Sign in to follow this  
Followers 0
niman

Full 2016 Zika Sequence From Mexico - R116265

3 posts in this topic

LOCUS       KX766029               10749 bp    RNA     linear   VRL 26-AUG-2016
DEFINITION  Zika virus isolate R116265, complete genome.
ACCESSION   KX766029
VERSION     KX766029.1  GI:1059853344
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10749)
  AUTHORS   Lanciotti,R.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-AUG-2016) Diagnostic & Reference Laboratory,
            Arbovirus Diseases Branch, Centers for Disease Control &
            Prevention, 3150 Rampart Road, Fort Collins, CO 80521, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. 7
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10749
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="R116265"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Mexico"
                     /collection_date="23-Jun-2016"

Share this post


Link to post
Share on other sites
LOCUS       KX766029               10749 bp    RNA     linear   VRL 26-AUG-2016
DEFINITION  Zika virus isolate R116265, complete genome.
ACCESSION   KX766029
VERSION     KX766029.1  GI:1059853344
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10749)
  AUTHORS   Lanciotti,R.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-AUG-2016) Diagnostic & Reference Laboratory,
            Arbovirus Diseases Branch, Centers for Disease Control &
            Prevention, 3150 Rampart Road, Fort Collins, CO 80521, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. 7
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10749
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="R116265"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Mexico"
                     /collection_date="23-Jun-2016"
     CDS             103..10374
                     /note="C-prM/M-E-NS1-NS2a-NS2b-NS3-NS4A-NS4B-NS5"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AOG18296.1"
                     /db_xref="GI:1059853345"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRAPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAEDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGIMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIL
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRTPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 ttgatctgyg tgaatcagac tgcgacagtt cgagtttgaa gcgaaagcta gcaacagtat
       61 caacaggttt tattttggat ttggaaacga gagtttctgg tcatgaaaaa cccaaaaaag
      121 aaatccggag gattccggat tgtcaatatg ctaaaacgcg gagtagcccg tgtgagcccc
      181 tttgggggct tgaagaggct gccagccgga cttctgctgg gtcatgggcc catcaggatg
      241 gtcttggcga ttctagcctt tttgagattc acggcaatca agccatcact gggtctcatc
      301 aatagatggg gttcagtggg gaaaaaagag gctatggaaa taataaagaa gttcaagaaa
      361 gatctggctg ccatgctgag aataatcaat gctaggaagg agaagaagag acgaggcgca
      421 gatactagtg tcggaattgt tggcctcctg ctgaccacag ctatggcagc ggaggtcact
      481 agacgtggga gtgcatacta tatgtacttg gacagaaacg atgctgggga ggccatatct
      541 tttccaacca cattggggat gaataagtgt tatatacaga tcatggatct tggacacatg
      601 tgtgatgcca ccatgagcta tgaatgccct atgctggatg agggggtgga accagatgac
      661 gtcgattgtt ggtgcaacac gacgtcaact tgggttgtgt acggaacctg ccatcacaaa
      721 aaaggtgaag cacggagatc tagaagagct gtgacgctcc cctcccattc cactaggaag
      781 ctgcaaacgc ggtcgcaaac ctggttggaa tcaagagaat acacaaagca cttgattaga
      841 gtcgaaaatt ggatattcag gaaccctggc ttcgcgttag cagcagctgc catcgcttgg
      901 cttttgggaa gctcaacgag ccaaaaagtc atatacttgg tcatgatact gctgattgcc
      961 ccggcataca gcatcaggtg cataggagtc agcaataggg actttgtgga aggtatgtca
     1021 ggtgggactt gggttgatgt tgtcttggaa catggaggtt gtgtcaccgt aatggcacag
     1081 gacaaaccga ctgtcgacat agagctggtc acaacaacag tcagcaacat ggcggaggta
     1141 agatcctact gctatgaggc atcaatatca gacatggctt cggacagccg ctgcccaaca
     1201 caaggtgaag cctaccttga caagcaatca gacactcaat atgtctgtaa aagaacgtta
     1261 gtggacagag gctggggaaa tggatgtgga ctttttggca aagggagcct ggtgacatgc
     1321 gctaagtttg cttgctccaa gaaaatgacc gggaagagca tccagccaga gaatctggag
     1381 taccggataa tgctgtcagt tcatggctcc cagcacagtg ggatgatcgt taatgacaca
     1441 ggacatgaaa ctgatgagaa tagagcgaag gttgagataa cgcccaattc accaagagcc
     1501 gaagccaccc tggggggttt tggaagccta ggacttgatt gtgaaccgag gacaggcctt
     1561 gacttttcag atttgtatta cttgactatg aataacaagc actggttggt tcacaaggag
     1621 tggttccacg acattccatt accttggcac gctggggcag acaccggaac tccacactgg
     1681 aacaacaaag aagcactggt agagttcaag gacgcacatg ccaaaaggca aactgtcgtg
     1741 gttctaggga gtcaagaagg agcagttcac acggcccttg ctggagctct ggaggctgag
     1801 atggatggtg caaagggaag gctgtcctct ggccacttga aatgtcgcct gaaaatggat
     1861 aaacttagat tgaagggcgt gtcatactcc ttgtgtaccg cagcgttcac attcaccaag
     1921 atcccggctg aaacactgca cgggacagtc acagtggagg tacagtacgc agggacagat
     1981 ggaccttgca aggttccagc tcagatggcg gtggacatgc aaactctgac cccagttggg
     2041 aggttgataa ccgctaaccc cgtaatcact gaaagcactg agaactctaa gatgatgctg
     2101 gaacttgatc caccatttgg ggactcttac attgtcatag gagtcgggga gaagaagatc
     2161 acccaccact ggcacaggag tggcagcacc attggaaaag catttgaagc cactgtgaga
     2221 ggtgccaaga gaatggcagt cttgggagac acagcctggg actttggatc agttggaggc
     2281 gctctcaact cattgggcaa gggcatccat caaatttttg gagcagcttt caaatcattg
     2341 tttggaggaa tgtcctggtt ctcacaaatt ctcattggaa cgttgctgat gtggttgggt
     2401 ctgaacacaa agaatggatc tatttccctt atgtgcttgg ccttaggggg agtgttgatc
     2461 ttcttatcca cagccgtctc tgctgatgtg gggtgctcgg tggacttctc aaagaaggag
     2521 acgagatgcg gtacaggggt gttcgtctat aacgacgttg aagcctggag ggacaggtat
     2581 aagtaccatc ctgactcccc ccgtagattg gcagcagcag tcaagcaagc ctgggaagat
     2641 ggtatctgcg ggatctcctc tgtttcaaga atggaaaaca tcatgtggag atcagtagaa
     2701 ggggagctca acgcaatcct ggaagagaat ggagttcaac tgacggtcgt tgtgggatct
     2761 gtaaaaaacc ccatgtggag agctccacag agattgcccg tgcctgtgaa cgagctgccc
     2821 cacggctgga aggcttgggg gaaatcgtac ttcgttagag cagcaaagac aaataacagc
     2881 tttgtcgtgg atggtgacac actgaaggaa tgcccactca aacatagagc atggaacagc
     2941 tttcttgtgg aggatcatgg gttcggggta ttccacacta gtgtctggct caaggttaga
     3001 gaagattatt cattagagtg tgatccagcc gttattggaa cagctgtcaa gggaaaggag
     3061 gctgtacaca gtgatctagg ctactggatt gagagtgaga agaatgacac atggaggctg
     3121 aagagggccc atctgatcga gatgaaaaca tgtgaatggc caaagtccca cacattgtgg
     3181 acagatggaa tagaagagag tgatctgatc atacccaagt ctttagctgg gccactcagc
     3241 catcacaata ccagagaggg ctacaggacc caaatgaaag ggccatggca cagtgaagag
     3301 cttgaaattc ggtttgagga atgcccaggc actaaggtcc acgtggagga aacatgtgga
     3361 acaagaggac catctctgag atcaaccact gcaagcggaa gggtgatcga ggaatggtgc
     3421 tgcagggagt gcacaatgcc cccactgtcg ttccgggctg aagatggctg ttggtatgga
     3481 atggagataa ggcccaggaa agaaccagaa agcaacttag taaggtcaat ggtgactgca
     3541 ggatcaactg atcacatgga tcacttctcc cttggagtgc ttgtgattct gctcatggtg
     3601 caggaagggc taaagaagag aatgaccaca aagatcatca taagcacatc aatggcagtg
     3661 ctggtagcta tgatcctggg aggattttca atgagtgacc tggctaagct tgcaattttg
     3721 atgggtgcca ccttcgcgga aatgaacact ggaggagatg tagctcatct ggcgctgata
     3781 gcggcattca aagtcagacc agcgttgctg gtatctttca tcttcagagc taattggaca
     3841 ccccgtgaaa gcatgctact ggccttggcc tcgtgtcttt tgcaaactgc gatctccgcc
     3901 ttggaaggcg acctgatggt tctcatcaat ggttttgctt tggcctggtt ggcaatacga
     3961 gcgatggttg ttccacgcac tgataacatc accttggcaa tcctggctgc tctgacacca
     4021 ctggcccggg gcacactgct tgtggcgtgg agagcaggcc ttgctacttg cggggggttt
     4081 atgctcctct ctctgaaggg aaaaggcagt gtgaagaaga acttaccatt tgtcatggcc
     4141 ctgggactaa ccgctgtgag gctggtcgac cccatcaacg tggtgggact gctgttgctc
     4201 acaaggagtg ggaagcggag ctggccccct agcgaagtac tcacagctgt tggcctgata
     4261 tgcgcattgg ctggagggtt cgccaaggca gatatagaga tggctgggcc catggccgcg
     4321 gtcggtctgc taattgtcag ttacgtggtc tcaggaaaga gtgtggacat gtacattgaa
     4381 agagcaggtg acatcacatg ggaaaaagat gcggaagtca ctggaaacag tccccggctc
     4441 gatgtggcgc tagatgagag tggtgatttc tccctggtgg aggatgacgg tccccccatg
     4501 agagagatca tactcaaggt ggtcctgatg accatctgtg gcatgaaccc aatagccata
     4561 ccctttgcag ctggagcgtg gtacgtatac gtgaagactg ggaaaaggag tggtgctcta
     4621 tgggatgtgc ctgctcccaa ggaagtaaaa aagggggaga ccacagatgg agtgtacaga
     4681 gtaatgactc gtagactgct aggttcaaca caagttggag tgggaattat gcaagagggg
     4741 gtctttcaca ctatgtggca cgtcacaaaa ggatccgcac tgagaagcgg tgaagggaga
     4801 cttgatccat actggggaga tgtcaagcag gatctggtgt catactgtgg tccatggaag
     4861 ctagatgccg cctgggacgg gcacagcgag gtgcagctct tggccgtgcc ccccggagag
     4921 agagcgagga acatccagac tctgcccgga atatttaaga caaaggatgg ggacattgga
     4981 gcggttgcgc tggattaccc agcaggaact tcaggatctc caatcctaga caagtgtggg
     5041 agagtgatag gactttatgg caatggggtc gtgatcaaaa acgggagtta tgttagtgcc
     5101 atcacccaag ggaggaggga ggaagagact cctgttgagt gcttcgagcc ttcgatgctg
     5161 aagaagaagc agctaactgt cttagactta catcctggag ctgggaaaac caggagagtt
     5221 cttcctgaaa tagtccgtga agccataaaa acaagactcc gtactgtgat cttagctcca
     5281 accagggttg tcgctgctga aatggaggag gcccttagag ggcttccagt gcgttatatg
     5341 acaacagcag tcaatgtcac ccactctgga acagaaatcg tcgacttaat gtgccatgcc
     5401 accttcactt cacgtctact acagccaatc agagtcccca actataatct gtatattatg
     5461 gatgaggccc acttcacaga tccctcaagt atagcagcaa gaggatacat ttcaacaagg
     5521 gttgagatgg gcgaggcggc tgccatcttc atgaccgcca cgccaccagg aacccgtgac
     5581 gcatttccgg actccaactc accaattatg gacaccgaag tggaagtccc agagagagcc
     5641 tggagctcag gctttgattg ggtgacggat cattctggga aaacagtttg gtttgttcca
     5701 agcgtgagga acggcaatga gatcgcagct tgtctgacaa aggctggaaa acgggtcata
     5761 cagctcagca gaaagacttt tgagacagag ttccagaaaa caaaacatca agagtgggac
     5821 tttgtcgtga caactgacat ttcagagatg ggcgccaact ttaaagctga ccgtgtcata
     5881 gattccagga gatgcctaaa gccggtcata cttgatggcg agagagtcat tctggctgga
     5941 cccatgcctg tcacacatgc cagcgctgcc cagaggaggg ggcgcatagg caggaatccc
     6001 aacaaacctg gagatgagta tctgtatgga ggtgggtgcg cagagactga cgaagaccat
     6061 gcacactggc ttgaagcaag aatgctcctt gacaatattt acctccaaga tggcctcata
     6121 gcctcgctct atcgacctga ggccgacaaa gtagcagcca ttgagggaga gttcaagctt
     6181 aggacggagc aaaggaagac ctttgtggaa ctcatgaaaa gaggagatct tcctgtttgg
     6241 ctggcctatc aggttgcatc tgccggaata acctacacag atagaagatg gtgctttgat
     6301 ggcacgacca acaacaccat actggaagac agtgtgccgg cagaggtgtg gaccagacac
     6361 ggagagaaaa gagtgctcaa accgaggtgg atggacgcca gagtttgttc agatcatgcg
     6421 gccctgaagt cattcaagga gtttgccgct ggaaaaagag gagcggcttt tggggtgatg
     6481 gaagccctgg gaacactgcc aggacacatg acagagagat tccaggaagc cattgacaac
     6541 ctcgctgtgc tcatgcgggc agagactgga agcaggcctt acaaagccgc ggcggcccaa
     6601 ttgccggaga ccctagagac cattatgctt ttggggttgc tgggaacagt ctcgctggga
     6661 atctttttcg tcttgatgag gaacaagggc atagggaaga tgggctttgg aatggtgacc
     6721 cttggggcca gtgcatggct catgtggctc tcggaaattg agccagccag aattgcatgt
     6781 gtcctcattg ttgtgttcct attgctggtg gtgctcatac ctgagccaga aaagcaaaga
     6841 tctccccagg acaaccaaat ggcaatcatc atcatggtag cagtaggtct tctgggcttg
     6901 attaccgcca atgaactcgg atggttggag agaacaaaga gtgacctaag ccatctaatg
     6961 ggaaggagag aggagggggc aaccatagga ttctcaatgg acattgacct gcggccagcc
     7021 tcagcttggg ccatctatgc tgccttgaca actttcatta ccccagccgt ccaacatgca
     7081 gtgaccactt catacaacaa ctactcctta atggcgatgg ccacgcaagc tggagtgttg
     7141 tttggtatgg gcaaagggat gccattctac gcatgggact ttggagtccc gctactaatg
     7201 ataggttgct actcacaatt aacacccctg accctaatag tggccatcat tttgctcgtg
     7261 gcgcactaca tgtacttgat cccagggctg caggcagcag ccgcgcgtgc tgcccagaag
     7321 agaacggcag ctggcatcat gaagaaccct gttgtggatg gaatagtggt gactgacatt
     7381 gacacaatga caattgaccc ccaagtggag aaaaagatgg gacaggtgct actcatagca
     7441 gtagccgtct ccagcgccat actgtcgcgg accgcctggg ggtgggggga ggctggggcc
     7501 ctgatcacag ccgcaacttc cactttgtgg gaaggctctc cgaacaagta ctggaactcc
     7561 tctacagcca cttcactgtg taacattttt aggggaagtt acttggctgg agcttctcta
     7621 atctacacag taacaagaaa cgctggcttg gtcaagagac gtgggggtgg aacaggagag
     7681 accctgggag agaaatggaa ggcccgcttg aaccagatgt cggccctgga gttctactcc
     7741 tacaaaaagt caggcatcac cgaggtgtgc agagaagagg cccgccgcgc cctcaaggac
     7801 ggtgtggcaa cgggaggcca tgctgtgtcc cgaggaagtg caaagctgag atggttggtg
     7861 gagcggggat acctgcagcc ctatggaaag gtcattgatc ttggatgtgg cagagggggc
     7921 tggagttact acgccgccac catccgcaaa gttcaagaag tgaaaggata cacaaaagga
     7981 ggccctggtc atgaggaacc cgtgttggtg caaagctatg ggtggaacat agtccgtctt
     8041 aagagtgggg tggacgtctt tcatatggcg gctgagccgt gtgacacgtt gctgtgtgac
     8101 ataggtgagt catcatctag tcctgaagtg gaagaagcac ggacgctcag agtcctctcc
     8161 atggtggggg attggcttga aaaaagacca ggagcctttt gtataaaagt gttgtgccca
     8221 tacaccagca ctatgatgga aaccctggag cgactgcagc gtaggtatgg gggaggactg
     8281 gtcagagtgc cactatcccg caactctaca catgagatgt actgggtctc tggagcgaaa
     8341 agcaacacca taaaaagtgt gtccaccacg agccagctcc tcttggggcg catggacggg
     8401 cctaggaggc cagtgaaata tgaggaggat gtgaatctcg gctctggcac gcgggctgtg
     8461 gtaagctgcg ctgaagctcc caacatgaag atcattggta accgcattga aaggatccgc
     8521 agtgagcacg cggaaacgtg gttctttgac gagaaccacc catataggac atgggcttac
     8581 catggaagct atgaggcccc cacacaaggg tcagcgtcct ctctaataaa cggggttgtc
     8641 aggctcctgt caaaaccctg ggatgtggtg actggagtca caggaatagc catgaccgac
     8701 accacaccgt atggtcagca aagagttttc aaggaaaaag tggacactag ggtgccagac
     8761 ccccaagaag gcactcgtca ggttatgagc atggtctctt cctggttgtg gaaagagcta
     8821 ggcaaacaca aacggccacg agtctgtacc aaagaagagt tcatcaacaa ggttcgtagc
     8881 aatgcagcat taggggcaat atttgaagag gaaaaagagt ggaagactgc agtggaagct
     8941 gtgaacgatc caaggttctg ggctctagtg gacaaggaaa gagagcacca cctgagagga
     9001 gagtgccaga gttgtgtgta caacatgatg ggaaaaagag aaaagaaaca aggggaattt
     9061 ggaaaggcca agggcagccg cgccatctgg tatatgtggc taggggctag atttctagag
     9121 ttcgaagccc ttggattctt gaacgaggat cactggatgg ggagagagaa ctcaggaggt
     9181 ggtgttgaag ggctgggatt acaaagactc ggatatgtcc tagaagagat gagtcgcaca
     9241 ccaggaggaa ggatgtatgc agatgacact gctggctggg acacccgcat cagcaggttt
     9301 gacctggaga atgaagctct aatcaccaac caaatggaga aagggcacag ggccttggca
     9361 ttggccataa tcaagtacac ataccaaaac aaagtggtaa aggtccttag accagctgaa
     9421 aaagggaaaa cagttatgga cattatttcg agacaagacc aaagggggag cggacaagtt
     9481 gtcacttacg ctcttaacac atttaccaac ctagtggtgc aactcattcg gaatatggag
     9541 gctgaggaag ttctagagat gcaagacttg tggctgctgc ggaggtcaga gaaagtgacc
     9601 aactggttgc agagcaacgg atgggatagg ctcaaacgaa tggcagtcag tggagatgat
     9661 tgcgttgtga agccaattga tgataggttt gcacatgccc tcaggttctt gaatgatatg
     9721 ggaaaagtta ggaaggacac acaagagtgg aaaccctcaa ctggatggga caactgggaa
     9781 gaagttccgt tttgctccca ccacttcaac aagctccatc tcaaggacgg gaggtccatt
     9841 gtggttccct gccgccacca agatgaactg attggccggg cccgcgtctc tccaggggcg
     9901 ggatggagca tccgggagac tgcttgccta gcaaaatcat atgcgcaaat gtggcagctc
     9961 ctttatttcc acagaaggga cctccgactg atggccaatg ccatttgttc atctgtgcca
    10021 gttgactggg ttccaactgg gagaactacc tggtcaatcc atggaaaggg agaatggatg
    10081 accactgaag acatgcttgt ggtgtggaac agagtgtgga ttgaggagaa cgaccacatg
    10141 gaagacaaga ccccagttac gaaatggaca gacattccct atttgggaaa aagggaagac
    10201 ttgtggtgtg gatctctcat agggcacaga ccgcgcacca cctgggctga gaacattaaa
    10261 aacacagtca acatggtgcg caggatcata ggtgatgaag aaaagtacat ggactaccta
    10321 tccacccaag ttcgctactt gggtgaagaa gggtctacac ctggagtgct gtaagcacca
    10381 atcttaatgt tgtcaggcct gctagtcagc cacagcttgg ggaaagctgt gcagcctgtg
    10441 acccccccag gagaagctgg gaaaccaagc ctatagtcag gccgagaacg ccatggcacg
    10501 gaagaagcca tgctgcctgt gagcccctca gaggacactg agtcaaaaaa ccccacgcgc
    10561 ttggaggcgc aggatgggaa aagaaggtgg cgaccttccc cacccttcaa tctggggcct
    10621 gaactggaga tcagctgtgg atctccagaa gagggactag tggttagagg agaccccccg
    10681 gaaaacgcaa aacagcatat tgacgctggg aaagaccaga gactccatga gtttccacca
    10741 cgctggccg

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
18969 18969 100% 0.0 100% KX766029.1
18859 18859 100% 0.0 99% KX247632.1
18848 18848 100% 0.0 99% KX446951.1
18842 18842 100% 0.0 99% KX446950.1
18825 18825 100% 0.0 99% KX262887.1
18814 18814 100% 0.0 99% KX694534.1
18803 18803 100% 0.0 99% KU501217.1
18798 18798 100% 0.0 99% KU501216.1
18776 18776 100% 0.0 99% KU870645.1
18770 18770 100% 0.0 99% KX447510.1
18759 18759 100% 0.0 99% KX447512.1
18759 18759 100% 0.0 99% KX369547.1
18759 18759 100% 0.0 99% KU509998.3
18753 18753 100% 0.0 99% KX447509.1
18753 18753 100% 0.0 99% KJ776791.1
18748 18748 100% 0.0 99% KX447513.1
18742 18742 100% 0.0 99% KX447515.1
18742 18742 100% 0.0 99% KX447511.1
18742 18742 100% 0.0 99% KX280026.1
18742 18742 100% 0.0 99% KU991811.1
18742 18742 100% 0.0 99% KU707826.1
18742 18742 100% 0.0 99% KU365779.1
18742 18742 100% 0.0 99% KU321639.1
18737 18737 100% 0.0 99% KX447514.1
18737 18737 100% 0.0 99% KX051563.1
18737 18737 100% 0.0 99% KU926309.1
18731 18731 100% 0.0 99% KX447516.1
18731 18731 100% 0.0 99% KU729218.1
18726 18726 100% 0.0 99% KU758877.1
18726 18726 100% 0.0 99% KX197192.1
18726 18726 100% 0.0 99% KU365780.1
18720 18720 100% 0.0 99% KU365777.1
18715 18715 100% 0.0 99% KX198135.1
18709 18709 100% 0.0 99% KU940228.1
18709 18709 100% 0.0 99% KU647676.1
18703 18703 100% 0.0 99% KX247646.1
18703 18703 100% 0.0 99% KX156776.1
18703 18703 100% 0.0 99% KU501215.1
18703 18703 100% 0.0 99% KU365778.1
18703 18703 100% 0.0 99% KU312312.1
18700 18700 99% 0.0 99% KU497555.1
18698 18698 100% 0.0 99% KX601168.1
18698 18698 100% 0.0 99% KX087101.2
18698 18698 100% 0.0 99% KX156774.1
18698 18698 100% 0.0 99% KU729217.2
18698 18698 100% 0.0 99% KU527068.1
18692 18692 100% 0.0 99% KU820897.5
18692 18692 100% 0.0 99% KX447517.1
18692 18692 100% 0.0 99% KX377337.1
18692 18692 100% 0.0 99% KU937936.1
18692 18692 100% 0.0 99% KX156775.1
18692 18692 100% 0.0 99% KX087102.1
18687 18687 100% 0.0 99% KX520666.1
18687 18687 100% 0.0 99% KU922960.1
18681 18681 100% 0.0 99% KX548902.1
18681 18681 100% 0.0 99% KU926310.1
18681 18681 100% 0.0 99% KU922923.1
18681 18681 100% 0.0 99% KU853013.1
18679 18679 100% 0.0 99% KU853012.1
18670 18670 100% 0.0 99% KX702400.1
18670 18670 100% 0.0 99% KU820898.1
18665 18665 100% 0.0 99% KX056898.1
18665 18665 100% 0.0 99% KU955590.1
18661 18661 100% 0.0 99% KX766028.1
18659 18659 100% 0.0 99% KU740184.2
18659 18659 100% 0.0 99% KU761564.1
18654 18654 100% 0.0 99% KX673530.1
18643 18643 100% 0.0 99% KX117076.1
18631 18631 100% 0.0 99% KX185891.1
18631 18631 100% 0.0 99% KU963796.1
18626 18626 100% 0.0 99% KX253996.1
18626 18626 100% 0.0 99% KU955589.1
18626 18626 100% 0.0 99% KU820899.2
18622 18622 100% 0.0 99% KX266255.1
18620 18620 100% 0.0 99% KU866423.2
18611 18611 99% 0.0 99% KU940224.1
18465 18465 100% 0.0 99% KU744693.1
18332 18332 100% 0.0 99% KU681081.3
18183 18183 100% 0.0 99% KX694532.1
17980 17980 99% 0.0 98% JN860885.1
17978 17978 100% 0.0 98% KU955593.1
17946 17946 98% 0.0 99% KF993678.1
17771 17771 100% 0.0 98% EU545988.1
17584 17584 100% 0.0 98% KU681082.3
16558 16558 88% 0.0 99% KX447518.1
16366 16366 99% 0.0 95% KX601167.1
16360 16360 99% 0.0 95% HQ234499.1
16355 16355 99% 0.0 95% KX694533.1
16349 16349 99% 0.0 95% KX377336.1
12554 12554 100% 0.0 89% KU720415.1
12549 12549 99% 0.0 89% HQ234498.1
12538 12538 100% 0.0 89% KX377335.1
12534 12534 100% 0.0 89% KF383115.1
12526 12526 100% 0.0 89% LC002520.1
12526 12526 100% 0.0 89% KF383119.1
12499 12499 100% 0.0 89% KU955595.1
12495 12495 100% 0.0 89% KF268948.1
12493 12493 100% 0.0 89% KX601169.1
12493 12493 100% 0.0 89% KU963573.1
12493 12493 100% 0.0 89% KU955594.1
12488 12488 100% 0.0 89% KU955592.1
12488 12488 100% 0.0 89% KF268950.1
12482 12482 100% 0.0 89% KF268949.1
12477 12477 100% 0.0 89% DQ859059.1
12471 12471 100% 0.0 89% KX198134.1
12466 12466 100% 0.0 89% KU955591.1
12460 12460 100% 0.0 89% KF383116.1
12454 12454 100% 0.0 89% AY632535.2
12429 12429 99% 0.0 89% HQ234501.1
12388 12388 100% 0.0 88% KF383117.1
12382 12382 100% 0.0 88% KX601166.1
12344 12344 100% 0.0 88% KU963574.1
12344 12344 99% 0.0 88% HQ234500.1
12165 12165 100% 0.0 88% KF383118.1
12139 12139 97% 0.0 89% KF383121.1
11738 16149 86% 0.0 99% KX447520.1
11112 18741 100% 0.0 99% KX576684.1
10207 16426 87% 0.0 99% KX447519.1
10052 15288 81% 0.0 99% KX447521.1
9681 9681 97% 0.0 84% KF383120.1
5099 5099 27% 0.0 99% KX212103.1
5092 5092 27% 0.0 99% KU758871.1
5090 5090 27% 0.0 99% KU758875.1
5084 5084 27% 0.0 99% KU758870.1
5083 5083 27% 0.0 99% KU312314.1
5081 5081 27% 0.0 99% KU758873.1
5066 5066 27% 0.0 99% KU758872.1
5055 5055 26% 0.0 99% KU758869.1
5053 5053 27% 0.0 99% KU758876.1
5049 5049 27% 0.0 99% KU312313.1
5024 5024 26% 0.0 99% KU758868.1
5018 5018 26% 0.0 99% KU758874.1
4732 4732 25% 0.0 99% KU646828.1
4721 4721 25% 0.0 99% KU646827.1
4527 14522 78% 0.0 98% KU940227.1
3500 3500 18% 0.0 99% KU312315.1
3271 3271 17% 0.0 99% KU740199.1
3173 13322 72% 0.0 99% KX101066.1
3086 10977 59% 0.0 98% KX101060.1
2748 2748 14% 0.0 99% KJ634273.1
2743 2743 14% 0.0 99% LC171327.1
2087 2087 11% 0.0 99% KU686218.1
2054 2054 11% 0.0 99% KU179098.1
1905 1905 10% 0.0 99% KU886298.1
1879 13803 74% 0.0 99% KX101061.1
1875 1875 9% 0.0 99% KX059014.1
1875 1875 9% 0.0 99% KX059013.1
1786 1786 9% 0.0 99% KM078936.1
1783 1783 9% 0.0 99% KM078961.1
1781 1781 9% 0.0 99% KM078930.1
1777 1777 9% 0.0 99% KM078971.1
1777 1777 9% 0.0 99% KM078970.1
1777 1777 9% 0.0 99% KM078933.1
1775 1775 9% 0.0 99% KM078929.1
1685 1685 9% 0.0 99% KX173841.1
1685 1685 9% 0.0 99% KX173840.1
1633 1633 8% 0.0 99% KJ873160.1
1616 9202 49% 0.0 99% KX101064.1
1552 1552 8% 0.0 99% KX173843.1
1541 1541 8% 0.0 99% KX173844.1
1447 1447 7% 0.0 99% KJ873161.1
1408 1408 7% 0.0 99% KM851039.1
1378 1378 7% 0.0 99% KU985087.1
1373 1373 7% 0.0 99% KU556802.1
1363 1363 7% 0.0 98% KM851038.1
1330 1330 7% 0.0 99% KU724096.1
1269 1269 6% 0.0 99% KT200609.1
1262 1262 6% 0.0 99% KU232300.1
1253 1253 6% 0.0 99% KU232290.1
1249 1249 6% 0.0 99% KU232297.1
1243 1243 6% 0.0 99% KU232294.1
1240 1240 6% 0.0 99% KU232292.1
1236 1236 6% 0.0 99% KU232298.1
1232 1232 6% 0.0 99% KU232296.1
1232 1232 6% 0.0 99% KU232293.1
1230 1230 10% 0.0 88% AF013415.1
1229 1229 6% 0.0 99% KU232295.1
1218 1218 6% 0.0 99% KU232288.1
1214 1214 6% 0.0 99% KU232289.1
1212 7434 40% 0.0 99% KX101063.1
1210 1210 6% 0.0 99% KU232299.1
1206 1206 6% 0.0 100% KU724097.1
1205 1205 6% 0.0 99% KU232291.1
1201 7394 39% 0.0 99% KX101065.1
1194 1194 6% 0.0 99% KU724098.1
1158 1158 6% 0.0 99% KU758878.1
1127 1127 5% 0.0 99% KU724099.1
1077 7325 40% 0.0 97% KX101062.1
1042 1042 5% 0.0 100% KU867812.1
1014 1014 8% 0.0 89% KF270886.1
965 965 5% 0.0 99% KU724100.1
926 926 7% 0.0 89% KF383022.1
922 922 7% 0.0 88% KF270887.1
920 920 7% 0.0 89% KF383026.1
917 917 8% 0.0 87% AF372422.1
909 909 7% 0.0 88% KF383032.1
905 905 7% 0.0 88% EU303241.1
904 904 7% 0.0 88% KF383037.1
904 904 7% 0.0 88% KF383034.1
904 904 7% 0.0 88% KF383029.1
898 898 4% 0.0 99% KX247638.1
898 898 7% 0.0 88% KF383036.1
898 898 7% 0.0 88% KF383033.1
893 893 4% 0.0 99% KU978616.1
876 876 7% 0.0 88% KF383039.1
876 876 7% 0.0 88% KF383028.1
870 870 7% 0.0 88% KF383031.1
865 865 7% 0.0 87% KF383038.1
854 854 7% 0.0 87% KF383046.1
846 846 6% 0.0 88% KF383103.1
846 846 6% 0.0 88% KF383086.1
846 846 4% 0.0 99% AB908162.1
837 837 4% 0.0 99% KU872850.1
837 837 7% 0.0 87% KF383045.1
832 832 7% 0.0 87% KF383043.1
826 826 4% 0.0 100% KX253994.1
826 826 7% 0.0 87% KF383041.1
821 8707 48% 0.0 99% KX101067.1
821 821 7% 0.0 86% KF383042.1
813 813 6% 0.0 87% KF383104.1
808 808 6% 0.0 87% KF383085.1
804 804 7% 0.0 86% KF383035.1
802 802 6% 0.0 87% KF383106.1
797 797 6% 0.0 87% KF383114.1
797 797 6% 0.0 87% KF383107.1
797 797 6% 0.0 87% KF383088.1
791 791 6% 0.0 87% KF383087.1
774 774 6% 0.0 86% KF383089.1
769 769 6% 0.0 86% KF383101.1
769 769 6% 0.0 86% KF383097.1
763 763 6% 0.0 86% KF383099.1
758 758 6% 0.0 86% KF383098.1
719 719 6% 0.0 85% KF383113.1
704 704 3% 0.0 98% KF258813.1
697 697 3% 0.0 100% KX253995.1
654 654 3% 0.0 99% KU985088.1
645 645 3% 6e-180 100% KX062045.1
640 640 3% 3e-178 99% KX062044.1
604 604 7% 1e-167 81% KF383017.1
599 599 3% 5e-166 99% KR815989.1
599 599 7% 5e-166 81% KF383016.1
599 599 7% 5e-166 81% KF383015.1
592 592 3% 8e-164 99% KX173842.1
592 592 7% 8e-164 81% KF383021.1
592 592 7% 8e-164 81% KF383020.1
577 577 7% 2e-159 81% KF383019.1
566 566 6% 5e-156 81% KF383092.1
564 564 6% 2e-155 81% KF383093.1
556 556 2% 3e-153 99% KR816334.1
555 555 2% 1e-152 99% KR816333.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.