Sign in to follow this  
Followers 0
niman

Full 2016 Zika Sequence United Kingdom ex-Guadeloupe

3 posts in this topic

Public Health England has released a full 2016 Zika sequence from United Kingdom ex-Guadeloupe traveler.

Share this post


Link to post
Share on other sites
LOCUS       KX673530               10689 bp    RNA     linear   VRL 14-AUG-2016
DEFINITION  Zika virus isolate PHE_semen_Guadeloupe, complete genome.
ACCESSION   KX673530
VERSION     KX673530.1  GI:1050405299
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10689)
  AUTHORS   Atkinson,B., Pullan,S.T., Miles,R.W., Lewandowski,K., Graham,V.A.,
            Dowall,S.D. and Hewson,R.
  TITLE     Complete genomic sequence of Zika virus isolated from a clinical
            semen sample
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10689)
  AUTHORS   Atkinson,B., Pullan,S.T., Miles,R.W., Lewandowski,K., Graham,V.A.,
            Dowall,S.D. and Hewson,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2016) Research, Public Health England, Manor Farm
            Road, Salisbury, Wiltshire SP4 0JG, UK
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: BWA v. 0.7.5
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10689
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="PHE_semen_Guadeloupe"
                     /isolation_source="semen"
                     /db_xref="taxon:64320"
                     /country="United Kingdom"
                     /collection_date="21-Apr-2016"
                     /note="passage details: 1 passage c6/36 followed by 1
                     passage vero; virus contracted while visiting Guadeloupe"
     CDS             92..10363
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ANZ46736.1"
                     /db_xref="GI:1050405300"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSVVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLVNGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTIEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGEEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 gaatcagact gcgacagttc gagtttgaag cgaaagctag caacagtatc aacaggtttt
       61 attttggatt tggaaacgag agtttctggt catgaaaaac ccaaaaaaga aatccggagg
      121 attccggatt gtcaatatgc taaaacgcgg agtagcccgt gtgagcccct ttgggggctt
      181 gaagaggctg ccagccggac ttctgctggg tcatgggccc atcaggatgg tcttggcgat
      241 tctagccttt ttgagattca cggcaatcaa gccatcactg ggtctcatca atagatgggg
      301 ttcagtgggg aaaaaagagg ctatggaaat aataaagaag ttcaagaaag atctggctgc
      361 catgctgaga ataatcaatg ctaggaagga gaagaagaga cgaggcgcag atactagtgt
      421 cggaattgtt ggcctcctgc tgaccacagc tatggcagcg gaggtcacta gacgtgggag
      481 tgcatactac atgtacttgg acagaaacga tgctggggag gccatatctt ttccaaccac
      541 attggggatg aataagtgtt atatacagat catggatctt ggacacatgt gtgatgccac
      601 catgagctat gaatgcccta tgctggatga gggggtggaa ccagatgacg tcgattgttg
      661 gtgcaacacg acgtcaactt gggttgtgta cggaacctgc catcacaaaa aaggtgaagc
      721 acggagatct agaagagctg tgacgctccc ctcccattcc actaggaagc tgcaaacgcg
      781 gtcgcaaacc tggttggaat caagagaata cacaaagcac ttgattagag tcgaaaattg
      841 gatattcagg aaccctggct tcgcgttagc agcagctgcc atcgcttggc ttttgggaag
      901 ctcaacgagc caaaaagtca tatacttggt catgatactg ctgattgccc cggcatacag
      961 catcaggtgc ataggagtca gcaataggga ctttgtggaa ggtatgtcag gtgggacttg
     1021 ggttgatgtt gtcttggaac atggaggttg tgtcaccgta atggcacagg acaaaccgac
     1081 tgtcgacata gagctggtta caacaacagt cagcaacatg gcggaggtga gatcctactg
     1141 ctatgaggca tcaatatcag acatggcttc ggacagccgc tgcccaacac aaggtgaagc
     1201 ctaccttgac aagcaatcag acactcaata tgtctgcaaa agaacgttag tggacagagg
     1261 ctggggaaat ggatgtggac tttttggcaa agggagcctg gtgacatgcg ctaagtttgc
     1321 atgctccaag aaaatgaccg ggaagagcat ccagccagag aatctggagt accggataat
     1381 gctgtcagtt catggctccc agcacagtgg gatgatcgtt aatgacacag gacatgaaac
     1441 tgatgagaat agagcgaagg ttgagataac gcccaattca ccaagagccg aagccaccct
     1501 ggggggtttt ggaagcctag gacttgattg tgaaccgagg acaggccttg acttttcaga
     1561 tttgtattac ttgactatga ataacaagca ctggttggtt cacaaggagt ggttccacga
     1621 cattccatta ccttggcacg ctggggcaga caccggaact ccacactgga acaacaaaga
     1681 agcactggta gagttcaagg acgcacatgc caaaaggcaa actgtcgtgg ttctagggag
     1741 tcaagaagga gcagttcaca cggcccttgc tggagctctg gaggctgaga tggatggtgc
     1801 aaagggaagg ctgtcctctg gccacttgaa atgtcgcctg aaaatggata aacttagatt
     1861 gaagggcgtg tcatactcct tgtgtaccgc agcgttcaca ttcaccaaga tcccggctga
     1921 aacactgcac gggacagtca cagtggaggt acagtacgca gggacagatg gaccttgcaa
     1981 ggttccagct cagatggcgg tggacatgca aactctgacc ccagttggga ggttgataac
     2041 cgccaacccc gtaatcactg aaagcactga gaactctaag atgatgctgg aacttgatcc
     2101 accatttggg gactcttaca ttgtcatagg agtcggggag aagaagatca cccaccactg
     2161 gcacaggagt ggcagcacca ttggaaaagc atttgaagcc actgtgagag gtgccaagag
     2221 aatggcagtc ttgggagaca cagcctggga cttcggatca gttggaggcg ctctcaactc
     2281 attgggcaag ggcatccatc aaatttttgg agcagctttc aaatcattgt ttggaggaat
     2341 gtcctggttc tcacaaatcc tcattggaac gttgctgatg tggttgggtc tgaacacaaa
     2401 gaatggatct atttccctca tgtgcttggc cttaggggga gtgttgatct tcttatccac
     2461 agccgtctct gctgatgtgg ggtgctcggt ggacttctca aagaaggaga cgagatgcgg
     2521 tacaggggtg ttcgtctata acgacgttga agcctggagg gacaggtaca agtaccatcc
     2581 tgactccccc cgtagattgg cagcagcagt caagcaagcc tgggaagatg gtatctgcgg
     2641 gatctcctct gtttcaagaa tggaaaacat catgtggaga tcagtagaag gggagctcaa
     2701 tgcaatcctg gaagagaatg gagttcaact gacggtcgtt gtgggatctg taaaaaaccc
     2761 catgtggaga ggtccacaga gattgcccgt gcctgtgaac gagctgcccc acggctggaa
     2821 ggcttggggg aaatcgtact tcgttagagc agcaaagaca aataacagct ttgtcgtgga
     2881 tggtgacaca ctgaaggaat gcccactcaa acatagagca tggaacagct ttcttgtgga
     2941 ggatcatggg ttcggggtat ttcacactag tgtctggctc aaggttagag aagattattc
     3001 attagagtgt gatccagccg ttattggaac agctgttaag ggaaaggagg ctgtacacag
     3061 tgatctaggc tactggattg agagtgagaa gaatgacaca tggaggctga agagggccca
     3121 tctgatcgag atgaaaacat gtgaatggcc aaagtcccac acattgtgga cagatggaat
     3181 agaagagagt gatctgatca tacccaagtc tttagctggg ccactcagcc atcacaatac
     3241 cagagagggc tacaggaccc aaatgaaagg gccatggcac agtgaagagc ttgaaattcg
     3301 gtttgaggaa tgcccaggca ctaaggtcca cgtggaggaa acatgtggaa caagaggacc
     3361 atctctgaga tcaaccactg caagcggaag ggtgatcgag gaatggtgct gcagggagtg
     3421 cacaatgccc ccactgtcgt tccgggctaa agatggctgt tggtatggaa tggagataag
     3481 gcccaggaaa gaaccagaaa gcaacttagt aaggtcagtg gtgactgcag gatcaactga
     3541 tcacatggat cacttctccc ttggagtgct tgtgattctg ctcatggtgc aggaagggct
     3601 gaagaagaga atgaccacaa agatcatcat aagcacatca atggcagtgc tggtagctat
     3661 gatcctggga ggattttcaa tgagtgacct ggctaagctt gcaattttga tgggtgccac
     3721 cttcgcggaa atgaacactg gaggagatgt agctcatctg gcgctgatag cggcattcaa
     3781 agtcagacca gcgttgctgg tatctttcat cttcagggct aattggacac cccgtgaaag
     3841 catgctgctg gccttggcct cgtgtctttt gcaaactgcg atctccgcct tggaaggcga
     3901 cctgatggtt ctcatcaatg gttttgcttt ggcctggttg gcaatacgag cgatggttgt
     3961 tccacgcact gataacatca ccttggcaat cctggctgct ctgacaccac tggcccgggg
     4021 cacactgctt gtggcgtgga gagctggcct tgctacttgc ggggggttta tgctcctctc
     4081 tctgaaggga aaaggcagtg tgaagaagaa cttaccattt gtcatggccc tgggactaac
     4141 cgctgtgaga ctggtcgacc ccatcaacgt ggtgggactg ctgttgctca caaggagtgg
     4201 gaagcggagc tggcccccta gcgaagtact cacagctgtt ggcctgatat gcgcattggc
     4261 tggagggttc gccaaggcag atatagagat ggctgggccc atggccgcgg tcggtctgct
     4321 aattgtcagt tacgtggtct caggaaagag tgtggacatg tacattgaaa gagcaggtga
     4381 catcacatgg gaaaaagatg cggaagtcac tggaaacagt ccccggctcg atgtggcgct
     4441 agatgagagt ggtgatttct ccctggtgga ggatgacggt ccccccatga gagagatcat
     4501 actcaaggtg gtcctgatga ccatctgtgg catgaaccca atagccatac cctttgcagc
     4561 tggagcgtgg tacgtatacg tgaagactgg aaaaaggagt ggtgctctat gggatgtgcc
     4621 tgctcccaag gaagtaaaaa agggggagac cacagatgga gtgtacagag taatgactcg
     4681 tagactgcta ggttcaacac aagttggagt gggagttatg caagaggggg tctttcacac
     4741 tatgtggcac gtcacaaaag gatccgcgct gagaagcggt gaagggagac ttgatccata
     4801 ctggggagat gtcaagcagg atctggtgtc atactgtggt ccatggaagc tagatgccgc
     4861 ctgggacggg cacagcgagg tgcagctctt ggccgtgccc cccggagaga gagcgaggaa
     4921 catccagact ctgcccggaa tatttaagac aaaggatggg gacattggag cggttgcgct
     4981 ggattaccca gcaggaactt caggatctcc aatcctagac aagtgtggga gagtgatagg
     5041 actttatggc aatggggtcg tgatcaaaaa tgggagttat gttagtgcca tcacccaagg
     5101 gaggagggag gaagagactc ctgttgagtg cttcgagcct tcgatgctga agaagaagca
     5161 gctaactgtc ttagacttgc accctggagc tgggaaaacc aggagagttc ttcctgaaat
     5221 agtccgtgaa gctataaaaa caagactccg tactgtgatc ttagctccaa ccagggttgt
     5281 cgctgctgaa atggaggaag cccttagagg gcttccagtg cgttatatga caacagcagt
     5341 caatgtcacc cattctggaa cagaaatcgt cgacttaatg tgccatgcca ccttcacttc
     5401 acgtctacta cagccaatca gagtccccaa ctataatctg tatattatgg atgaggccca
     5461 cttcacagat ccctcaagta tagcagcaag aggatacatt tcaacaaggg ttgagatggg
     5521 cgaggcggct gccatcttca tgaccgccac gccaccagga acccgtgacg catttccgga
     5581 ctccaactca ccaattatgg acaccgaagt ggaagtccca gagagagcct ggagctcagg
     5641 ctttgattgg gtgacggatc attctggaaa aacagtttgg tttgttccaa gcgtgaggaa
     5701 cggcaatgag atcgcagctt gtctgacaaa ggctggaaaa cgggtcatac agctcagcag
     5761 aaagactttt gagacagagt tccagaaaac aaaacatcaa gagtgggact ttgtcgtgac
     5821 aaccgacatt tcagagatgg gcgccaactt taaagctgac cgtgtcatag attccaggag
     5881 atgcctaaag ccggtcatac ttgatggcga gagagtcatt ctggctggac ccatgcctgt
     5941 cacacatgcc agcgctgccc agaggagggg gcgcataggc aggaatccca acaaacctgg
     6001 agatgagtat ctgtatggag gtgggtgcgc agagactgac gaagaccatg cacactggct
     6061 tgaagcaaga atgctccttg acaatattta cctccaagat ggcctcatag cctcgctcta
     6121 tcgacctgag gccgacaaag tagcagccat tgagggagag ttcaagctta ggacggagca
     6181 aaggaagacc tttgtggaac tcatgaaaag aggagatctt cctgtttggc tggcctatca
     6241 ggttgcatct gccggaataa cttacacaga tagaagatgg tgctttgatg gcacgaccaa
     6301 caacaccata atggaagaca gtgtgccggc agaggtgtgg accagacacg gagagaaaag
     6361 agtgctcaaa ccgaggtgga tggacgccag agtttgttca gatcatgcgg ccctgaagtc
     6421 attcaaggag tttgccgctg ggaaaagagg agcggctttt ggagtgatgg aagccctggg
     6481 aacactgcca ggacacatga cagagagatt ccaggaagcc attgacaacc tcgctgtgct
     6541 catgcgggca gagactggaa gcaggcctta caaagccgcg gcggcccaat tgccggagac
     6601 cctagagacc attatgcttt tggggttgct gggaacagtc tcgctgggaa tctttttcgt
     6661 cttgatgagg aacaagggca tagggaagat gggctttgga atggtgactc ttggggccag
     6721 cgcatggctc atgtggctct cggaaattga gccagccaga attgcatgtg tcctcattgt
     6781 tgtgttccta ttgctggtgg tgctcatacc tgagccagaa aagcaaagat ctccccagga
     6841 caaccaaatg gcaatcatca tcatggtagc agtaggtctt ctgggcttga tcaccgccaa
     6901 tgaactcgga tggttggaga gaacaaagag tgacctaagc catctaatgg gaaggagaga
     6961 ggagggggca accataggat tctcaatgga cattgacctg cggccagcct cagcttgggc
     7021 catctatgct gccttgacaa ctttcattac cccagccgtc caacatgcag tgaccacttc
     7081 atacaacaac tactccttaa tggcgatggc cacgcaagct ggagtgttgt ttggtatggg
     7141 caaagggatg ccattctacg catgggactt tggagtcccg ctgctaatga taggttgcta
     7201 ctcacaatta acacccctga ccctaatagt ggccatcatt ttgctcgtgg cgcactacat
     7261 gtacttgatc ccagggctgc aggcagcagc tgcgcgtgct gcccagaaga gaacggcagc
     7321 tggcatcatg aagaaccctg tcgtggatgg aatagtggtg actgacattg acacaatgac
     7381 aattgacccc caagtggaga aaaagatggg acaggtgcta ctcatagcag tagccgtctc
     7441 cagcgccata ctgtcgcgga ccgcctgggg gtggggggag gctggggccc tgatcacagc
     7501 cgcaacttcc actttgtggg aaggctctcc gaacaagtac tggaactcct ctacagccac
     7561 ttcactgtgt aacattttta ggggaagtta cttggctgga gcttctctaa tctacacagt
     7621 aacaagaaac gctggcttgg tcaagagacg tgggggtgga acaggagaga ccctgggaga
     7681 gaaatggaag gcccgcttga accagatgtc ggccctggag ttctactcct acaaaaagtc
     7741 aggcatcacc gaggtgtgca gagaagaggc ccgccgcgcc ctcaaggacg gtgtggcaac
     7801 gggaggccat gctgtgtccc gaggaagtgc aaagctgaga tggttggtgg agcggggata
     7861 cctgcagccc tatggaaagg tcattgatct tggatgtggc agagggggct ggagttacta
     7921 cgccgccacc atccgcaaag ttcaagaagt gaaaggatac acaaaaggag gccctggtca
     7981 tgaagaaccc gtgttggtgc agagctatgg gtggaacata gtccgtctca agagtggggt
     8041 ggacgtcttt catatggcgg ctgagccgtg tgacacgttg ctgtgtgaca taggtgagtc
     8101 atcatctagt cctgaagtgg aagaagcacg gacgctcaga gtcctctcca tggtggggga
     8161 ttggcttgaa aaaagaccag gagccttttg tataaaagtg ttgtgcccat acaccagcac
     8221 tatgatggaa accctggagc ggctgcagcg taggtatggg ggaggactgg tcagagtgcc
     8281 actctcccgc aactctacac atgagatgta ctgggtctct ggagcgaaaa gcaacaccat
     8341 aaaaagtgtg tccaccacga gccagctcct cttggggcgc atggacgggc ctaggaggcc
     8401 agtgaaatat gaggaggatg tgaatctcgg ctctggcacg cgggctgtgg taagctgcgc
     8461 tgaagctccc aacatgaaga tcattggtaa ccgcattgaa aggatccgca gtgagcacgc
     8521 ggaaacgtgg ttctttgacg agaaccaccc atataggaca tgggcttacc atggaagcta
     8581 tgaggccccc acacaagggt cagcatcctc tctagtaaac ggggttgtca ggctcctgtc
     8641 aaaaccctgg gatgtggtga ctggagtcac aggaatagcc atgaccgaca ccacaccgta
     8701 tggtcagcaa agagttttca aggaaaaagt ggacactagg gtgccagacc cccaagaagg
     8761 cactcgtcag gttatgagca tggtctcttc ctggttgtgg aaagagctag gcaaacacaa
     8821 acggccacga gtctgtacca aagaagagtt catcaacaag gttcgtagca atgcagcatt
     8881 aggggcaata tttgaagagg aaaaagagtg gaagactgca gtggaagctg tgaacgatcc
     8941 aaggttctgg gctctagtgg acaaggaaag agagcaccac ctgagaggag agtgccagag
     9001 ttgtgtgtac aacatgatgg gaaaaagaga aaagaaacaa ggggaatttg gaaaggccaa
     9061 gggcagccgc gccatctggt atatgtggct aggggctaga tttttagagt tcgaagccct
     9121 tggattcttg aacgaggatc actggatggg gagagagaac tcaggaggtg gtgttgaagg
     9181 gctgggatta caaagactcg gatatgtcct agaagagatg agtcgcatac caggaggaag
     9241 gatgtatgca gatgacactg ctggctggga tacccgcatc agcaggtttg atctagagaa
     9301 tgaagctcta atcaccaacc aaatggagaa agggcacagg gccttggcat tggccataat
     9361 caagtacaca taccaaaaca aagtggtaaa ggtccttaga ccagctgaaa aagggaaaac
     9421 agttatggac attatttcga gacaagacca aagggggagc ggacaagttg tcacttacgc
     9481 tcttaacaca tttaccaacc tagtggtgca actcattcgg aatatggagg ctgaggaagt
     9541 tctagagatg caagacttgt ggctgctgcg gaggtcagag aaagtgacca actggttgca
     9601 gagcaacgga tgggataggc tcaaacgaat ggcagtcagt ggagatgatt gcgttgtgaa
     9661 gccaattgat gataggtttg cacatgccct caggttcttg aatgatatgg gaaaagttag
     9721 gaaggacaca caagagtgga aaccctcaac tggatgggac aactgggaag aagttccgtt
     9781 ttgctcccac cacttcaaca agctccatct caaggacggg aggtccattg tggttccctg
     9841 ccgccaccaa gatgaactga ttggccgggc ccgcgtctct ccaggggcgg gatggagcat
     9901 ccgggagact gcttgcctag caaaatcata tgcgcaaatg tggcagctcc tttatttcca
     9961 cagaagggac ctccgactga tggccaatgc catttgctca tctgtgccag ttgactgggt
    10021 tccaactggg agaactacct ggtcaatcca tggaaaggga gaatggatga ccattgaaga
    10081 catgcttgtg gtgtggaaca gagtgtggat tgaggagaac gaccacatgg aagacaagac
    10141 cccagttacg aaatggacag acattcccta tttgggaaaa agggaagact tgtggtgtgg
    10201 atctctcata gggcacagac cgcgcaccac ctgggctgag aacattaaaa acacagtcaa
    10261 catggtgcgc aggatcatag gtgaggaaga aaagtacatg gactacctat ccacccaagt
    10321 tcgctacttg ggtgaagaag ggtctacacc tggagtgctg taagcaccaa tcttaatgtt
    10381 gtcaggcctg ctagtcagcc acagcttggg gaaagctgtg cagcctgtga cccccccagg
    10441 agaagctggg aaaccaagcc tatagtcagg ccgagaacgc catggcacgg aagaagccat
    10501 gctgcctgtg agcccctcag aggacactga gtcaaaaaac cccacgcgct tggaggcgca
    10561 ggatgggaaa agaaggtggc gaccttcccc acccttcaat ctggggcctg aactggagat
    10621 cagctgtgga tctccagaag agggactagt ggttagagga gaccccccgg aaaacgcaaa
    10681 acagcatat

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
18525 18525 100% 0.0 100% KX673530.1
18438 18438 100% 0.0 99% KU853013.1
18438 18438 100% 0.0 99% KU853012.1
18357 18357 100% 0.0 99% KX447510.1
18348 18348 100% 0.0 99% KX447512.1
18348 18348 100% 0.0 99% KX369547.1
18348 18348 100% 0.0 99% KU509998.3
18345 18345 100% 0.0 99% KX447509.1
18345 18345 100% 0.0 99% KX280026.1
18345 18345 100% 0.0 99% KU991811.1
18345 18345 100% 0.0 99% KJ776791.1
18339 18339 100% 0.0 99% KX447513.1
18336 18336 100% 0.0 99% KX447515.1
18336 18336 100% 0.0 99% KX447511.1
18336 18336 100% 0.0 99% KU729217.2
18336 18336 100% 0.0 99% KU321639.1
18330 18330 100% 0.0 99% KX447514.1
18330 18330 100% 0.0 99% KX051563.1
18327 18327 100% 0.0 99% KX447516.1
18327 18327 100% 0.0 99% KU940228.1
18327 18327 100% 0.0 99% KU729218.1
18327 18327 100% 0.0 99% KU707826.1
18327 18327 100% 0.0 99% KU365779.1
18321 18321 100% 0.0 99% KX262887.1
18321 18321 100% 0.0 99% KX197192.1
18321 18321 100% 0.0 99% KU926309.1
18318 18318 100% 0.0 99% KU527068.1
18312 18312 100% 0.0 99% KX198135.1
18312 18312 100% 0.0 99% KU926310.1
18312 18312 100% 0.0 99% KU365780.1
18309 18309 100% 0.0 99% KX520666.1
18309 18309 100% 0.0 99% KU647676.1
18309 18309 100% 0.0 99% KU365777.1
18303 18303 100% 0.0 99% KX447517.1
18303 18303 100% 0.0 99% KU758877.1
18303 18303 100% 0.0 99% KX247646.1
18303 18303 100% 0.0 99% KX156776.1
18303 18303 100% 0.0 99% KU501217.1
18300 18300 100% 0.0 99% KX156774.1
18300 18300 99% 0.0 99% KU497555.1
18300 18300 100% 0.0 99% KU501216.1
18294 18294 100% 0.0 99% KU820897.3
18294 18294 100% 0.0 99% KX247632.1
18294 18294 100% 0.0 99% KX156775.1
18294 18294 100% 0.0 99% KX087102.1
18294 18294 100% 0.0 99% KU365778.1
18294 18294 100% 0.0 99% KU312312.1
18291 18291 100% 0.0 99% KU922960.1
18285 18285 100% 0.0 99% KX548902.1
18285 18285 100% 0.0 99% KX446951.1
18285 18285 100% 0.0 99% KU937936.1
18285 18285 100% 0.0 99% KU922923.1
18285 18285 100% 0.0 99% KU501215.1
18282 18282 100% 0.0 99% KX601168.1
18282 18282 100% 0.0 99% KX446950.1
18282 18282 100% 0.0 99% KX087101.2
18282 18282 100% 0.0 99% KU870645.1
18276 18276 100% 0.0 99% KX377337.1
18267 18267 100% 0.0 99% KU820898.1
18264 18264 100% 0.0 99% KX056898.1
18264 18264 100% 0.0 99% KU955590.1
18258 18258 100% 0.0 99% KU740184.2
18258 18258 100% 0.0 99% KU761564.1
18254 18254 100% 0.0 99% KX117076.1
18245 18245 100% 0.0 99% KX185891.1
18245 18245 100% 0.0 99% KU963796.1
18240 18240 100% 0.0 99% KX253996.1
18240 18240 100% 0.0 99% KU955589.1
18240 18240 100% 0.0 99% KU820899.2
18236 18236 100% 0.0 99% KX266255.1
18236 18236 100% 0.0 99% KU866423.2
18231 18231 99% 0.0 99% KU940224.1
18101 18101 100% 0.0 99% KU744693.1
18011 18011 100% 0.0 99% KU681081.3
17704 17704 100% 0.0 98% KU955593.1
17703 17703 99% 0.0 98% JN860885.1
17667 17667 98% 0.0 99% KF993678.1
17549 17549 100% 0.0 98% EU545988.1
17401 17401 100% 0.0 98% KU681082.3
16374 16374 100% 0.0 95% KX601167.1
16366 16366 99% 0.0 95% HQ234499.1
16361 16361 100% 0.0 95% KX377336.1
16208 16208 88% 0.0 99% KX447518.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.