Sign in to follow this  
Followers 0
niman

Full 2016 Zika Sequence Shenzhen ex-Samoa

3 posts in this topic

CAS Key Laboratory of Pathogenic Microbiology and Immunology has release a full 2016 sequence, SMGC-1, from Shenzhen ex-Samoa.

Share this post


Link to post
Share on other sites
LOCUS       KX266255               10785 bp    RNA     linear   VRL 10-AUG-2016
DEFINITION  Zika virus isolate ZIKV_SMGC-1, complete genome.
ACCESSION   KX266255
VERSION     KX266255.1  GI:1032810274
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10785)
  AUTHORS   Bi,Y., Wang,Q., Yang,Y., Liu,Y. and Gao,G.F.
  TITLE     Genetic and Biological Characterization for Zika Viruses Imported
            through Shenzhen Port
  JOURNAL   Chin. Sci. Bull. 61 (22), 2463-2474 (2016)
REFERENCE   2  (bases 1 to 10785)
  AUTHORS   Bi,Y., Wang,Q., Yang,Y., Liu,Y. and Gao,G.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAY-2016) CAS Key Laboratory of Pathogenic
            Microbiology and Immunology, Institute of Microbiology, Chinese
            Academy of Sciences, No. 1 West Beichen Road Chaoyang District,
            Beijing 100101, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10785
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="ZIKV_SMGC-1"
                     /isolation_source="serum"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="China"
                     /collection_date="14-Feb-2016"
                     /note="passage details: Vero cells"
     CDS             99..10370
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ANH21697.1"
                     /db_xref="GI:1032810275"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGADTNVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGARRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFQAKDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPXVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRSMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVRPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 tctgtgtgaa tcagactgcg acagttcgag tttgaagcga aagctagcaa cagtatcaac
       61 aggttttatt ttggatttgg aaacgagagt ttctggtcat gaaaaaccca aaaaagaaat
      121 ccggaggatt ccggattgtc aatatgctaa aacgcggagt agcccgtgtg agcccctttg
      181 ggggcttgaa gaggctgcca gccggacttc tgctgggtca tgggcccatc aggatggtct
      241 tggcgattct agccttcttg agattcacgg caatcaagcc atcactgggt ctcatcaata
      301 gatggggttc agtggggaaa aaagaggcta tggaaataat aaagaagttc aagaaagatc
      361 tggctgccat gctgagaata atcaatgcta ggaaggagaa gaagagacga ggcgcagata
      421 ctaatgtcgg aattgttggc ctcctgctga ccacagctat ggcagcggag gtcactagac
      481 gtgggagtgc atactatatg tacttggaca gaaacgatgc tggggaggcc atatcttttc
      541 caaccacatt ggggatgaat aagtgttata tacagatcat ggatcttgga cacatgtgtg
      601 atgccaccat gagctatgaa tgccctatgc tggatgaggg ggtggaacca gatgacgtcg
      661 attgttggtg caacacgacg tcaacttggg ttgtgtacgg aacctgccat cacaaaaaag
      721 gtgaagcacg gagatctaga agagctgtga cgctcccctc ccattccact aggaagctgc
      781 aaacgcggtc gcaaacttgg ttggaatcaa gagaatacac aaagcacttg attagagtcg
      841 aaaattggat attcaggaac cctggcttcg cgttagcagc agctgccatc gcttggcttt
      901 tgggaagctc aacgagccaa aaagtcatat acttggtcat gatactgctg attgccccgg
      961 catacagcat caggtgcata ggagtcagca atagggactt tgtggaaggt atgtcaggtg
     1021 ggacttgggt tgatgttgtc ttggaacatg gaggttgtgt caccgtaatg gcacaggaca
     1081 aaccgactgt cgacatagag ctggttacaa caacagtcag caacatggcg gaggtaagat
     1141 cctactgcta tgaggcatca atatcggaca tggcttcgga cagccgctgc ccaacacaag
     1201 gtgaagccta ccttgacaag caatcagaca ctcaatatgt ctgcaaaaga acgttagtgg
     1261 acagaggctg gggaaatgga tgtggacttt ttggcaaagg gagcctggtg acatgcgcta
     1321 agtttgcatg ctccaagaaa atgaccggga agagcatcca gccagagaat ctggagtacc
     1381 ggataatgct gtcagttcat ggctcccagc acagtgggat gatcgttaat gacacaggac
     1441 atgaaactga tgagaataga gcgaaggttg agataacgcc caattcacca agagccgaag
     1501 ccaccctggg gggttttgga agcctaggac ttgattgtga accgaggaca ggccttgact
     1561 tttcagattt gtattacttg actatgaata acaagcactg gttggttcac aaggagtggt
     1621 tccacgacat tccattacct tggcacgctg gggcagacac cggaactcca cactggaaca
     1681 acaaagaagc actggtagag ttcaaggacg cacatgccaa aaggcaaact gtcgtggttc
     1741 tagggagtca agaaggagca gttcacacgg cccttgctgg agctctggag gctgagatgg
     1801 atggtgcaaa gggaaggctg tcctctggcc acttgaaatg tcgcctgaaa atggataaac
     1861 ttagattgaa gggcgtgtca tactccttgt gtaccgcagc gttcacattc accaagatcc
     1921 cggctgaaac actgcacggg acagtcacag tggaggtaca gtacgcaggg acagatggac
     1981 cttgcaaggt tccagctcag atggcggtgg acatgcaaac tctgacccca gttgggaggc
     2041 tgataaccgc taaccccgta atcactgaaa gcactgagaa ctccaagatg atgctggaac
     2101 ttgatccacc atttggggac tcttacattg tcataggagt cggggagaag aagatcaccc
     2161 accactggca caggagtggc agcaccattg gaaaagcatt tgaagccact gtgagaggtg
     2221 ccaggagaat ggcagtcttg ggagacacag cctgggactt tggatcagtt ggaggcgctc
     2281 tcaactcatt gggcaagggc atccatcaaa tttttggagc agctttcaaa tcattgtttg
     2341 gaggaatgtc ctggttctca caaattctca ttggaacgtt gctgatgtgg ttgggtctga
     2401 acacaaagaa tggatctatt tcccttatgt gcttggcctt agggggagtg ttgatcttct
     2461 tatccacagc cgtctctgct gatgtggggt gctcggtgga cttctcaaag aaggagacga
     2521 gatgcggtac aggggtgttc gtctataacg acgttgaagc ctggagggac aggtacaagt
     2581 accatcctga ctccccccgt agattggcag cagcagtcaa gcaagcctgg gaagatggta
     2641 tctgtgggat ctcctctgtt tcaagaatgg aaaacatcat gtggagatca gtagaagggg
     2701 agctcaacgc aatcctggaa gagaatggag ttcaactgac ggtcgttgtg ggatctgtaa
     2761 aaaaccccat gtggagaggt ccacagagat tgcccgtgcc tgtgaacgag ctgccccacg
     2821 gctggaaggc ttgggggaaa tcgtacttcg tcagagcagc aaagacaaat aacagctttg
     2881 tcgtggatgg tgacacactg aaggaatgcc cactcaaaca tagagcatgg aacagctttc
     2941 ttgtggagga tcatgggttc ggggtatttc acactagtgt ctggctcaag gttagagaag
     3001 attattcatt agagtgtgat ccagccgtta ttggaacagc tgttaaggga aaggaggctg
     3061 tacacagtga tctaggctac tggattgaga gtgagaagaa tgacacatgg aggctgaaga
     3121 gggcccatct gatcgagatg aaaacatgtg aatggccaaa gtcccacaca ttgtggacag
     3181 atggaataga agagagtgat ctgatcatac ccaagtcttt agctgggcca ctcagccatc
     3241 acaataccag agagggctac aggacccaaa tgaaagggcc atggcacagt gaagagcttg
     3301 aaattcggtt tgaggaatgc ccaggcacca aggtccacgt ggaggaaaca tgtggaacaa
     3361 gaggaccatc tctgagatca accactgcaa gcggaagggt gatcgaggaa tggtgctgca
     3421 gggagtgcac aatgccccca ctgtcgttcc aggctaaaga tggctgttgg tatggaatgg
     3481 agataaggcc caggaaagaa ccagaaagta acttagtaag gtcaatggtg actgcaggat
     3541 caactgatca catggatcac ttctcccttg gagtgcttgt gattctgctc atggtgcagg
     3601 aagggctgaa gaagagaatg accacaaaga tcatcataag cacatcaatg gcagtgctgg
     3661 tagctatgat cctgggagga ttttcaatga gtgacctggc taagcttgca attttgatgg
     3721 gtgccacctt cgcggaaatg aacactggag gagatgtagc tcatctggcg ctgatagcgg
     3781 cattcaaagt cagaccagcg ttgctggtat ctttcatctt cagagctaat tggacacccc
     3841 gtgaaagcat gctgctggcc ttggcctcgt gtcttttgca aactgcgatc tccgccttgg
     3901 aaggcgacct gatggttctc atcaatggtt ttgctttggc ctggttggca atacgagcga
     3961 tggttgttcc acgcactgat aacatcacct tggcaatcct ggctgctctg acaccactgg
     4021 cccggggcac actgcttgtg gcgtggagag caggccttgc tacttgcggg gggtttatgc
     4081 tcctctctct gaagggaaaa ggcagtgtga agaagaactt accanttgtc atggccctgg
     4141 gactaaccgc tgtgaggctg gtcgacccca tcaacgtggt gggactgctg ttgctcacaa
     4201 ggagtgggaa gcggagctgg ccccctagcg aagtactcac agctgttggc ctgatatgcg
     4261 cattggctgg agggttcgcc aaggcagata tagagatggc tgggcccatg gccgcggtcg
     4321 gtctgctaat tgtcagttac gtggtctcag gaaagagtgt ggacatgtac attgaaagag
     4381 caggtgacat cacatgggaa aaagatgcgg aagtcactgg aaacagtccc cggcttgatg
     4441 tggcgctaga tgagagtggt gatttctccc tggtggagga tgacggtccc cccatgagag
     4501 agatcatact caaggtggtc ctgatgacca tctgtggcat gaacccaata gccataccct
     4561 ttgcagctgg agcgtggtac gtatacgtga agactggaaa aaggagtgga gctctatggg
     4621 atgtgcctgc tcccaaggaa gtaaaaaagg gggagaccac agatggagtg tacagagtga
     4681 tgactcgtag actgctaggt tcaacacaag ttggagtggg agttatgcaa gagggggtct
     4741 ttcacaccat gtggcacgtc acaaaaggat ccgcgctgag aagcggtgaa gggagacttg
     4801 atccatactg gggagatgtc aagcaggatc tggtgtcata ctgtggtcca tggaagctag
     4861 atgccgcctg ggacgggcac agcgaggtgc agctcttggc cgtgcccccc ggagagagag
     4921 cgaggaacat ccagactctg cccggaatat ttaagacaaa ggatggggac attggagcgg
     4981 ttgcgctgga ttacccagca ggaacttcag gatctccaat cctagacaag tgtgggagag
     5041 tgataggact ttatggcaat ggggtcgtga tcaaaaatgg gagttatgtt agtgccatca
     5101 cccaagggag gagggaggaa gagactcctg ttgagtgctt cgagccttcg atgctgaaga
     5161 agaagcagct aactgtctta gacttgcatc ctggagctgg gaaaaccagg agagttcttc
     5221 ctgaaatagt ccgtgaagcc ataaaaacaa gactccgtac tgtgatctta gctccaacca
     5281 gggttgtcgc tgccgaaatg gaggaagccc ttagagggct tccagtgcgt tatatgacaa
     5341 cagcagtcaa tgtcacccac tctggaacag aaatcgtcga cttaatgtgc catgccacct
     5401 tcacttcacg tctactacag ccaatcagag tccccaacta taatctgtat attatggatg
     5461 aggcccactt cacagatccc tcaagtatag cagcaagagg atacatttca acaagggttg
     5521 agatgggcga ggcggctgcc atcttcatga ccgccacgcc accaggaacc cgtgacgcat
     5581 ttccggactc caactcacca attatggaca ccgaagtgga agtcccagag agagcctgga
     5641 gctcaggctt tgattgggtg acggatcatt ctggaaaaac agtctggttt gttccaagcg
     5701 tgaggaacgg caatgagatc gcagcttgtc tgacaaaggc tggaaaacgg gtcatacagc
     5761 tcagcagaaa gacttttgag acagagttcc agaaaacaaa acatcaagag tgggactttg
     5821 tcgtgacaac tgacatttca gagatgggcg ccaactttaa agctgaccgt gtcatagatt
     5881 ccaggagatg cctaaagccg gtcatacttg atggcgagag agtcattctg gctggaccca
     5941 tgcctgtcac acatgccagc gctgcccaga ggagggggcg cataggcagg aatcccaaca
     6001 aacctggaga tgagtatctg tatggaggtg ggtgcgcaga gactgacgaa gaccatgcac
     6061 actggcttga agcaagaatg ctccttgaca atatttacct ccaagatggc ctcatagcct
     6121 cgctctatcg acctgaggcc gacaaagtag cagccattga gggagagttc aagcttagga
     6181 cggagcaaag gaagaccttt gtggaactca tgaaaagagg agatcttcct gtttggctgg
     6241 cctatcaggt tgcatctgcc ggaataacct acacagatag aagatggtgc tttgatggca
     6301 cgaccaacaa caccataatg gaagacagtg tgccggcaga ggtgtggacc agacacggag
     6361 agaaaagagt gctcaaaccg aggtggatgg acgccagagt ttgttcagat cacgcggccc
     6421 tgaagtcatt caaggagttt gccgctggga aaagaggagc ggcttttgga gtgatggaag
     6481 ccttgggaac actgccagga cacatgacag agagattcca ggaagccatt gacaacctcg
     6541 ctgtgctcat gcgggcagag actggaagca ggccttacaa agccgcggcg gcccaattgc
     6601 cggagaccct agagaccatt atgcttttgg ggttgctggg aacagtctcg ctgggaatct
     6661 ttttcgtctt gatgaggaac aagggcatag ggaagatggg ctttggaatg gtgactcttg
     6721 gggccagcgc atggctcatg tggctctcgg aaattgagcc agccagaatt gcatgtgtcc
     6781 tcattgttgt gttcctattg ctggtggtgc tcatacctga gccagaaaag caaagatctc
     6841 cccaggacaa ccaaatggca atcatcatca tggtagcagt aggtcttctg ggcttgatta
     6901 ccgccaatga actcggatgg ttggagagaa caaagagtga cctaagccat ctaatgggaa
     6961 ggagagagga gggggcaacc ataggattct caatggacat tgacctgcgg ccagcctcag
     7021 cttgggccat ctacgctgcc ttgacaactt tcattacccc agccgtccaa catgcagtga
     7081 ccacttcata caacaactac tccttaatgg cgatggccac gcaagctgga gtgttgtttg
     7141 gtatgggcaa agggatgcca ttctacgcat gggactttgg agtcccgctg ctaatgatag
     7201 gttgctactc acaattaaca cccctgaccc taatagtagc catcattttg ctcgtggcgc
     7261 actacatgta cttgatccca gggctgcagg cagcagctgc gcgtgctgcc cagaagagaa
     7321 cggcagctgg catcatgaag aaccctgttg tggatggaat agtggtgact gacattgaca
     7381 caatgacaat tgacccccaa gtggagaaaa agatgggaca ggtgctactc atagcagtag
     7441 ccgtctccag cgccatactg tcgcggaccg cctgggggtg gggggaggct ggggccctga
     7501 tcacagctgc aacttccact ttgtgggaag gctctccgaa caagtactgg aactcctcta
     7561 cagccacttc actgtgtaac atttttaggg gaagttactt ggctggagct tctctaatct
     7621 acacagtaac aagaaacgct ggcttggtca agagacgtgg gggtggaaca ggagagaccc
     7681 tgggagagaa atggaaggcc cgcttgaacc agatgtcggc cctggagttc tactcctaca
     7741 aaaagtcagg catcaccgag gtgtgcagag aagaggcccg ccgcgccctc aaggacggtg
     7801 tggcaacggg aggccatgct gtgtcccgag gaagtgcaaa gctgagatgg ttggtggagc
     7861 ggggatacct gcagccctat ggaaaggtca ttgatcttgg atgtggcaga gggggctgga
     7921 gttactacgc cgccaccatc cgcaaagttc aagaagtgaa aggatacaca aaaggaggcc
     7981 ctggtcatga agaacccatg ttggtgcaaa gctatgggtg gaacatagtc cgtcttaaga
     8041 gtggggtgga cgtctttcat atggcggctg agccgtgtga cacgttgctg tgtgacatag
     8101 gtgagtcatc atctagtcct gaagtggaag aagcacggac gctcagagtc ctttccatgg
     8161 tgggggattg gcttgaaaaa agaccaggag ccttttgtat aaaagtgttg tgcccataca
     8221 ccagcactat gatggaaacc ctggagcgac tgcagcgtag gtatggggga ggactggtca
     8281 gagtgccact ctcccgcaac tctacacatg agatgtactg ggtctctgga gcgaaaagca
     8341 acaccataaa aagtgtgtcc accacgagcc agctcctctt ggggcgcatg gacgggccca
     8401 ggaggccagt gaaatatgag gaggatgtga atctcggctc tggcacgcgg gctgtggtaa
     8461 gctgcgctga agctcccaac atgaagatca ttggtaaccg cattgaaagg atccgcagtg
     8521 agcacgcgga aacgtggttc tttgacgaga accacccata taggacatgg gcttaccatg
     8581 gaagctatga ggcccccaca caagggtcag cgtcctctct aataaacggg gttgtcaggc
     8641 tcctgtcaaa accctgggac gtggtgactg gagtcacagg aatagccatg accgacacca
     8701 caccgtatgg tcagcaaaga gttttcaagg aaaaagtgga cactagggtg ccagatcccc
     8761 aagaaggcac tcgtcaggtt atgagcatgg tctcttcctg gttgtggaaa gagctaggca
     8821 aacacaaacg gccacgagtc tgtaccaaag aagagttcat caacaaggtt cgtagcaatg
     8881 cagcattagg ggcaatattt gaagaggaaa aagagtggaa gactgcagtg gaagctgtga
     8941 acgatccaag gttctgggct ctagtggaca aggaaagaga gcaccacctg agaggagagt
     9001 gccagagttg tgtgtacaac atgatgggaa aaagagaaaa gaaacaaggg gaatttggaa
     9061 aggccaaggg cagccgcgcc atctggtata tgtggctagg ggctagattt ctagagttcg
     9121 aagcccttgg attcttgaac gaggatcact ggatggggag agagaactca ggaggtggtg
     9181 ttgaagggct gggattacaa agactcggat atgtcctaga agagatgagt cgcataccag
     9241 gaggaaggat gtatgcagat gacactgctg gctgggacac ccgcatcagc aggtttgatc
     9301 tggagaatga agctctaatc accaaccaaa tggagaaagg gcacagggcc ttggcattgg
     9361 ccataatcaa gtacacatac caaaacaaag tggtaaaggt ccttagacca gctgaaaaag
     9421 ggaagacagt tatggacatt atttcgagac aagaccaaag ggggagcgga caagttgtca
     9481 cttacgctct taacacattt accaacctag tggtgcaact cattcggagt atggaggctg
     9541 aggaagttct agagatgcaa gacttgtggc tgctgcggag gtcagagaaa gtgaccaact
     9601 ggctgcagag caacggatgg gataggctca aacgaatggc agtcagtgga gatgattgcg
     9661 ttgtgaggcc aattgatgat aggtttgcac atgccctcag gttcttgaat gatatgggga
     9721 aagttaggaa ggacacacaa gagtggaaac cctcaactgg atgggacaac tgggaggaag
     9781 ttccgttttg ctcccaccac ttcaacaagc tccatctcaa ggacgggagg tccattgtgg
     9841 ttccctgccg ccaccaagat gaactgattg gccgggcccg cgtctctcca ggggcgggat
     9901 ggagcatccg ggagactgct tgcctagcaa aatcatatgc gcaaatgtgg cagctccttt
     9961 atttccacag aagggacctc cgactgatgg ccaatgccat ttgttcatct gtgccagttg
    10021 actgggttcc aactgggaga actacctggt caatccatgg aaagggagaa tggatgacca
    10081 ctgaagacat gcttgtggtg tggaacagag tgtggattga ggagaacgac cacatggaag
    10141 acaagacccc agttacgaaa tggacagaca ttccctattt gggaaaaagg gaagacttgt
    10201 ggtgtggatc tctcataggg cacagaccgc gcaccacctg ggctgagaac attaaaaaca
    10261 cagtcaacat ggtgcgcagg atcataggtg atgaagaaaa gtacatggac tacctatcca
    10321 cccaagttcg ctacttgggt gaagaagggt ctacacctgg agtgctgtaa gcaccaatct
    10381 tagtgttgtc aggcctgcta gtcagccaca gcttggggaa agctgtgcag cctgtgaccc
    10441 ccccaggaga agctgggaaa ccaagcctat agtcaggccg agaacgccat ggcacggaag
    10501 aagccatgct gcctgtgagc ccctcagagg acactgagtc aaaaaacccc acgcgcttgg
    10561 aggcgcagga tgggaaaaga aggtggcgac cttccccacc ctttaatctg gggcctgaac
    10621 tggagatcag ctgtggatct ccagaagagg gactagtggt tagaggagac cccccggaaa
    10681 acgcaaaaca gcatattgac gctgggaaag accagagact ccatgagttt ccaccacgct
    10741 ggccgccagg cacagatcgc cgaatagcgg cggccggtgt gggga

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:
Select:AllNone Selected:0
Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
18521 18521 100% 0.0 100% KX266255.1
18521 18521 100% 0.0 99% KX253996.1
18521 18521 100% 0.0 99% KU955589.1
18516 18516 100% 0.0 99% KX185891.1
18516 18516 100% 0.0 99% KU963796.1
18512 18512 100% 0.0 99% KU820899.2
18507 18507 100% 0.0 99% KU866423.2
18507 18507 100% 0.0 99% KX117076.1
18386 18386 100% 0.0 99% KX369547.1
18386 18386 100% 0.0 99% KJ776791.1
18341 18341 100% 0.0 99% KU509998.3
18323 18323 100% 0.0 99% KX280026.1
18323 18323 100% 0.0 99% KX051563.1
18318 18318 100% 0.0 99% KU991811.1
18318 18318 100% 0.0 99% KU321639.1
18309 18309 100% 0.0 99% KU729218.1
18309 18309 100% 0.0 99% KU707826.1
18309 18309 100% 0.0 99% KU365779.1
18305 18305 100% 0.0 99% KX262887.1
18305 18305 100% 0.0 99% KX197192.1
18296 18296 100% 0.0 99% KX198135.1
18296 18296 100% 0.0 99% KU926309.1
18296 18296 100% 0.0 99% KU501217.1
18296 18296 100% 0.0 99% KU365780.1
18291 18291 100% 0.0 99% KU940228.1
18291 18291 100% 0.0 99% KU647676.1
18291 18291 100% 0.0 99% KU501216.1
18291 18291 100% 0.0 99% KU365777.1
18287 18287 100% 0.0 99% KU758877.1
18287 18287 100% 0.0 99% KX247646.1
18287 18287 100% 0.0 99% KX156776.1
18283 18283 99% 0.0 99% KU497555.1
18282 18282 100% 0.0 99% KX156774.1
18282 18282 100% 0.0 99% KU729217.2
18282 18282 100% 0.0 99% KU527068.1
18278 18278 100% 0.0 99% KU820897.3
18278 18278 100% 0.0 99% KX247632.1
18278 18278 100% 0.0 99% KX156775.1
18278 18278 100% 0.0 99% KX087102.1
18278 18278 100% 0.0 99% KU365778.1
18278 18278 100% 0.0 99% KU312312.1
18273 18273 100% 0.0 99% KX520666.1
18273 18273 100% 0.0 99% KU922960.1
18269 18269 100% 0.0 99% KX548902.1
18269 18269 100% 0.0 99% KX446951.1
18269 18269 100% 0.0 99% KU937936.1
18269 18269 100% 0.0 99% KU926310.1
18269 18269 100% 0.0 99% KU922923.1
18269 18269 100% 0.0 99% KU501215.1
18264 18264 100% 0.0 99% KX601168.1
18264 18264 100% 0.0 99% KX446950.1
18264 18264 100% 0.0 99% KX087101.2
18264 18264 100% 0.0 99% KU870645.1
18260 18260 100% 0.0 99% KX377337.1
18260 18260 100% 0.0 99% KU853013.1
18258 18258 100% 0.0 99% KU853012.1
18251 18251 100% 0.0 99% KU820898.1
18251 18251 100% 0.0 99% KU740184.2
18251 18251 100% 0.0 99% KU761564.1
18245 18245 100% 0.0 99% KX056898.1
18245 18245 100% 0.0 99% KU955590.1
18197 18197 99% 0.0 99% KU940224.1
18101 18101 100% 0.0 99% KU744693.1
18047 18047 100% 0.0 99% KU681081.3
17750 17750 100% 0.0 98% KU955593.1
17750 17750 99% 0.0 98% JN860885.1
17685 17685 98% 0.0 99% KF993678.1
17603 17603 100% 0.0 98% EU545988.1
17439 17439 100% 0.0 98% KU681082.3
16438 16438 100% 0.0 95% KX601167.1
16429 16429 99% 0.0 95% HQ234499.1
16424 16424 100% 0.0 95% KX377336.1
13283 13283 100% 0.0 89% KU720415.1
13277 13277 99% 0.0 89% HQ234498.1
13268 13268 100% 0.0 89% KX377335.1
13266 13266 100% 0.0 89% KF383115.1
13265 13265 100% 0.0 89% KF383119.1
13263 13263 100% 0.0 89% KF268949.1
13263 13263 100% 0.0 89% DQ859059.1
13259 13259 100% 0.0 89% KU955595.1
13259 13259 100% 0.0 89% LC002520.1
13250 13250 100% 0.0 89% KU955592.1
13245 13245 100% 0.0 89% KF268948.1
13243 13243 100% 0.0 89% KX601169.1
13243 13243 100% 0.0 89% KU963573.1
13243 13243 100% 0.0 89% KU955594.1
13238 13720 100% 0.0 89% KX198134.1
13238 13238 100% 0.0 89% KF268950.1
13232 13232 100% 0.0 89% KU955591.1
13210 13210 99% 0.0 89% HQ234501.1
13209 13209 100% 0.0 89% KF383116.1
13201 13201 100% 0.0 89% AY632535.2
13176 13176 100% 0.0 88% KX601166.1
13138 13138 100% 0.0 88% KF383117.1
13118 13221 100% 0.0 88% KU963574.1
13117 13117 99% 0.0 88% HQ234500.1
12947 13015 100% 0.0 88% KF383118.1
12861 12861 97% 0.0 89% KF383121.1
10900 18324 100% 0.0 99% KX576684.1
Edited by niman

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.