Sign in to follow this  
Followers 0
niman

Full 2016 Venezuela Zika Sequence From Lactating Mother's Milk

6 posts in this topic

University of Florida released full 2016 Venezuela sequence from milk from lactating mother.

Share this post


Link to post
Share on other sites
LOCUS       KX702400               10808 bp    cRNA    linear   VRL 24-AUG-2016
DEFINITION  Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete
            genome.
ACCESSION   KX702400
VERSION     KX702400.1  GI:1057445801
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10808)
  AUTHORS   Blohm,G.M., Paniz Mondolfi,A.E., Puliam,J.R.C., Morris,J.G. Jr.,
            Bonny,T.S., Loeb,J.C., Pacheco,C., Marquez,M. and Lednicky,J.A.
  TITLE     Viable Zika virus in the breast milk of a lactating woman with
            acute signs and symptoms of Zika Fever in Venezuela in 2016
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10808)
  AUTHORS   Blohm,G.M., Paniz Mondolfi,A.E., Puliam,J.R.C., Morris,J.G. Jr.,
            Bonny,T.S., Loeb,J.C., Pacheco,C., Marquez,M. and Lednicky,J.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-AUG-2016) Environmental and Global Health, University
            of Florida - Gainesville, 1225 Center Drive, Room 4155,
            Gainesville, FL 32610, USA
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10808
                     /organism="Zika virus"
                     /mol_type="viral cRNA"
                     /strain="Zika virus/Homo sapiens/VEN/UF-1/2016"
                     /isolation_source="whole breast milk, and separated fat
                     and liquid components"
                     /host="Homo sapiens; lactating female with acute symptoms"
                     /db_xref="taxon:64320"
                     /country="Venezuela: Barquisimeto"
                     /collection_date="25-Mar-2016"
                     /collected_by="Alberto E. Paniz Mondolfi"
                     /identified_by="Gabriela Blohm and John Lednicky"
                     /note="passage details: LLC-MK2 cells, passage 1"
     5'UTR           1..107
     CDS             108..10379
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AOE22997.1"
                     /db_xref="GI:1057445802"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKDAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGAETSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSPTASGRVIEEWCCRECTMPPLSFWAKDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
     3'UTR           10380..10808
ORIGIN      
        1 agttgttact gttgctgact cagactgcga cagttcgagt ttgaagcgaa agctagcaac
       61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa
      121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga
      181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca
      241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc
      301 tcatcaatag atggggttca gtggggaaaa aagatgctat ggaaataata aagaagttca
      361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag
      421 gcgcagaaac tagtgtcgga attgttggcc tccttctgac cacagctatg gcagcggagg
      481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca
      541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac
      601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag
      661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc
      721 acaaaaaagg tgaagcacgg agatctagaa gagccgtgac gctcccctcc cattccacta
      781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga
      841 ttagagtcga aaattggata ttcaggaacc ctggtttcgc tttagcagca gctgccatcg
      901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga
      961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta
     1021 tgtcaggtgg gacttgggtt gatgtcgtct tggaacatgg aggttgtgtc accgtaatgg
     1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg
     1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc
     1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtt tgcaaaagaa
     1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga
     1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc
     1381 tggagtaccg gataatgttg tcagttcatg gctcccagca cagtgggatg attgttaatg
     1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa
     1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag
     1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca
     1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac
     1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg
     1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg
     1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa
     1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca
     1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga
     1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag
     2041 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga
     2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga
     2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg
     2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg
     2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat
     2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt
     2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt
     2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga
     2521 aggagacgag atgtggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca
     2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg
     2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag
     2701 tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg
     2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc
     2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata
     2881 acagctttgt cgtggatggt gacacactga aagaatgccc actcaaacat agagcatgga
     2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg
     3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa
     3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga
     3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat
     3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac
     3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg
     3301 aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg gaggaaacat
     3361 gtggaacaag aggaccatct ctgagatcac ccactgcaag cggaagggtg atcgaggaat
     3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttctg ggctaaagat ggctgttggt
     3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcaatggtga
     3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca
     3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg
     3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa
     3721 tcttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc
     3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc cttcatcttc agagctaatt
     3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct
     3901 ccgccttgga gggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa
     3961 tacgagcgat ggttgttcca cgcactgaca acatcacctt ggcaatcctg gctgctctga
     4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg
     4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca
     4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt
     4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc
     4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg
     4321 ccgcggttgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca
     4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc
     4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc
     4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag
     4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg
     4621 cgctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt
     4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag
     4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag
     4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat
     4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg
     4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca
     4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt
     5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta
     5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga
     5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga
     5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag
     5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt
     5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc
     5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata
     5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa
     5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc
     5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga
     5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg
     5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg
     5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt
     5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg
     5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg
     5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga
     6001 atcccaataa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag
     6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc
     6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca
     6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg
     6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct
     6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca
     6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc
     6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag
     6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg
     6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg
     6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgt
     6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg
     6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg
     6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc
     6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg
     6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc
     6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggacatt gacctgcggc
     7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac
     7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag
     7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc
     7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc
     7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc
     7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg
     7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca
     7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg
     7501 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga
     7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt
     7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag
     7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct
     7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca
     7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt
     7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag
     7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa
     7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aatatagtcc
     8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt
     8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc
     8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt
     8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag
     8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag
     8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg
     8401 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg
     8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga
     8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg
     8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg
     8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga
     8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc
     8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag
     8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggtgc
     8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg
     8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga
     9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg
     9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc
     9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag
     9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc
     9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcattagca
     9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct
     9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag
     9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac
     9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata
     9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag
     9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag
     9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg
     9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact
     9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt
     9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag
     9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc
     9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg
    10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat
    10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc
    10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg
    10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca
    10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact
    10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag
    10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc
    10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg
    10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca
    10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg
    10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc
    10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc
    10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca
    10801 tgggtctt

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
18498 18498 100% 0.0 99% KX247646.1
18489 18489 100% 0.0 99% KU820897.4
18489 18489 100% 0.0 99% KX087102.1
18453 18453 100% 0.0 99% KX198135.1
18444 18444 100% 0.0 99% KX156776.1
18438 18438 100% 0.0 99% KX156774.1
18435 18435 100% 0.0 99% KX156775.1
18411 18411 100% 0.0 99% KU647676.1
18408 18408 100% 0.0 99% KX548902.1
18393 18393 100% 0.0 99% KU922960.1
18390 18390 100% 0.0 99% KU922923.1
18381 18381 100% 0.0 99% KX447510.1
18375 18375 100% 0.0 99% KU991811.1
18372 18372 100% 0.0 99% KX447512.1
18372 18372 100% 0.0 99% KX369547.1
18372 18372 100% 0.0 99% KU509998.3
18366 18366 100% 0.0 99% KX447509.1
18366 18366 100% 0.0 99% KJ776791.1
18363 18363 100% 0.0 99% KX447515.1
18363 18363 100% 0.0 99% KX447513.1
18357 18357 100% 0.0 99% KX447511.1
18357 18357 100% 0.0 99% KX280026.1
18357 18357 100% 0.0 99% KU707826.1
18357 18357 100% 0.0 99% KU365779.1
18357 18357 100% 0.0 99% KU321639.1
18354 18354 100% 0.0 99% KX447514.1
18354 18354 100% 0.0 99% KX051563.1
18348 18348 100% 0.0 99% KX447516.1
18348 18348 100% 0.0 99% KU729218.1
18345 18345 100% 0.0 99% KX262887.1
18345 18345 100% 0.0 99% KX197192.1
18345 18345 100% 0.0 99% KU365780.1
18341 18341 99% 0.0 99% KU497555.1
18339 18339 100% 0.0 99% KU365777.1
18336 18336 100% 0.0 99% KX694534.1
18336 18336 100% 0.0 99% KU758877.1
18336 18336 100% 0.0 99% KU926309.1
18330 18330 100% 0.0 99% KU940228.1
18327 18327 100% 0.0 99% KX447517.1
18327 18327 100% 0.0 99% KU501217.1
18327 18327 100% 0.0 99% KU365778.1
18327 18327 100% 0.0 99% KU312312.1
18321 18321 100% 0.0 99% KU729217.2
18321 18321 100% 0.0 99% KU527068.1
18321 18321 100% 0.0 99% KU501216.1
18318 18318 100% 0.0 99% KX247632.1
18318 18318 100% 0.0 99% KU937936.1
18318 18318 100% 0.0 99% KU926310.1
18318 18318 100% 0.0 99% KU501215.1
18312 18312 100% 0.0 99% KX601168.1
18312 18312 100% 0.0 99% KX520666.1
18312 18312 100% 0.0 99% KX087101.2
18309 18309 100% 0.0 99% KX446951.1
18309 18309 100% 0.0 99% KX377337.1
18309 18309 100% 0.0 99% KU820898.1
18303 18303 100% 0.0 99% KX446950.1
18303 18303 100% 0.0 99% KU870645.1
18300 18300 100% 0.0 99% KU853013.1
18298 18298 100% 0.0 99% KU853012.1
18294 18294 100% 0.0 99% KX056898.1
18294 18294 100% 0.0 99% KU955590.1
18291 18291 100% 0.0 99% KU740184.2
18291 18291 100% 0.0 99% KU761564.1
18276 18276 100% 0.0 99% KX673530.1
18276 18276 100% 0.0 99% KX117076.1
18267 18267 100% 0.0 99% KX185891.1
18267 18267 100% 0.0 99% KU963796.1
18264 18264 100% 0.0 99% KX253996.1
18264 18264 100% 0.0 99% KU955589.1
18264 18264 100% 0.0 99% KU820899.2
18260 18260 100% 0.0 99% KX266255.1
18258 18258 100% 0.0 99% KU866423.2
18236 18236 99% 0.0 99% KU940224.1
18141 18141 100% 0.0 99% KU744693.1
18033 18033 100% 0.0 99% KU681081.3
17924 17924 100% 0.0 99% KX694532.1
17726 17726 100% 0.0 98% KU955593.1
17726 17726 99% 0.0 98% JN860885.1
17694 17694 98% 0.0 99% KF993678.1
17571 17571 100% 0.0 98% EU545988.1
17420 17420 100% 0.0 98% KU681082.3
16424 16424 100% 0.0 95% KX601167.1
16415 16415 100% 0.0 95% KX694533.1
16415 16415 99% 0.0 95% HQ234499.1
16410 16410 100% 0.0 95% KX377336.1
16211 16211 88% 0.0 99% KX447518.1
13306 13306 100% 0.0 89% KF383115.1
13297 13297 100% 0.0 89% KF268949.1
13297 13297 100% 0.0 89% KF268948.1
13290 13290 100% 0.0 89% KU720415.1
13290 13290 100% 0.0 89% KF268950.1
13284 13284 99% 0.0 89% HQ234498.1
13281 13281 100% 0.0 89% KU955595.1
13277 13277 100% 0.0 89% KX377335.1
13275 13275 100% 0.0 89% DQ859059.1
13272 13272 100% 0.0 89% KU955592.1
13272 13272 100% 0.0 89% KF383119.1
13268 13268 100% 0.0 89% LC002520.1
13259 13738 100% 0.0 89% KX198134.1
13254 13254 100% 0.0 89% KU955591.1
13252 13252 100% 0.0 89% KX601169.1
13252 13252 100% 0.0 89% KU963573.1
13252 13252 100% 0.0 89% KU955594.1
13239 13239 100% 0.0 89% KF383116.1
13223 13223 99% 0.0 89% HQ234501.1
13209 13209 100% 0.0 89% AY632535.2
13198 13198 100% 0.0 88% KX601166.1
13155 13155 100% 0.0 88% KF383117.1
13140 13248 100% 0.0 88% KU963574.1
13138 13138 99% 0.0 88% HQ234500.1
12949 13017 100% 0.0 88% KF383118.1
12870 12870 97% 0.0 89% KF383121.1
11490 15810 86% 0.0 99% KX447520.1
10931 18358 100% 0.0 99% KX576684.1
10862 10862 97% 0.0 84% KF383120.1
10024 16083 87% 0.0 99% KX447519.1
9822 14966 81% 0.0 99% KX447521.1
5029 14417 87% 0.0 95% KU940227.1
4998 4998 27% 0.0 99% KX212103.1
4960 4960 27% 0.0 99% KU758875.1
4956 4956 27% 0.0 99% KU758871.1
4949 4949 27% 0.0 99% KU758870.1
4949 4949 27% 0.0 99% KU312314.1
4947 4947 27% 0.0 99% KU758873.1
4935 4935 27% 0.0 99% KU758872.1
4924 4924 27% 0.0 99% KU758876.1
4922 4922 27% 0.0 99% KU312313.1
4913 4913 26% 0.0 99% KU758869.1
4888 4888 26% 0.0 99% KU758868.1
4884 4884 26% 0.0 99% KU758874.1
4664 4664 25% 0.0 99% KU646828.1
4664 4664 25% 0.0 99% KU646827.1
4226 13295 75% 0.0 95% KX101060.1
3431 3431 18% 0.0 99% KU312315.1
3205 3205 17% 0.0 99% KU740199.1
3113 13092 74% 0.0 99% KX101066.1
2852 4159 95% 0.0 71% DQ859064.1
2686 2686 14% 0.0 99% KJ634273.1
2682 2682 14% 0.0 99% LC171327.1
2253 10777 65% 0.0 92% KX101064.1
2060 2060 11% 0.0 99% KU686218.1
2021 2021 11% 0.0 99% KU179098.1
1867 1867 10% 0.0 99% KU886298.1
1840 13871 78% 0.0 99% KX101061.1
1838 1838 9% 0.0 99% KX059014.1
1838 1838 9% 0.0 99% KX059013.1
1752 1752 9% 0.0 99% KM078936.1
1748 1748 9% 0.0 99% KM078961.1
1746 1746 9% 0.0 99% KM078930.1
1745 1745 9% 0.0 99% KM078971.1
1745 1745 9% 0.0 99% KM078970.1
1745 1745 9% 0.0 99% KM078933.1
1743 1743 9% 0.0 99% KM078929.1
1645 1645 9% 0.0 99% KX173841.1
1645 1645 9% 0.0 99% KX173840.1
1602 1602 8% 0.0 99% KJ873160.1
1514 1514 8% 0.0 99% KX173843.1
1503 1503 8% 0.0 99% KX173844.1
1420 1420 7% 0.0 99% KJ873161.1
1382 1382 7% 0.0 99% KM851039.1
1353 1353 7% 0.0 99% KU985087.1
1346 1346 7% 0.0 99% KU556802.1
1346 1346 7% 0.0 98% KM851038.1
1315 1315 10% 0.0 88% AF013415.1
1310 1310 7% 0.0 100% KU724096.1
1240 1240 6% 0.0 99% KU232300.1
1240 1240 6% 0.0 99% KT200609.1
1231 1231 6% 0.0 99% KU232290.1
1229 1229 6% 0.0 99% KU232297.1
1220 1220 6% 0.0 99% KU232294.1
1218 1218 6% 0.0 99% KU232292.1
1214 1214 6% 0.0 99% KU232298.1
1211 1211 6% 0.0 99% KU232296.1
1211 1211 6% 0.0 99% KU232293.1
1205 1205 6% 0.0 99% KU232295.1
1195 1195 6% 0.0 99% KU232288.1
1191 1191 6% 0.0 99% KU232289.1
1187 1187 6% 0.0 99% KU232299.1
1186 1186 6% 0.0 99% KU232291.1
1184 7780 46% 0.0 99% KX101065.1
1178 1178 6% 0.0 100% KU724097.1
1177 7438 42% 0.0 99% KX101063.1
1166 1166 6% 0.0 99% KU724098.1
1124 1124 6% 0.0 98% KU758878.1
1101 1101 5% 0.0 99% KU724099.1
1077 1077 8% 0.0 89% KF270886.1
1049 7316 41% 0.0 97% KX101062.1
1020 1020 8% 0.0 87% AF372422.1
1018 1018 5% 0.0 100% KU867812.1
1000 1000 7% 0.0 89% KF270887.1
980 980 7% 0.0 89% KF383022.1
975 975 7% 0.0 89% KF383026.1
971 971 7% 0.0 88% EU303241.1
966 966 7% 0.0 88% KF383032.1
962 962 7% 0.0 88% KF383034.1
962 962 7% 0.0 88% KF383029.1
960 960 7% 0.0 88% KF383037.1
957 957 7% 0.0 88% KF383036.1
957 957 7% 0.0 88% KF383033.1
944 944 5% 0.0 99% KU724100.1
939 939 7% 0.0 88% KF383039.1
939 939 7% 0.0 88% KF383028.1
935 935 7% 0.0 88% KF383031.1
930 930 7% 0.0 87% KF383038.1
921 921 7% 0.0 87% KF383046.1
906 906 6% 0.0 88% KF383103.1
906 906 6% 0.0 88% KF383086.1
906 906 7% 0.0 87% KF383045.1
902 902 7% 0.0 87% KF383043.1
901 901 7% 0.0 86% KF383035.1
897 897 7% 0.0 87% KF383041.1
893 893 7% 0.0 86% KF383042.1
874 874 6% 0.0 87% KF383104.1
874 874 6% 0.0 87% KF383085.1
870 870 6% 0.0 87% KF383106.1
868 868 4% 0.0 99% KX247638.1
866 866 7% 0.0 86% KF383040.1
865 865 4% 0.0 99% KU978616.1
865 865 6% 0.0 87% KF383114.1
865 865 6% 0.0 87% KF383107.1
865 865 6% 0.0 87% KF383088.1
861 861 6% 0.0 87% KF383087.1
854 8490 51% 0.0 89% KX101067.1
847 847 6% 0.0 87% KF383089.1
843 843 6% 0.0 86% KF383101.1
843 843 6% 0.0 86% KF383097.1
838 838 6% 0.0 86% KF383099.1
834 834 6% 0.0 86% KF383098.1
823 823 4% 0.0 99% KU872850.1
820 820 4% 0.0 99% AB908162.1
807 807 4% 0.0 100% KX253994.1
807 807 6% 0.0 85% KF383084.1
801 801 6% 0.0 85% KF383113.1
717 717 7% 0.0 81% KF383017.1
713 713 7% 0.0 81% KF383016.1
713 713 7% 0.0 81% KF383015.1
708 708 7% 0.0 81% KF383020.1
706 706 7% 0.0 81% KF383021.1
693 693 3% 0.0 98% KF258813.1
690 690 7% 0.0 80% KF383019.1
681 681 3% 0.0 100% KX253995.1
664 664 6% 0.0 81% KF383092.1
663 663 6% 0.0 81% KF383093.1
657 657 6% 0.0 81% KF383095.1
654 654 6% 0.0 80% KF383091.1
636 636 3% 4e-177 99% KU985088.1
630 630 3% 2e-175 100% KX062045.1
625 625 3% 8e-174 99% KX062044.1
587 587 3% 2e-162 99% KR815989.1
580 580 3% 3e-160 99% KX173842.1

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
18969 18969 100% 0.0 100% KX702400.1
18936 18936 100% 0.0 99% KX247646.1
18925 18925 100% 0.0 99% KU820897.5
18925 18925 100% 0.0 99% KX087102.1
18881 18881 100% 0.0 99% KX198135.1
18870 18870 100% 0.0 99% KX156776.1
18864 18864 100% 0.0 99% KX156774.1
18859 18859 100% 0.0 99% KX156775.1
18831 18831 100% 0.0 99% KU647676.1
18825 18825 100% 0.0 99% KX548902.1
18809 18809 100% 0.0 99% KU922960.1
18803 18803 100% 0.0 99% KU922923.1
18792 18792 100% 0.0 99% KX447510.1
18787 18787 100% 0.0 99% KU991811.1
18781 18781 100% 0.0 99% KX447512.1
18781 18781 100% 0.0 99% KX369547.1
18781 18781 100% 0.0 99% KU509998.3
18776 18776 100% 0.0 99% KX447509.1
18776 18776 100% 0.0 99% KJ776791.1
18770 18770 100% 0.0 99% KX447515.1
18770 18770 100% 0.0 99% KX447513.1
18764 18764 100% 0.0 99% KX447511.1
18764 18764 100% 0.0 99% KX280026.1
18764 18764 100% 0.0 99% KU707826.1
18764 18764 100% 0.0 99% KU365779.1
18764 18764 100% 0.0 99% KU321639.1
18759 18759 100% 0.0 99% KX447514.1
18759 18759 100% 0.0 99% KX051563.1
18753 18753 100% 0.0 99% KX447516.1
18753 18753 100% 0.0 99% KU729218.1
18748 18748 100% 0.0 99% KX262887.1
18748 18748 100% 0.0 99% KX197192.1
18748 18748 100% 0.0 99% KU365780.1
18744 18744 99% 0.0 99% KU497555.1
18742 18742 100% 0.0 99% KU365777.1
18737 18737 100% 0.0 99% KX694534.1
18737 18737 100% 0.0 99% KU758877.1
18737 18737 100% 0.0 99% KU926309.1
18731 18731 100% 0.0 99% KU940228.1
18726 18726 100% 0.0 99% KX447517.1
18726 18726 100% 0.0 99% KU501217.1
18726 18726 100% 0.0 99% KU365778.1
18726 18726 100% 0.0 99% KU312312.1
18720 18720 100% 0.0 99% KU729217.2
18720 18720 100% 0.0 99% KU527068.1
18720 18720 100% 0.0 99% KU501216.1
18715 18715 100% 0.0 99% KX247632.1
18715 18715 100% 0.0 99% KU937936.1
18715 18715 100% 0.0 99% KU926310.1
18715 18715 100% 0.0 99% KU501215.1
18709 18709 100% 0.0 99% KX601168.1
18709 18709 100% 0.0 99% KX520666.1
18709 18709 100% 0.0 99% KX087101.2
18703 18703 100% 0.0 99% KX446951.1
18703 18703 100% 0.0 99% KX377337.1
18703 18703 100% 0.0 99% KU820898.1
18698 18698 100% 0.0 99% KX446950.1
18698 18698 100% 0.0 99% KU870645.1
18694 18694 100% 0.0 99% KX766028.1
18692 18692 100% 0.0 99% KU853013.1
18691 18691 100% 0.0 99% KU853012.1
18687 18687 100% 0.0 99% KX056898.1
18687 18687 100% 0.0 99% KU955590.1
18681 18681 100% 0.0 99% KU740184.2
18681 18681 100% 0.0 99% KU761564.1
18670 18670 100% 0.0 99% KX766029.1
18665 18665 100% 0.0 99% KX673530.1
18665 18665 100% 0.0 99% KX117076.1
18654 18654 100% 0.0 99% KX185891.1
18654 18654 100% 0.0 99% KU963796.1
18648 18648 100% 0.0 99% KX253996.1
18648 18648 100% 0.0 99% KU955589.1
18648 18648 100% 0.0 99% KU820899.2
18644 18644 100% 0.0 99% KX266255.1
18643 18643 100% 0.0 99% KU866423.2
18633 18633 99% 0.0 99% KU940224.1
18499 18499 100% 0.0 99% KU744693.1
18366 18366 100% 0.0 99% KU681081.3
18233 18233 100% 0.0 99% KX694532.1
17996 17996 98% 0.0 99% KF993678.1
17991 17991 99% 0.0 98% JN860885.1
17989 17989 100% 0.0 98% KU955593.1
17804 17804 100% 0.0 98% EU545988.1
17612 17612 100% 0.0 98% KU681082.3
16574 16574 88% 0.0 99% KX447518.1
16388 16388 99% 0.0 95% KX601167.1
16382 16382 99% 0.0 95% HQ234499.1
16377 16377 99% 0.0 95% KX694533.1
16371 16371 99% 0.0 95% KX377336.1

Share this post


Link to post
Share on other sites
LOCUS       KX893855               10808 bp    cRNA    linear   VRL 01-OCT-2016
DEFINITION  Zika virus strain Zika virus/Homo sapiens/VEN/UF-2/2016, complete
            genome.
ACCESSION   KX893855
VERSION     KX893855.1  GI:1070310450
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10808)
  AUTHORS   Blohm,G.M., Paniz Mondolfi,A.E., Puliam,J.R.C., Morris,J.G. Jr.,
            White,S.K., Bonny,T.S., Loeb,J.C., Pacheco,C., Marquez,M. and
            Lednicky,J.A.
  TITLE     Viable Zika virus in the serum of an asymptomatic breastfeeding
            Venezuelan infant in 2016
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10808)
  AUTHORS   Blohm,G.M., Paniz Mondolfi,A.E., Puliam,J.R.C., Morris,J.G. Jr.,
            White,S.K., Bonny,T.S., Loeb,J.C., Pacheco,C., Marquez,M. and
            Lednicky,J.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-SEP-2016) Environmental and Global Health, University
            of Florida - Gainesville, 1225 Center Drive, Room 4155,
            Gainesville, FL 32610, USA
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10808
                     /organism="Zika virus"
                     /mol_type="viral cRNA"
                     /strain="Zika virus/Homo sapiens/VEN/UF-2/2016"
                     /isolation_source="serum"
                     /host="Homo sapiens; symptomatic breast-feeding infant"
                     /db_xref="taxon:64320"
                     /country="Venezuela"
                     /collection_date="25-Mar-2016"
                     /collected_by="Alberto E. Paniz Mondolfi"
                     /identified_by="Gabriela Blohm and John Lednicky"
                     /note="from Barquisimeto City;
                     passage details: LLC-MK2 cells, passage 1"

Share this post


Link to post
Share on other sites