%0.089%KU955592.1
1339613396100%0.089%KU963573.1
1339613396100%0.089%KU955594.1
1338213382100%0.089%KU955591.1
133661385499%0.089%KX198134.1
1335513355100%0.089%AY632535.2
133291332999%0.089%HQ234498.1
133201332099%0.089%KF383115.1
133081330899%0.089%KF383119.1
132611326199%0.089%KF383116.1
132561336399%0.088%KU963574.1
132521325299%0.089%DQ859059.1
132361323699%0.089%HQ234501.1
132001320099%0.088%KF383117.1
131711317199%0.088%HQ234500.1
129941306299%0.088%KF383118.1
129061290696%0.089%KF383121.1
108711087196%0.084%KF383120.1
5115511527%0.099%KU758871.1
5113511327%0.099%KU758875.1
5108510827%0.099%KU758870.1
5106510627%0.099%KU758873.1
5093509327%0.099%KU758872.1
5083508327%0.099%KU758876.1
5063506327%0.099%KU312314.1
5054505427%0.099%KU758869.1
5038503827%0.099%KU312313.1
5029502927%0.099%KU758868.1
5023502327%0.099%KU758874.1

Share this post


Link to post
Share on other sites
LOCUS       KX087101               10771 bp ss-RNA     linear   VRL 12-MAY-2016
DEFINITION  Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete
            genome.
ACCESSION   KX087101
VERSION     KX087101.2  GI:1027485270
DBLINK      BioProject: PRJNA314889
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10771)
  AUTHORS   Shabman,R., Shilts,M., Puri,V., Dilley,K., Fedorova,N.,
            Stockwell,T., Shrivastava,S., Amedeo,P., Williams,M., Hu,L.,
            Das,S.R. and Rashid,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-APR-2016) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
REFERENCE   2  (bases 1 to 10771)
  AUTHORS   Shabman,R., Shilts,M., Puri,V., Dilley,K., Fedorova,N.,
            Shrivastava,S., Amedeo,P., Williams,M., Hu,L., Das,S.R. and
            Rashid,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-MAY-2016) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
  REMARK    Sequence update by submitter
COMMENT     On May 12, 2016 this sequence version replaced gi:1020267435.
            This work was supported by the National Institute of Allergy and
            Infectious Diseases (NIAID), Genome Center for Infectious Diseases
            (GCID) program.
            
            ##Genome-Assembly-Data-START##
            Current Finishing Status :: Finished
            Assembly Method          :: clc_ref_assemble_long v. 3.22.55705
            Genome Coverage          :: 245.4x
            Sequencing Technology    :: Illumina
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10771
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="ZIKV/Homo sapiens/PRI/PRVABC59/2015"
                     /isolate="V3/V2"
                     /host="Homo sapiens"
                     /db_xref="BEI:NR-50240"
                     /db_xref="taxon:64320"
                     /lab_host="Cercopithecus aethiops kidney epithelial cells"
                     /country="Puerto Rico"
                     /collection_date="Dec-2015"
                     /note="passage details: V3/V2 (CDC/BEI); V# = number of
                     passages in Vero cells"
     misc_feature    1..10771
                     /db_xref="ViPR:ZIKVBE_ZIKVBEI_00005.MAIN"
     gene            80..10351
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
     CDS             80..10351
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /codon_start=1
                     /product="genome polyprotein"
                     /protein_id="AMZ03556.1"
                     /db_xref="GI:1020267436"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMETIKKFKKDLAAMLRIINARKEKK
                     RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVELQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYVATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
     mat_peptide     80..391
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="capsid protein C"
                     /note="core protein"
     mat_peptide     446..724
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="protein pr"
     mat_peptide     725..949
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="small envelope protein M"
                     /note="membrane glycoprotein M"
     mat_peptide     950..2461
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="envelope protein E"
     mat_peptide     2462..3517
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="nonstructural protein NS1"
     mat_peptide     3518..4195
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="nonstructural protein NS2A"
     mat_peptide     4196..4585
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="nonstructural protein NS2B"
     mat_peptide     4586..6436
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="nonstructural protein NS3"
     mat_peptide     6437..6817
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="nonstructural protein NS4A"
     mat_peptide     6818..6886
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="protein 2K"
     mat_peptide     6887..7639
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="nonstructural protein NS4B"
     mat_peptide     7640..10348
                     /gene="GP1"
                     /locus_tag="A2G93_63481gpGP1"
                     /product="RNA-dependent RNA polymerase NS5"
                     /note="nonstructural protein 5"
ORIGIN      
        1 gacagttcga gtttgaagcg aaagctagca acagtatcaa caggttttat tttggatttg
       61 gaaacgagag tttctggtca tgaaaaaccc aaaaaagaaa tccggaggat tccggattgt
      121 caatatgcta aaacgcggag tagcccgtgt gagccccttt gggggcttga agaggctgcc
      181 agccggactt ctgctgggtc atgggcccat caggatggtc ttggcgattc tagccttttt
      241 gagattcacg gcaatcaagc catcactggg tctcatcaat agatggggtt cagtggggaa
      301 aaaagaggct atggaaacaa taaagaagtt caagaaagat ctggctgcca tgctgagaat
      361 aatcaatgct aggaaggaga agaagagacg aggcgcagat actagtgtcg gaattgttgg
      421 cctcctgctg accacagcta tggcagcgga ggtcactaga cgtgggagtg catactatat
      481 gtacttggac agaaacgatg ctggggaggc catatctttt ccaaccacat tggggatgaa
      541 taagtgttat atacagatca tggatcttgg acacatgtgt gatgccacca tgagctatga
      601 atgccctatg ctggatgagg gggtggaacc agatgacgtc gattgttggt gcaacacgac
      661 gtcaacttgg gttgtgtacg gaacctgcca tcacaaaaaa ggtgaagcac ggagatctag
      721 aagagctgtg acgctcccct cccattccac caggaagctg caaacgcggt cgcaaacctg
      781 gttggaatca agagaataca caaagcactt gattagagtc gaaaattgga tattcaggaa
      841 ccctggcttc gcgttagcag cagctgccat cgcttggctt ttgggaagct caacgagcca
      901 aaaagtcata tacttggtca tgatactgct gattgccccg gcatacagca tcaggtgcat
      961 aggagtcagc aatagggact ttgtggaagg tatgtcaggt gggacttggg ttgatgttgt
     1021 cttggaacat ggaggttgtg tcaccgtaat ggcacaggac aaaccgactg tcgacataga
     1081 gctggttaca acaacagtca gcaacatggc ggaggtaaga tcctactgct atgaggcatc
     1141 aatatcagac atggcttctg acagccgctg cccaacacaa ggtgaagcct accttgacaa
     1201 gcaatcagac actcaatatg tctgcaaaag aacgttagtg gacagaggct ggggaaatgg
     1261 atgtggactt tttggcaaag ggagcctggt gacatgcgct aagtttgcat gctccaagaa
     1321 aatgaccggg aagagcatcc agccagagaa tctggagtac cggataatgc tgtcagttca
     1381 tggctcccag cacagtggga tgatcgttaa tgacacagga catgaaactg atgagaatag
     1441 agcgaaagtt gagataacgc ccaattcacc gagagccgaa gccaccctgg ggggttttgg
     1501 aagcctagga cttgattgtg aaccgaggac aggccttgac ttttcagatt tgtattactt
     1561 gactatgaat aacaagcact ggttggttca caaggagtgg ttccacgaca ttccattacc
     1621 ttggcacgct ggggcagaca ccggaactcc acactggaac aacaaagaag cactggtaga
     1681 gttcaaggac gcacatgcca aaaggcaaac tgtcgtggtt ctagggagtc aagaaggagc
     1741 agttcacacg gcccttgctg gagctctgga ggctgagatg gatggtgcaa agggaaggct
     1801 gtcctctggc cacttgaaat gtcgcctgaa aatggataaa cttagattga agggcgtgtc
     1861 atactccttg tgtactgcag cgttcacatt caccaagatc ccggctgaaa cactgcacgg
     1921 gacagtcaca gtggagttac agtacgcagg gacagatgga ccttgcaagg ttccagctca
     1981 gatggcggtg gacatgcaaa ctctgacccc agttgggagg ttgataaccg ctaaccccgt
     2041 aatcactgaa agcactgaga actctaagat gatgctggaa cttgatccac catttgggga
     2101 ctcttacatt gtcataggag tcggggagaa gaagatcacc caccactggc acaggagtgg
     2161 cagcaccatt ggaaaagcat ttgaagccac tgtgagaggt gccaagagaa tggcagtctt
     2221 gggagacaca gcctgggact ttggatcagt tggaggcgct ctcaactcat tgggcaaggg
     2281 catccatcaa atttttggag cagctttcaa atcattgttt ggaggaatgt cctggttctc
     2341 acaaattctc attggaacgt tgctgatgtg gttgggtctg aacacaaaga atggatctat
     2401 ttcccttatg tgcttggcct tagggggagt gttgatcttc ttatccacag ccgtctctgc
     2461 tgatgtgggg tgctcggtgg acttctcaaa gaaggagacg agatgcggta caggggtgtt
     2521 cgtctataac gacgttgaag cctggaggga caggtacaag taccatcctg actccccccg
     2581 tagattggca gcagcagtca agcaagcctg ggaagatggt atctgcggga tctcctctgt
     2641 ttcaagaatg gaaaacatca tgtggagatc agtagaaggg gagctcaacg caatcctgga
     2701 agagaatgga gttcaactga cggtcgttgt gggatctgta aaaaacccca tgtggagagg
     2761 tccacagaga ttgcccgtgc ctgtgaacga gctgccccac ggctggaagg cttgggggaa
     2821 atcgtatttc gtcagagcag caaagacaaa taacagcttt gtcgtggatg gtgacacact
     2881 gaaggaatgc ccactcaaac atagagcatg gaacagcttt cttgtggagg atcatgggtt
     2941 cggggtattt cacactagtg tctggctcaa ggttagagaa gattattcat tagagtgtga
     3001 tccagccgtt attggaacag ctgttaaggg aaaggaggct gtacacagtg atctaggcta
     3061 ctggattgag agtgagaaga atgacacatg gaggctgaag agggcccatc tgatcgagat
     3121 gaaaacatgt gaatggccaa agtcccacac attgtggaca gatggaatag aagagagtga
     3181 tctgatcata cccaagtctt tagctgggcc actcagccat cacaatacca gagagggcta
     3241 caggacccaa atgaaagggc catggcacag tgaagagctt gaaattcggt ttgaggaatg
     3301 cccaggcact aaggtccacg tggaggaaac atgtggaaca agaggaccat ctctgagatc
     3361 aaccactgca agcggaaggg tgatcgagga atggtgctgc agggagtgca caatgccccc
     3421 actgtcgttc cgggctaaag atggctgttg gtatggaatg gagataaggc ccaggaaaga
     3481 accagaaagc aacttagtaa ggtcaatggt gactgcagga tcaactgatc acatggacca
     3541 cttctccctt ggagtgcttg tgatcctgct catggtgcag gaagggctga agaagagaat
     3601 gaccacaaag atcatcataa gcacatcaat ggcagtgctg gtagctatga tcctgggagg
     3661 attttcaatg agtgacctgg ctaagcttgc aattttgatg ggtgccacct tcgcggaaat
     3721 gaacactgga ggagatgtag ctcatctggc gctgatagcg gcattcaaag tcagaccagc
     3781 gttgctggta tctttcatct tcagagctaa ttggacaccc cgtgaaagca tgctgctggc
     3841 cttggcctcg tgtcttttgc aaactgcgat ctccgccttg gaaggcgacc tgatggttct
     3901 catcaatggt tttgctttgg cctggttggc aatacgagcg atggttgttc cacgcactga
     3961 taacatcacc ttggcaatcc tggctgctct gacaccactg gcccggggca cactgcttgt
     4021 ggcgtggaga gcaggccttg ctacttgcgg ggggtttatg ctcctctctc tgaagggaaa
     4081 aggcagtgtg aagaagaact taccatttgt catggccctg ggactaaccg ctgtgaggct
     4141 ggtcgacccc atcaacgtgg tgggactgct gttgctcaca aggagtggga agcggagctg
     4201 gccccctagc gaagtactca cagctgttgg cctgatatgc gcattggctg gagggttcgc
     4261 caaggcagat atagagatgg ctgggcccat ggccgcggtc ggtctgctaa ttgtcagtta
     4321 cgtggtctca ggaaagagtg tggacatgta cattgaaaga gcaggtgaca tcacatggga
     4381 aaaagatgcg gaagtcactg gaaacagtcc ccggctcgat gtggcgctag atgagagtgg
     4441 tgatttctcc ctggtggagg atgacggtcc ccccatgaga gagatcatac tcaaggtggt
     4501 cctgatgacc atctgtggca tgaacccaat agccataccc tttgcagctg gagcgtggta
     4561 cgtatacgtg aagactggaa aaaggagtgg tgctctatgg gatgtgcctg ctcccaagga
     4621 agtaaaaaag ggggagacca cagatggagt gtacagagta atgactcgta gactgctagg
     4681 ttcaacacaa gttggagtgg gagttatgca agagggggtc tttcacacta tgtggcacgt
     4741 cacaaaagga tccgcgctga gaagcggtga agggagactt gatccatact ggggagatgt
     4801 caagcaggat ctggtgtcat actgtggtcc atggaagcta gatgccgcct gggatgggca
     4861 cagcgaggtg cagctcttgg ccgtgccccc cggagagaga gcgaggaaca tccagactct
     4921 gcccggaata tttaagacaa aggatgggga cattggagcg gttgcgctgg attacccagc
     4981 aggaacttca ggatctccaa tcctagacaa gtgtgggaga gtgataggac tttatggcaa
     5041 tggggtcgtg atcaaaaacg ggagttatgt tagtgccatc acccaaggga ggagggagga
     5101 agagactcct gttgagtgct tcgagccctc gatgctgaag aagaagcagc taactgtctt
     5161 agacttgcat cctggagctg ggaaaaccag gagagttctt cctgaaatag tccgtgaagc
     5221 cataaaaaca agactccgta ctgtgatctt agctccaacc agggttgtcg ctgctgaaat
     5281 ggaggaggcc cttagagggc ttccagtgcg ttatatgaca acagcagtca atgtcaccca
     5341 ctctggaaca gaaatcgtcg acttaatgtg ccatgccacc ttcacttcac gtctactaca
     5401 gccaatcaga gtccccaact ataatctgta tattatggat gaggcccact tcacagatcc
     5461 ctcaagtata gcagcaagag gatacatttc aacaagggtt gagatgggcg aggcggctgc
     5521 catcttcatg accgccacgc caccaggaac ccgtgacgca tttccggact ccaactcacc
     5581 aattatggac accgaagtgg aagtcccaga gagagcctgg agctcaggct ttgattgggt
     5641 gacggatcat tctggaaaaa cagtttggtt tgttccaagc gtgaggaacg gcaatgagat
     5701 cgcagcttgt ctgacaaagg ctggaaaacg ggtcatacag ctcagcagaa agacttttga
     5761 gacagagttc cagaaaacaa aacatcaaga gtgggacttt gtcgtgacaa ctgacatttc
     5821 agagatgggc gccaacttta aagctgaccg tgtcatagat tccaggagat gcctaaagcc
     5881 ggtcatactt gatggcgaga gagtcattct ggctggaccc atgcctgtca cacatgccag
     5941 cgctgcccag aggagggggc gcataggcag gaatcccaac aaacctggag atgagtatct
     6001 gtatggaggt gggtgcgcag agactgacga agaccatgca cactggcttg aagcaagaat
     6061 gctccttgac aatatttacc tccaagatgg cctcatagcc tcgctctatc gacctgaggc
     6121 cgacaaagta gcagccattg agggagagtt caagcttagg acggagcaaa ggaagacctt
     6181 tgtggaactc atgaaaagag gagatcttcc tgtttggctg gcctatcagg ttgcatctgc
     6241 cggaataacc tacacagata gaagatggtg ctttgatggc acgaccaaca acaccataat
     6301 ggaagacagt gtgccggcag aggtgtggac cagacacgga gagaaaagag tgctcaaacc
     6361 gaggtggatg gacgccagag tttgttcaga tcatgcggcc ctgaagtcat tcaaggagtt
     6421 tgccgctggg aaaagaggag cggcttttgg agtgatggaa gccctgggaa cactgccagg
     6481 acacatgaca gagagattcc aggaagccat tgacaacctc gctgtgctca tgcgggcaga
     6541 gactggaagc aggccttaca aagccgcggc ggcccaattg ccggagaccc tagagaccat
     6601 aatgcttttg gggttgctgg gaacagtctc gctgggaatc ttcttcgtct tgatgaggaa
     6661 caagggcata gggaagatgg gctttggaat ggtgactctt ggggccagcg catggctcat
     6721 gtggctctcg gaaattgagc cagccagaat tgcatgtgtc ctcattgttg tgttcctatt
     6781 gctggtggtg ctcatacctg agccagaaaa gcaaagatct ccccaggaca accaaatggc
     6841 aatcatcatc atggtagcag taggtcttct gggcttgatt accgccaatg aactcggatg
     6901 gttggagaga acaaagagtg acctaagcca tctaatggga aggagagagg agggggcaac
     6961 cataggattc tcaatggaca ttgacctgcg gccagcctca gcttgggcca tctatgctgc
     7021 cttgacaact ttcattaccc cagccgtcca acatgcagtg accacctcat acaacaacta
     7081 ctccttaatg gcgatggcca cgcaagctgg agtgttgttt ggcatgggca aagggatgcc
     7141 attctacgca tgggactttg gagtcccgct gctaatgata ggttgctact cacaattaac
     7201 acccctgacc ctaatagtgg ccatcatttt gctcgtggcg cactacatgt acttgatccc
     7261 agggctgcag gcagcagctg cgcgtgctgc ccagaagaga acggcagctg gcatcatgaa
     7321 gaaccctgtt gtggatggaa tagtggtgac tgacattgac acaatgacaa ttgaccccca
     7381 agtggagaaa aagatgggac aggtgctact catagcagta gccgtctcca gcgccatact
     7441 gtcgcggacc gcctgggggt ggggggaggc tggggctctg atcacagccg caacttccac
     7501 tttgtgggaa ggctctccga acaagtactg gaactcctct acagccactt cactgtgtaa
     7561 catttttagg ggaagttact tggctggagc ttctctaatc tacacagtaa caagaaacgc
     7621 tggcttggtc aagagacgtg ggggtggaac aggagagacc ctgggagaga aatggaaggc
     7681 ccgcttgaac cagatgtcgg ccctggagtt ctactcctac aaaaagtcag gcatcaccga
     7741 ggtgtgcaga gaagaggccc gccgcgccct caaggacggt gtggcaacgg gaggccatgc
     7801 tgtgtcccga ggaagtgcaa agctgagatg gttggtggag cggggatacc tgcagcccta
     7861 tggaaaggtc attgatcttg gatgtggcag agggggctgg agttactacg tcgccaccat
     7921 ccgcaaagtt caagaagtga aaggatacac aaaaggaggc cctggtcatg aagaacccgt
     7981 gttggtgcaa agctatgggt ggaacatagt ccgtcttaag agtggggtgg acgtctttca
     8041 tatggcggct gagccgtgtg acacgttgct gtgtgacata ggtgagtcat catctagtcc
     8101 tgaagtggaa gaagcacgga cgctcagagt cctctccatg gtgggggatt ggcttgaaaa
     8161 aagaccagga gccttttgta taaaagtgtt gtgcccatac accagcacta tgatggaaac
     8221 cctggagcga ctgcagcgta ggtatggggg aggactggtc agagtgccac tctcccgcaa
     8281 ctctacacat gagatgtact gggtctctgg agcgaaaagc aacaccataa aaagtgtgtc
     8341 caccacgagc cagctcctct tggggcgcat ggacgggcct aggaggccag tgaaatatga
     8401 ggaggatgtg aatctcggct ctggcacgcg ggctgtggta agctgcgctg aagctcccaa
     8461 catgaagatc attggtaacc gcattgaaag gatccgcagt gagcacgcgg aaacgtggtt
     8521 ctttgacgag aaccacccat ataggacatg ggcttaccat ggaagctatg aggcccccac
     8581 acaagggtca gcgtcctctc taataaacgg ggttgtcagg ctcctgtcaa aaccctggga
     8641 tgtggtgact ggagtcacag gaatagccat gaccgacacc acaccgtatg gtcagcaaag
     8701 agttttcaag gaaaaagtgg acactagggt gccagacccc caagaaggca ctcgtcaggt
     8761 tatgagcatg gtctcttcct ggttgtggaa agagctaggc aaacacaaac ggccacgagt
     8821 ctgcaccaaa gaagagttca tcaacaaggt tcgtagcaat gcagcattag gggcaatatt
     8881 tgaagaggaa aaagagtgga agactgcagt ggaagctgtg aacgatccaa ggttctgggc
     8941 tctagtggac aaggaaagag agcaccacct gagaggagag tgccagagct gtgtgtacaa
     9001 catgatggga aaaagagaaa agaaacaagg ggaatttgga aaggccaagg gcagccgcgc
     9061 catctggtat atgtggctag gggctagatt tctagagttc gaagcccttg gattcttgaa
     9121 cgaggatcac tggatgggga gagagaactc aggaggtggt gttgaagggc tgggattaca
     9181 aagactcgga tatgtcctag aagagatgag tcgtatacca ggaggaagga tgtatgcaga
     9241 tgacactgct ggctgggaca cccgcattag caggtttgat ctggagaatg aagctctaat
     9301 caccaaccaa atggagaaag ggcacagggc cttggcattg gccataatca agtacacata
     9361 ccaaaacaaa gtggtaaagg tccttagacc agctgaaaaa gggaaaacag ttatggacat
     9421 tatttcgaga caagaccaaa gggggagcgg acaagttgtc acttacgctc ttaacacatt
     9481 taccaaccta gtggtgcaac tcattcggaa tatggaggct gaggaagttc tagagatgca
     9541 agacttgtgg ctgctgcgga ggtcagagaa agtgaccaac tggttgcaga gcaacggatg
     9601 ggataggctc aaacgaatgg cagtcagtgg agatgattgc gttgtgaagc caattgatga
     9661 taggtttgca catgccctca ggttcttgaa tgatatggga aaagttagga aggacacaca
     9721 agagtggaaa ccctcaactg gatgggacaa ctgggaagaa gttccgtttt gctcccacca
     9781 cttcaacaag ctccatctca aggacgggag gtccattgtg gttccctgcc gccaccaaga
     9841 tgaactgatt ggccgggccc gcgtctctcc aggggcggga tggagcatcc gggagactgc
     9901 ttgcctagca aaatcatatg cgcaaatgtg gcagctcctt tatttccaca gaagggacct
     9961 ccgactgatg gccaatgcca tttgttcatc tgtgccagtt gactgggttc caactgggag
    10021 aactacctgg tcaatccatg gaaagggaga atggatgacc actgaagaca tgcttgtggt
    10081 gtggaacaga gtgtggattg aggagaacga ccacatggaa gacaagaccc cagttacgaa
    10141 atggacagac attccctatt tgggaaaaag ggaagacttg tggtgtggat ctctcatagg
    10201 gcacagaccg cgcaccacct gggctgagaa cattaaaaac acagtcaaca tggtgcgcag
    10261 gatcataggt gatgaagaaa agtacatgga ctacctatcc acccaagttc gctacttggg
    10321 tgaagaaggg tctacacctg gagtgctgta agcaccaatc ttaatgttgt caggcctgct
    10381 agtcagccac agcttgggga aagctgtgca gcctgtgacc cccccaggag aagctgggaa
    10441 accaagccta tagtcaggcc gagaacgcca tggcacggaa gaagccatgc tgcctgtgag
    10501 cccctcagag gacactgagt caaaaaaccc cacgcgcttg gaggcgcagg atgggaaaag
    10561 aaggtggcga ccttccccac ccttcaatct ggggcctgaa ctggagatca gctgtggatc
    10621 tccagaagag ggactagtgg ttagaggaga ccccccggaa aacgcaaaac agcatattga
    10681 cgctgggaaa gaccagagac tccatgagtt tccaccacgc tggccgccag gcacagatcg
    10741 ccgaatagcg gcggccggtg tggggaaatc c

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1852518525100%0.0100%KX087101.2
1852018520100%0.099%KU501215.1
1851118511100%0.099%KX377337.1
1842918429100%0.099%KU758877.1
1842018420100%0.099%KU365778.1
1841118411100%0.099%KU937936.1
1840818408100%0.099%KU707826.1
1840818408100%0.099%KU365779.1
1839318393100%0.099%KU365780.1
1839318393100%0.099%KU312312.1
1839018390100%0.099%KU365777.1
1837518375100%0.099%KU509998.3
1837518375100%0.099%KU820898.1
1837218372100%0.099%KX056898.1
1837218372100%0.099%KJ776791.1
1836618366100%0.099%KU740184.2
1836618366100%0.099%KU761564.1
1836318363100%0.099%KX280026.1
1836318363100%0.099%KU991811.1
1836318363100%0.099%KU955590.1
1836318363100%0.099%KU321639.1
1835718357100%0.099%KX262887.1
1835718357100%0.099%KX051563.1
1835418354100%0.099%KU729218.1
1834818348100%0.099%KX198135.1
1834818348100%0.099%KX197192.1
1834818348100%0.099%KU926309.1
1834518345100%0.099%KU940228.1
1833918339100%0.099%KX247646.1
1833918339100%0.099%KX247632.1
1833918339100%0.099%KX156776.1
1833918339100%0.099%KU501217.1
1833618336100%0.099%KX156774.1
1833618336100%0.099%KU647676.1
1833618336100%0.099%KU501216.1
1833018330100%0.099%KU820897.3
1833018330100%0.099%KX156775.1
1833018330100%0.099%KX087102.1
1832718327100%0.099%KU729217.2
183271832799%0.099%KU497555.1
1832718327100%0.099%KU527068.1
1831818318100%0.099%KU870645.1
1831818318100%0.099%KU922960.1
1831218312100%0.099%KU926310.1
1831218312100%0.099%KU922923.1
1830318303100%0.099%KU853013.1
1830318303100%0.099%KU853012.1
1828218282100%0.099%KX117076.1
1827318273100%0.099%KX185891.1
1827318273100%0.099%KU963796.1
1826718267100%0.099%KX253996.1
1826718267100%0.099%KU955589.1
1826718267100%0.099%KU820899.2
1826418264100%0.099%KU866423.2
182491824999%0.099%KU940224.1
1813718137100%0.099%KU744693.1
1803818038100%0.099%KU681081.3
1773517735100%0.098%KU955593.1
177351773599%0.098%JN860885.1
176851768598%0.099%KF993678.1
1758017580100%0.098%EU545988.1
1742917429100%0.098%KU681082.3
164201642099%0.095%HQ234499.1
1641516415100%0.095%KX377336.1
1333113331100%0.089%KU720415.1
133261332699%0.089%HQ234498.1
1331713317100%0.089%KX377335.1
1331513315100%0.089%KF383115.1
1331113311100%0.089%KF268949.1
1331113311100%0.089%KF268948.1
1330813308100%0.089%LC002520.1
1330413304100%0.089%KF383119.1
1330413304100%0.089%KF268950.1
1329913299100%0.089%KU955595.1
1329213292100%0.089%KU963573.1
1329213292100%0.089%KU955594.1
1329013290100%0.089%KU955592.1
1327713765100%0.089%KX198134.1
1327213272100%0.089%KU955591.1
1325713257100%0.089%KF383116.1
1325713257100%0.089%DQ859059.1
1325013250100%0.089%AY632535.2
132321323299%0.089%HQ234501.1
1319613196100%0.088%KF383117.1
1316713275100%0.088%KU963574.1
131651316599%0.088%HQ234500.1
1299013058100%0.088%KF383118.1
129001290097%0.089%KF383121.1
108771087797%0.084%KF383120.1
5025502527%0.099%KX212103.1
4991499127%0.099%KU758875.1
4989498927%0.099%KU758871.1
4982498227%0.099%KU758870.1
4980498027%0.099%KU758873.1
4980498027%0.099%KU312314.1
4967496727%0.099%KU758872.1
4956495627%0.099%KU758876.1
4953495327%0.099%KU312313.1
4928492826%0.099%KU758869.1
4902490226%0.099%KU758868.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!

Register a new account

Sign in

Already have an account? Sign in here.

Sign In Now
Sign in to follow this  

  • Recently Browsing   0 members

    No registered users viewing this page.

×