Sign in to follow this  
Followers 0
niman

October 2015 North Carolina Swine Match 2012 Cases

36 posts in this topic

USDA released 2015 North Carolina swine sequences that match 2012 human cases.

Share this post


Link to post
Share on other sites
LOCUS       KU143619                1701 bp    cRNA    linear   VRL 13-DEC-2015
DEFINITION  Influenza A virus (A/swine/North Carolina/A01857750/2015(H3N2))
            segment 4 hemagglutinin (HA) gene, complete cds.
ACCESSION   KU143619
VERSION     KU143619.1  GI:960313421
KEYWORDS    .
SOURCE      Influenza A virus (A/swine/North Carolina/A01857750/2015(H3N2))
  ORGANISM  Influenza A virus (A/swine/North Carolina/A01857750/2015(H3N2))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1701)
  AUTHORS   Lin,K., Huang,H. and Zhang,J.
  CONSRTM   USDA SIV Survelliance
  TITLE     Direct Submission
  JOURNAL   Submitted (12-NOV-2015) National Veterinary Services Laboratory,
            USDA, 1920 Dayton, Ames, IA 50010, USA
FEATURES             Location/Qualifiers
     source          1..1701
                     /organism="Influenza A virus (A/swine/North
                     Carolina/A01857750/2015(H3N2))"
                     /mol_type="viral cRNA"
                     /strain="A/swine/North Carolina/A01857750/2015"
                     /serotype="H3N2"
                     /isolation_source="nasal swab"
                     /host="swine"
                     /db_xref="taxon:1755979"
                     /segment="4"
                     /country="USA: North Carolina"
                     /collection_date="13-Oct-2015"
     gene            1..1701
                     /gene="HA"
     CDS             1..1701
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="ALR83224.1"
                     /db_xref="GI:960313422"
                     /translation="MKTIIAFSCILCLIFAQKPPGSDNSMATLCLGHHAVPNGTLVKT
                     ITDDQIEVTNATELVQNSSTGRICNSPHQILDGKNCTLIDALLGDPHCDDFQNKKWDL
                     FVERSTAYSNCYPYYVPDYATLRSLIASSGNLEFTQESFNWTGVAQDGSSYACKRGSV
                     KSFFSRLNWLYNLNYKYPEQNVTMPNNDKFDKLYIWGVHHPGTDKDQTNLYVQASGRV
                     IVSTKRSQQTVIPNIGSRPWVRGVSSIISIYWTIVKPGDILLINSTGNLIAPRGYFKI
                     QSGESSIMRSDAHIDECNSECITPNGSIPNDKPFQNVNKITYGACPRYVKQNTLKLAT
                     GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQ
                     ITGKLNRVIKKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
                     HTIDLTDSEMSKLFERTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDIYR
                     NEALNNRFQIKSVQLKSGYKDWILWISFAISCFLLCVVLLGFIMWACQKGNIRCNICI
                     "
     sig_peptide     1..48
                     /gene="HA"
     mat_peptide     49..1035
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1036..1698
                     /gene="HA"
                     /product="HA2"
     misc_feature    1..1701
                     /db_xref="IRD:IRD-A01857750.4"
ORIGIN      
        1 atgaagacta tcattgcttt tagctgcatt ctatgtctga tttttgctca aaaacctccc
       61 ggaagtgaca acagcatggc aacgctgtgc ctaggacacc acgcagtgcc aaacggaaca
      121 ttagtgaaaa caatcacgga tgaccaaatt gaagtgacta atgctactga gctggtccag
      181 aattcctcaa caggtagaat atgcaacagt cctcaccaaa tccttgatgg gaaaaattgc
      241 acactgatag atgctctatt gggggaccct cattgtgatg acttccaaaa caagaaatgg
      301 gacctttttg ttgaacgaag cacagcctac agcaactgtt acccttatta tgtgccagat
      361 tatgctaccc ttaggtcact aattgcctca tctggcaacc tggaatttac ccaagaaagc
      421 ttcaattgga ctggagttgc tcaagacgga tcaagctatg cctgcaaaag gggttctgtt
      481 aaaagtttct ttagtagatt gaattggtta tataacttga attacaagta tccagaacag
      541 aacgtaacta tgccaaacaa tgacaaattt gacaaattgt acatttgggg ggttcaccac
      601 ccgggtacgg acaaagacca aaccaaccta tatgtccaag catcagggag agttatagtc
      661 tctaccaaaa gaagccaaca aactgtaatc ccgaatatcg ggtctagacc ctgggtaagg
      721 ggtgtctcca gcataataag catctattgg acgatagtaa aaccaggaga catacttttg
      781 attaacagca cagggaatct aattgcccct cggggttact tcaaaataca aagtggggaa
      841 agctcaataa tgagatcaga tgcacacatt gatgaatgca attctgaatg cattactcca
      901 aatggaagca ttcccaatga caaacctttt caaaatgtaa acaagatcac atatggagcc
      961 tgtcccagat atgttaagca aaacaccctg aaattggcaa caggaatgcg gaatgtacca
     1021 gagaagcaaa ctagaggcat attcggcgca attgcaggtt tcatagaaaa tggttgggag
     1081 ggaatggtag acggttggta cggtttcagg catcagaatt ctgaaggcac aggacaagca
     1141 gcagatctta aaagcactca agcggcaatc aaccaaatca ccgggaaact aaatagagta
     1201 atcaagaaaa cgaacgagaa atttcatcaa atcgaaaaag aattctcaga agtagaaggg
     1261 agaattcagg acctagagaa atacgttgaa gacactaaaa tagatctctg gtcttacaac
     1321 gctgagcttc ttgttgccct ggagaaccaa catacaattg atttaaccga ctcagagatg
     1381 agcaaactgt tcgaaagaac aagaaggcaa ctgcgggaaa atgctgagga catgggcaat
     1441 ggttgcttca aaatatacca caaatgtgac aacgcttgca taggatcaat cagaaatgga
     1501 acttatgacc atgatatata cagaaacgag gcattaaaca atcggttcca gatcaaaagt
     1561 gttcagctaa agtcaggata caaagattgg atcctatgga tttcctttgc catatcatgc
     1621 tttttgcttt gtgttgttct gctggggttc attatgtggg cctgccaaaa aggcaacatt
     1681 aggtgcaaca tttgcattta a

Share this post


Link to post
Share on other sites
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI623626A/swine/North Carolina/A02024129/2015 (A/H3N2) segment 4 (HA)3098.00.000000e+001693/1701 (99%)
text_code_colored.pngEPI532373A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 4 (HA)3098.00.000000e+001693/1701 (99%)
text_code_colored.pngEPI573807A/swine/North Carolina/A01840322/2015 (A/H3N2) segment 4 (HA)3094.30.000000e+001692/1701 (99%)
text_code_colored.pngEPI597655A/swine/North Carolina/A01476848/2014 (A/H3N2) segment 4 (HA)3092.40.000000e+001692/1701 (99%)
text_code_colored.pngEPI542551A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 4 (HA)3092.40.000000e+001692/1701 (99%)
text_code_colored.pngEPI542447A/swine/North Carolina/A01476196/2014 (A/H3N2) segment 4 (HA)3092.40.000000e+001692/1701 (99%)
text_code_colored.pngEPI542524A/swine/North Carolina/A01477142/2014 (A/H3N2) segment 4 (HA)3088.70.000000e+001691/1701 (99%)
text_code_colored.pngEPI574154A/Kansas/A01377457/2014 (A/H3N2) segment 4 (HA)3086.90.000000e+001691/1701 (99%)
text_code_colored.pngEPI531059A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 4 (HA)3086.90.000000e+001691/1701 (99%)
text_code_colored.pngEPI572994A/swine/North Carolina/A01840071/2014 (A/H3N2) segment 4 (HA)3081.30.000000e+001690/1701 (99%)
text_code_colored.pngEPI545416A/swine/North Carolina/A01478000/2014 (A/H3N2) segment 4 (HA)3081.30.000000e+001690/1701 (99%)
text_code_colored.pngEPI534947A/swine/Iowa/A01501048/2014 (A/H3N2) segment 4 (HA)3081.30.000000e+001690/1701 (99%)
text_code_colored.pngEPI532376A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 4 (HA)3081.30.000000e+001690/1701 (99%)
text_code_colored.pngEPI597661A/swine/North Carolina/A01476883/2014 (A/H3N2) segment 4 (HA)3077.60.000000e+001689/1701 (99%)
text_code_colored.pngEPI538664A/swine/Iowa/A01410752/2014 (A/H3N2) segment 4 (HA)3077.60.000000e+001689/1701 (99%)
text_code_colored.pngEPI533782A/swine/North Carolina/A01410800/2014 (A/H3N2) segment 4 (HA)3077.60.000000e+001689/1701 (99%)
text_code_colored.pngEPI559548A/swine/North Carolina/A01476688/2014 (A/H3N2) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI558883A/swine/North Carolina/A01476771/2014 (A/H0) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI558842A/swine/North Carolina/A01477778/2014 (A/H0) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI558839A/swine/North Carolina/A01478182/2014 (A/H3N2) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI558834A/swine/North Carolina/A01476730/2014 (A/H0) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI558819A/swine/North Carolina/A01476734/2014 (A/H3N2) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI550293A/swine/Iowa/A01410971/2014 (A/H3N2) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI530996A/swine/Iowa/A01410600/2014 (A/H3N2) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI542548A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 4 (HA)3072.10.000000e+001688/1701 (99%)
text_code_colored.pngEPI586151A/swine/North Carolina/A01555667/2015 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI559025A/swine/North Carolina/A01566286/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI545858A/swine/North Carolina/A01476419/2014 (A/H0) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI545840A/swine/North Carolina/A01476427/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI545816A/swine/North Carolina/A01476354/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI545407A/swine/Iowa/A01476267/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI545379A/swine/Iowa/A01476223/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI538670A/swine/Oklahoma/A01475757/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI600431A/swine/North Carolina/A01476974/2014 (A/H3N2) segment 4 (HA)3066.60.000000e+001687/1701 (99%)
text_code_colored.pngEPI573035A/swine/North Carolina/A01555111/2014 (A/H3N2) segment 4 (HA)3066.60.000000e+001687/1701 (99%)
text_code_colored.pngEPI593956A/swine/Minnesota/A01489046/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI584808A/swine/North Carolina/A01841335/2015 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI573818A/swine/North Carolina/A01555273/2015 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI573793A/swine/North Carolina/A01840289/2015 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI573479A/swine/North Carolina/A01840158/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI573350A/swine/Minnesota/A01567013/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI550296A/swine/Iowa/A01410995/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI548259A/swine/Iowa/A01476428/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI542563A/swine/North Carolina/A01476078/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI542542A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI573011A/swine/Arkansas/A01555090/2014 (A/H3N2) segment 4 (HA)3061.00.000000e+001686/1701 (99%)
text_code_colored.pngEPI623700A/swine/Indiana/A01260863/2015 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI600344A/swine/North Carolina/A01476954/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI573020A/swine/North Carolina/A01840022/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI559533A/swine/North Carolina/A01476698/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI545813A/swine/North Carolina/A01476367/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI542474A/swine/Kansas/018050-1/2014 (A/H3N2) segment 4 (HA)3057.30.000000e+001683/1698 (99%)
text_code_colored.pngEPI620523A/swine/Iowa/A02076873/2015 (A/H3N2) segment 4 (HA)3055.50.000000e+001685/1701 (99%)
text_code_colored.pngEPI600449A/swine/North Carolina/A01477954/2014 (A/H3N2) segment 4 (HA)3055.50.000000e+001685/1701 (99%)
text_code_colored.pngEPI669209A/swine/North Carolina/A01857100/2015 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI623703A/swine/Indiana/A01260882/2015 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI598964A/swine/North Carolina/A01476757/2014 (A/H3N2) segment 4 (HA)3053.60.000000e+001686/1702 (99%)
text_code_colored.pngEPI573452A/swine/Iowa/A01555142/2014 (A/H3N2) segment 4 (HA)3049.90.000000e+001684/1701 (99%)
text_code_colored.pngEPI672951A/swine/North Carolina/A01945243/2015 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI620526A/swine/Iowa/A02077538/2015 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI559530A/swine/North Carolina/A01476719/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI557544A/Wisconsin/24/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI557542A/Wisconsin/24/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI542530A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI623651A/swine/Illinois/A02076874/2015 (A/H3N2) segment 4 (HA)3046.20.000000e+001683/1701 (98%)
text_code_colored.pngEPI558851A/swine/Minnesota/A01477780/2014 (A/H3N2) segment 4 (HA)3046.20.000000e+001682/1699 (98%)
text_code_colored.pngEPI669224A/swine/North Carolina/A01857097/2015 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI620514A/swine/Iowa/A02076659/2015 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI620490A/swine/North Carolina/A02077505/2015 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI612571A/swine/North Carolina/A02076180/2015 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI573017A/swine/Ohio/A01840053/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI573003A/swine/Arkansas/A01555074/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI557534A/Wisconsin/24/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI510214A/swine/Illinois/A01475015/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI510211A/swine/Illinois/A01409994/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI510199A/swine/Illinois/A01410268/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI510190A/swine/Illinois/A01411463/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI510173A/swine/Illinois/A01411461/2014 (A/H0) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI507284A/swine/Illinois/A01411097/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI505102A/swine/Iowa/A01409518/2013 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI504864A/swine/Illinois/A01411096/2013 (A/H0) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI460390A/swine/Indiana/A01260254/2013 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI647569A/swine/North Carolina/A02035784/2015 (A/H3N2) segment 4 (HA)3040.70.000000e+001682/1701 (98%)
text_code_colored.pngEPI600347A/swine/North Carolina/A01476949/2014 (A/H3N2) segment 4 (HA)3040.70.000000e+001683/1702 (98%)
text_code_colored.pngEPI590659A/swine/North Carolina/A01841712/2015 (A/H3N2) segment 4 (HA)3040.70.000000e+001682/1701 (98%)
text_code_colored.pngEPI669135A/swine/North Carolina/A02025687/2015 (A/H0) segment 4 (HA)3038.90.000000e+001682/1701 (98%)
text_code_colored.pngEPI600470A/swine/Arkansas/A01476939/2014 (A/H3N2) segment 4 (HA)3038.90.000000e+001682/1701 (98%)
text_code_colored.pngEPI672887A/swine/North Carolina/A01945112/2015 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI669154A/swine/North Carolina/A02025678/2015 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI663380A/swine/North Carolina/A02025575/2015 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI663334A/swine/North Carolina/A01770073/2015 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI647584A/swine/North Carolina/A02025402/2015 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI573495A/swine/Indiana/A01840133/2014 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI573486A/swine/Arkansas/A01555162/2014 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI573448A/swine/Indiana/A01840146/2014 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI545852A/swine/Iowa/A01476426/2014 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI538990A/swine/Michigan/A01410962/2014 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI530299A/swine/Illinois/A01410453/2014 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI530284A/swine/Illinois/A01475190/2014 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI508836A/swine/Illinois/A01409932/2014 (A/H0) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI460381A/swine/Indiana/A01260284/2013 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI573445A/swine/Arkansas/A01840147/2014 (A/H3N2) segment 4 (HA)3033.30.000000e+001681/1701 (98%)
text_code_colored.pngEPI508858A/swine/Illinois/A01410110/2014 (A/H3N2) segment 4 (HA)3033.30.000000e+001681/1701 (98%)
text_code_colored.pngEPI669236A/swine/North Carolina/A01857103/2015 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI663367A/swine/North Carolina/A01769650/2015 (A/H0) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI573599A/swine/Indiana/A01840253/2014 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI530309A/swine/North Carolina/A01410529/2014 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI505062A/swine/Illinois/A01409657/2014 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI460387A/swine/Indiana/A01260252/2013 (A/H3N2) segment 4 (HA)3031.50.000000e+001682/1702 (98%)
text_code_colored.pngEPI460372A/swine/Indiana/A01260276/2013 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI573602A/swine/Indiana/A01840254/2014 (A/H3N2) segment 4 (HA)3029.60.000000e+001680/1701 (98%)
text_code_colored.pngEPI573000A/swine/Arkansas/A01840096/2014 (A/H3N2) segment 4 (HA)3029.60.000000e+001680/1701 (98%)
text_code_colored.pngEPI663313A/swine/North Carolina/A01770059/2015 (A/H3N2) segment 4 (HA)3027.80.000000e+001680/1701 (98%)
text_code_colored.pngEPI669247A/swine/North Carolina/A02025897/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI669178A/swine/Indiana/A01260958/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI653893A/swine/North Carolina/A02034953/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI647504A/swine/North Carolina/A02034471/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI586038A/swine/Illinois/A01555570/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI584802A/swine/Indiana/A01841389/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI531097A/swine/Minnesota/A01493481/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI505039A/swine/Illinois/A01410018/2013 (A/H0) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI573714A/swine/Kansas/14-032477/2014 (A/H3N2) segment 4 (HA)3022.20.000000e+001679/1701 (98%)
text_code_colored.pngEPI584734A/swine/Illinois/A01555638/2015 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI573051A/swine/Iowa/A01840061/2014 (A/H3N2) segment 4 (HA)3016.70.000000e+001678/1701 (98%)
text_code_colored.pngEPI398672A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 4 (HA)3016.70.000000e+001677/1699 (98%)
text_code_colored.pngEPI391413A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 4 (HA)3016.70.000000e+001677/1699 (98%)
text_code_colored.pngEPI391404A/swine/Ohio/A01203186/2012 (A/H3N2) segment 4 (HA)3016.70.000000e+001677/1699 (98%)
text_code_colored.pngEPI366030A/Utah/10/2012 (A/H3N2) segment 4 (HA)3016.70.000000e+001677/1699 (98%)
text_code_colored.pngEPI642513A/Michigan/39/2015 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI558822A/swine/Indiana/A01476743/2014 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI509764A/swine/Indiana/A01260416/2013 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI493012A/swine/Kansas/A01377090/2013 (A/H3N2) segment 4 (HA)3011.20.000000e+001676/1699 (98%)
text_code_colored.pngEPI426890A/swine/Indiana/A01432300/2013 (A/H3N2) segment 4 (HA)3011.20.000000e+001676/1699 (98%)
text_code_colored.pngEPI424073A/swine/Michigan/A01259003/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001676/1699 (98%)
text_code_colored.pngEPI408199A/swine/Indiana/A01260093/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001676/1699 (98%)
text_code_colored.pngEPI396270A/Indiana/133/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001676/1699 (98%)
text_code_colored.pngEPI394913A/Indiana/132/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001676/1699 (98%)
text_code_colored.pngEPI388332A/Utah/10/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001676/1699 (98%)
text_code_colored.pngEPI388327A/Indiana/14/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001676/1699 (98%)
text_code_colored.pngEPI342603A/swine/NY/A01104005/2011 (A/H3N2) segment 4 (HA)3011.20.000000e+001676/1699 (98%)
text_code_colored.pngEPI671792A/swine/Illinois/A01857433/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI559527A/swine/North Carolina/A01476560/2014 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI645058A/swine/Indiana/A01260926/2015 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI573566A/swine/Minnesota/A01469329/2014 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI528431A/swine/Ohio/13TOSU1547/2013 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI527870A/swine/Ohio/13TOSU2043/2013 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI527113A/swine/Ohio/13TOSU2052/2013 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI453427A/swine/Korea/D79/2011 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI453426A/swine/Korea/A18/2011 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI451202A/swine/Alabama/A01104056/2012 (A/H0) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI446888A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI446879A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI446800A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI443550A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI426887A/swine/Iowa/A01432271/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI414186A/swine/Indiana/A00968394/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI414170A/swine/Indiana/A00968398/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI408202A/swine/Indiana/A01260099/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI406576A/swine/Iowa/A01203863/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI406504A/swine/Iowa/A01267939/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI404890A/Iowa/16/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI401609A/swine/Ohio/A00138552/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI397913A/Indiana/123/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI397906A/Illinois/11/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI397905A/Hawaii/03/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI397662A/Maryland/28/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI397396A/Indiana/93/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI397210A/Maryland/25/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI397006A/Ohio/78/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI396262A/Indiana/127/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI396254A/Indiana/126/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI395883A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI395259A/Ohio/35/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI394944A/Maryland/22/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI393306A/Indiana/18/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI392926A/Maryland/20/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI388352A/Indiana/20/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI388346A/Indiana/15/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI388298A/Indiana/19/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI388282A/Indiana/13/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI383528A/swine/Indiana/A01203509/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI381873A/Hawaii/03/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI351662A/swine/Iowa/A01202659/2011 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI346493A/West Virginia/06/2011 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI339171A/Maine/06/2011 (A/H3N2) segment 4 (HA)3005.60.000000e+001675/1699 (98%)
text_code_colored.pngEPI573439A/swine/Missouri/A01555163/2014 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI398492A/swine/Maryland/A01104048/2012 (A/H3N2) segment 4 (HA)3001.90.000000e+001674/1699 (98%)
text_code_colored.pngEPI653868A/swine/Illinois/A00857134/2011 (A/H0) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI653857A/swine/Illinois/A00857131/2011 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI653774A/swine/Illinois/A00857129/2011 (A/H0) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI550135A/swine/Texas/13TOSU0060/2013 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI526932A/swine/Ohio/13TOSU1373/2013 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI492349A/swine/Indiana/A00968364/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI446927A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI446919A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI446863A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI446830A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI443558A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI443526A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI433540A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI433533A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI433306A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI433298A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI414178A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI406530A/swine/Illinois/A01432127/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI401702A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI401684A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI401680A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI401667A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI400105A/swine/Indiana/A00968308/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI398542A/swine/Ohio/A00152576/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI398534A/swine/Ohio/A01208457/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI398526A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI398518A/swine/Ohio/A01133464/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI398500A/swine/Ohio/A01133466/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI398479A/swine/Maryland/A01104040/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397969A/Wisconsin/34/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397962A/Wisconsin/30/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397954A/Ohio/85/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397939A/Ohio/41/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397548A/Ohio/84/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397540A/Ohio/56/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397532A/Ohio/47/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397524A/Ohio/44/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397516A/Ohio/36/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397503A/Indiana/104/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397446A/Wisconsin/31/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397432A/Ohio/81/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397426A/Minnesota/15/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397385A/Indiana/138/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397351A/Ohio/37/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397340A/Indiana/150/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI397089A/Indiana/52/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI396299A/Maryland/23/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI396280A/Indiana/144/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI396208A/Indiana/149/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI396192A/Ohio/77/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI396183A/Indiana/77/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI396175A/Ohio/80/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI395874A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI395866A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI395718A/swine/Indiana/A01104023/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI395711A/swine/Indiana/A01104016/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI395357A/Pennsylvania/17/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI395344A/Wisconsin/28/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI395328A/West Virginia/06/2011 (A/H3N2) segment 4 (HA)3000.10.000000e+001675/1700 (98%)
text_code_colored.pngEPI395270A/Pennsylvania/11/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI395267A/Ohio/65/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI394937A/Ohio/75/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI394933A/Wisconsin/23/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)

Share this post


Link to post
Share on other sites
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI542564A/swine/North Carolina/A01476078/2014 (A/H3N2) segment 6 (NA)2544.00.000000e+001399/1410 (99%)
text_code_colored.pngEPI542552A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 6 (NA)2544.00.000000e+001399/1410 (99%)
text_code_colored.pngEPI542543A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 6 (NA)2544.00.000000e+001399/1410 (99%)
text_code_colored.pngEPI542549A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 6 (NA)2540.30.000000e+001398/1410 (99%)
text_code_colored.pngEPI559534A/swine/North Carolina/A01476698/2014 (A/H3N2) segment 6 (NA)2538.40.000000e+001398/1410 (99%)
text_code_colored.pngEPI531060A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 6 (NA)2538.40.000000e+001398/1410 (99%)
text_code_colored.pngEPI533783A/swine/North Carolina/A01410800/2014 (A/H3N2) segment 6 (NA)2534.70.000000e+001397/1410 (99%)
text_code_colored.pngEPI532377A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 6 (NA)2534.70.000000e+001397/1410 (99%)
text_code_colored.pngEPI600348A/swine/North Carolina/A01476949/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI573351A/swine/Minnesota/A01567013/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI545841A/swine/North Carolina/A01476427/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI545408A/swine/Iowa/A01476267/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI545380A/swine/Iowa/A01476223/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI542531A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI542448A/swine/North Carolina/A01476196/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI538665A/swine/Iowa/A01410752/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI534948A/swine/Iowa/A01501048/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI532374A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 6 (NA)2529.20.000000e+001396/1410 (99%)
text_code_colored.pngEPI530997A/swine/Iowa/A01410600/2014 (A/H3N2) segment 6 (NA)2529.20.000000e+001396/1410 (99%)
text_code_colored.pngEPI612572A/swine/North Carolina/A02076180/2015 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI598965A/swine/North Carolina/A01476757/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI574155A/Kansas/A01377457/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI573480A/swine/North Carolina/A01840158/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI573036A/swine/North Carolina/A01555111/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI559531A/swine/North Carolina/A01476719/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI559026A/swine/North Carolina/A01566286/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI558882A/swine/North Carolina/A01476771/2014 (A/H0) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI558852A/swine/Minnesota/A01477780/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI558843A/swine/North Carolina/A01477778/2014 (A/H0) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI558840A/swine/North Carolina/A01478182/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI558835A/swine/North Carolina/A01476730/2014 (A/H0) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI558820A/swine/North Carolina/A01476734/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI550294A/swine/Iowa/A01410971/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI460388A/swine/Indiana/A01260252/2013 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI460382A/swine/Indiana/A01260284/2013 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI460373A/swine/Indiana/A01260276/2013 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI460367A/swine/Indiana/A01260261/2013 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI600450A/swine/North Carolina/A01477954/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI584809A/swine/North Carolina/A01841335/2015 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI573021A/swine/North Carolina/A01840022/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI572995A/swine/North Carolina/A01840071/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI538671A/swine/Oklahoma/A01475757/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI533959A/swine/Iowa/A01501046/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI460391A/swine/Indiana/A01260254/2013 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI446797A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI443547A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI443523A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI433303A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI433295A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI414172A/swine/Indiana/A00968398/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI401685A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI401681A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI400106A/swine/Indiana/A00968308/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI400096A/swine/Indiana/A00968390/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI398520A/swine/Ohio/A01133464/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI398502A/swine/Ohio/A01133466/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI398494A/swine/Maryland/A01104048/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI398486A/swine/Maryland/A01104040/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI398034A/Maryland/22/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397661A/Maryland/28/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397620A/Maryland/25/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397531A/Ohio/47/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397523A/Ohio/44/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397515A/Ohio/36/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397431A/Ohio/81/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397350A/Ohio/37/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397208A/Ohio/78/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397088A/Indiana/52/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI396276A/Indiana/135/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI396261A/Indiana/127/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI396253A/Indiana/126/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI396234A/Ohio/34/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI395885A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI395336A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI395266A/Ohio/65/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI395258A/Ohio/35/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI394062A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI393694A/West Virginia/16/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI393680A/West Virginia/10/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI393672A/Ohio/71/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI393316A/Ohio/38/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI393310A/West Virginia/09/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI393305A/Indiana/18/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI392704A/Indiana/52/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI392683A/Indiana/13/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI669248A/swine/North Carolina/A02025897/2015 (A/H3N2) segment 6 (NA)2518.10.000000e+001394/1410 (98%)
text_code_colored.pngEPI669155A/swine/North Carolina/A02025678/2015 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI647624A/swine/Michigan/A01104086/2015 (A/H0) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI623627A/swine/North Carolina/A02024129/2015 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI620515A/swine/Iowa/A02076659/2015 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI600345A/swine/North Carolina/A01476954/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI573794A/swine/North Carolina/A01840289/2015 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI559549A/swine/North Carolina/A01476688/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI550297A/swine/Iowa/A01410995/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI548260A/swine/Iowa/A01476428/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI502642A/swine/South Dakota/A01366093/2013 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI446924A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI446916A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI446868A/swine/Ohio/12TOSU411/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI446860A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI446835A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI433542A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI433535A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI408203A/swine/Indiana/A01260099/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI406575A/swine/Iowa/A01203863/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI401703A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI401688A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI398671A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI398544A/swine/Ohio/A00152576/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI398536A/swine/Ohio/A01208457/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397946A/Ohio/84/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397904A/Hawaii/03/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397626A/Ohio/57/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397623A/Indiana/150/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397554A/Ohio/86/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397502A/Indiana/104/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397425A/Minnesota/15/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397403A/Indiana/99/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI396298A/Maryland/23/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001395/1411 (98%)
text_code_colored.pngEPI396207A/Indiana/149/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI396191A/Ohio/77/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI396182A/Indiana/77/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395876A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395868A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI394925A/Illinois/11/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI394059A/Indiana/38/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393701A/Ohio/64/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393518A/Indiana/65/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393297A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393291A/Indiana/38/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI392752A/Indiana/16/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI392698A/Indiana/46/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI392695A/Indiana/43/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI392691A/Indiana/31/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI383539A/swine/Indiana/A01203509/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI593957A/swine/Minnesota/A01489046/2014 (A/H3N2) segment 6 (NA)2512.60.000000e+001393/1410 (98%)
text_code_colored.pngEPI672888A/swine/North Carolina/A01945112/2015 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI663381A/swine/North Carolina/A02025575/2015 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI623701A/swine/Indiana/A01260863/2015 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI620491A/swine/North Carolina/A02077505/2015 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI597662A/swine/North Carolina/A01476883/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001394/1411 (98%)
text_code_colored.pngEPI597656A/swine/North Carolina/A01476848/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001394/1411 (98%)
text_code_colored.pngEPI586152A/swine/North Carolina/A01555667/2015 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI545814A/swine/North Carolina/A01476367/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI542525A/swine/North Carolina/A01477142/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI528783A/swine/Indiana/A01260479/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI509736A/swine/Iowa/13H075/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI492350A/swine/Indiana/A00968364/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI446885A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI446876A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI446827A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI443555A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI443539A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI443531A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI443515A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI443507A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI427179A/swine/Indiana/A01260015/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI426886A/swine/Iowa/A01432271/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI414188A/swine/Indiana/A00968394/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001394/1411 (98%)
text_code_colored.pngEPI406470A/swine/Indiana/A01260041/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI404892A/Iowa/16/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI401610A/swine/Ohio/A00138552/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI400102A/swine/Indiana/A00968397/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI398123A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397931A/Ohio/19/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397918A/Ohio/17/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397750A/Ohio/87/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397627A/Ohio/63/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397625A/Ohio/43/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397624A/Ohio/80/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397621A/Ohio/79/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397547A/Ohio/83/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397539A/Ohio/56/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397395A/Indiana/93/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397384A/Indiana/138/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397377A/Indiana/123/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397363A/Ohio/23/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397097A/Indiana/103/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI396279A/Indiana/144/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001394/1411 (98%)
text_code_colored.pngEPI396269A/Indiana/133/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395958A/swine/Indiana/A00968379/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395950A/swine/Indiana/A00968376/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395934A/swine/Indiana/A00968370/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395921A/swine/Ohio/12TOSU268/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395860A/swine/Ohio/12TOSU464/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395852A/swine/Ohio/12TOSU467/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395742A/swine/Indiana/A00968386/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395330A/West Virginia/06/2011 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395327A/West Virginia/06/2011 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395250A/Indiana/152/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI394936A/Ohio/75/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI394932A/Wisconsin/23/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI394920A/Ohio/69/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI394912A/Indiana/132/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI394905A/Ohio/62/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393696A/Indiana/20/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393687A/Ohio/23/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393666A/Ohio/28/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393510A/Ohio/52/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393294A/Ohio/24/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392677A/Ohio/13/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI388365A/Ohio/17/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI388345A/Indiana/15/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI388338A/Ohio/16/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI388329A/Ohio/20/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI388320A/Ohio/18/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI388318A/Ohio/20/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI388311A/Ohio/15/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI388304A/Ohio/14/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI378522A/Indiana/09/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI378514A/Indiana/07/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393526A/West Virginia/15/2012 (A/H3N2) segment 6 (NA)2508.90.000000e+001390/1406 (98%)
text_code_colored.pngEPI397924A/Ohio/18/2012 (A/H3N2) segment 6 (NA)2507.00.000000e+001392/1410 (98%)
text_code_colored.pngEPI395712A/swine/Indiana/A01104016/2012 (A/H3N2) segment 6 (NA)2507.00.000000e+001392/1410 (98%)
text_code_colored.pngEPI647505A/swine/North Carolina/A02034471/2015 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI590660A/swine/North Carolina/A01841712/2015 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI573808A/swine/North Carolina/A01840322/2015 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI573453A/swine/Iowa/A01555142/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI559528A/swine/North Carolina/A01476560/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI558823A/swine/Indiana/A01476743/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI545817A/swine/North Carolina/A01476354/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001393/1411 (98%)
text_code_colored.pngEPI530300A/swine/Illinois/A01410453/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI530285A/swine/Illinois/A01475190/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI510212A/swine/Illinois/A01409994/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI507285A/swine/Illinois/A01411097/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI505103A/swine/Iowa/A01409518/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI499948A/swine/Iowa/13H087/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI499655A/swine/North Carolina/A01409048/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI493013A/swine/Kansas/A01377090/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI448835A/swine/Kansas/13-105721a/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001393/1411 (98%)
text_code_colored.pngEPI416856A/swine/Tennessee/A01104055/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI414180A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI414029A/swine/Indiana/A01260135/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397561A/Wisconsin/29/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397445A/Wisconsin/31/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397439A/Wisconsin/30/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397411A/Michigan/16/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397387A/Indiana/49/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397214A/Pennsylvania/17/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397212A/Indiana/115/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397124A/Pennsylvania/11/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396245A/Indiana/125/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396229A/Indiana/147/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396222A/Indiana/57/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395942A/swine/Indiana/A00968373/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395929A/swine/Ohio/12TOSU293/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395893A/swine/Ohio/12TOSU420/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395269A/Pennsylvania/11/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI394076A/Wisconsin/27/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI394068A/Pennsylvania/11/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%) 

Share this post


Link to post
Share on other sites
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI499985A/swine/North Carolina/A01394918/2013 (A/H1N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI499701A/swine/North Carolina/A01290729/2013 (A/H1N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI487964A/swine/North Carolina/A01290565/2013 (A/H0) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI502663A/swine/Illinois/A01290887/2013 (A/H1N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI487213A/swine/North Carolina/A01290534/2013 (A/H1N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI531049A/swine/North Carolina/A01410511/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI509545A/swine/North Carolina/A01410024/2013 (A/H0) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI509540A/swine/North Carolina/A01290805/2013 (A/H0) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI509529A/swine/North Carolina/A01290797/2013 (A/H0) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI507277A/swine/North Carolina/A01409655/2014 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492430A/swine/North Carolina/A01290458/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492403A/swine/North Carolina/A01290462/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI476512A/swine/North Carolina/A01290349/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI451188A/swine/North Carolina/A01432634/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI502715A/swine/North Carolina/A01290800/2013 (A/H1N2) segment 7 (MP)1783.10.000000e+00976/982 (99%)
text_code_colored.pngEPI623628A/swine/North Carolina/A02024129/2015 (A/H3N2) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI531067A/swine/North Carolina/A01410520/2014 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI531058A/swine/North Carolina/A01410535/2014 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI531052A/swine/North Carolina/A01410554/2014 (A/H0) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI531046A/swine/North Carolina/A01475277/2014 (A/H3N2) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI531010A/swine/North Carolina/A01410555/2014 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI510222A/swine/North Carolina/A01409981/2014 (A/H3N2) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI510180A/swine/North Carolina/A01410205/2014 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI505101A/swine/North Carolina/A01290956/2013 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI499665A/swine/North Carolina/A01290725/2013 (A/H1N2) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI499656A/swine/North Carolina/A01409048/2013 (A/H3N2) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI492427A/swine/North Carolina/A01290473/2013 (A/H1N2) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI492393A/swine/North Carolina/A01290447/2013 (A/H3N2) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI531073A/swine/North Carolina/A01475272/2014 (A/H1N1) segment 7 (MP)1777.60.000000e+00975/982 (99%)
text_code_colored.pngEPI568694A/swine/North Carolina/A01840322/2015 (A/H3N2) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI530295A/swine/North Carolina/A01410422/2014 (A/H1N1) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI508851A/swine/North Carolina/A01410136/2014 (A/H3N2) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI499637A/swine/North Carolina/A01290636/2013 (A/H1N2) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI467465A/swine/North Carolina/A01432952/2013 (A/H1N2) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI459659A/swine/Pennsylvania/A01380412/2013 (A/H3N2) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI542513A/swine/North Carolina/A01476095/2014 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI532396A/swine/North Carolina/A01410625/2014 (A/H1N2) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI531079A/swine/North Carolina/A01410533/2014 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI531007A/swine/North Carolina/A01475257/2014 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI531001A/swine/North Carolina/A01475256/2014 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI530317A/swine/North Carolina/A01410329/2014 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI510231A/swine/North Carolina/A01409950/2014 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI508877A/swine/North Carolina/A01410180/2014 (A/H3N2) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI504902A/swine/Illinois/A01411204/2013 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI502700A/swine/North Carolina/A01290857/2013 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI502651A/swine/North Carolina/A01290856/2013 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI489709A/swine/South Carolina/A01394262/2013 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI487968A/swine/North Carolina/A01291004/2013 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI463707A/swine/North Carolina/A01432766/2013 (A/H1N2) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI647515A/swine/North Carolina/A02034477/2015 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI645054A/swine/Illinois/A02090072/2015 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI641468A/swine/Illinois/A01820879/2015 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI621368A/swine/Illinois/A01820513/2015 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI615355A/swine/Illinois/A01820485/2015 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI600454A/swine/North Carolina/A01476924/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI600427A/swine/North Carolina/A01476896/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI600358A/swine/North Carolina/A01476968/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI600352A/swine/North Carolina/A01476902/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI597648A/swine/North Carolina/A01478870/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI586022A/swine/North Carolina/A01555546/2015 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI559565A/swine/North Carolina/A01476557/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI559559A/swine/North Carolina/A01478107/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI558830A/swine/North Carolina/A01476722/2014 (A/H3N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI557793A/swine/North Carolina/A01476778/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI557792A/swine/North Carolina/A01476736/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI557791A/swine/North Carolina/A01476738/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI557789A/swine/North Carolina/A01476775/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI545821A/swine/North Carolina/A01476359/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI532369A/swine/North Carolina/A01410640/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI492963A/swine/Minnesota/A01394248/2013 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI492380A/swine/Minnesota/A01392079/2013 (A/H3N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI489727A/swine/Minnesota/A01394021/2013 (A/H3N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI441498A/swine/Ohio/A01349140/2013 (A/H1N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI438228A/swine/Indiana/A01260209/2013 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI433271A/swine/Ohio/A01280357/2013 (A/H1N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI426874A/swine/Ohio/A01280112/2013 (A/H1N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI414110A/swine/Ohio/A01279763/2012 (A/H1N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI414104A/swine/Ohio/A01279737/2012 (A/H1N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI414053A/swine/Ohio/A01279640/2012 (A/H1N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI414050A/swine/Ohio/A01279687/2012 (A/H1N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI414038A/swine/Ohio/A01279522/2012 (A/H1N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI408198A/swine/Indiana/A01260048/2012 (A/H3N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI407026A/swine/Ohio/A01279011/2012 (A/H1N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI406535A/swine/Ohio/A01267959/2012 (A/H1N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI398690A/swine/North Carolina/A01270266/2012 (A/H1N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI395329A/West Virginia/06/2011 (A/H3N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI395324A/West Virginia/06/2011 (A/H3N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI391475A/swine/Ohio/A01203186/2012 (A/H3N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI391470A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI542522A/swine/North Carolina/A01477162/2014 (A/H0) segment 7 (MP)1761.00.000000e+00972/982 (98%)
text_code_colored.pngEPI672971A/swine/North Carolina/A01945307/2015 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI672959A/swine/North Carolina/A01945329/2015 (A/H1N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI672860A/swine/Illinois/A02090702/2015 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI669147A/swine/North Carolina/A01770469/2015 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI663354A/swine/North Carolina/A02025520/2015 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI663315A/swine/North Carolina/A01770059/2015 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI653881A/swine/North Carolina/A02025523/2015 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI647586A/swine/North Carolina/A02025402/2015 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI612564A/swine/North Carolina/A01554473/2015 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI597672A/swine/North Carolina/A01476862/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI597645A/swine/North Carolina/A01476810/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI586055A/swine/North Carolina/A01555549/2015 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI584851A/swine/Nebraska/A01489870/2014 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI584830A/swine/Nebraska/A01489868/2014 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI584810A/swine/North Carolina/A01841335/2015 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI573008A/swine/North Carolina/A01840074/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI568715A/swine/North Carolina/A01555137/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI559598A/swine/North Carolina/A01477720/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI559589A/swine/North Carolina/A01476564/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI546902A/swine/Indiana/13TOSU1982/2013 (A/H0) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI545845A/swine/North Carolina/A01476462/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI542516A/swine/North Carolina/A01411902/2014 (A/H0) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI539063A/swine/Nebraska/A01501767/2014 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI532390A/swine/Illinois/A01411761/2014 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI526872A/swine/Minnesota/A01480518/2014 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI505095A/swine/Nebraska/A01409647/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI501539A/swine/South Dakota/A01366063/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI492657A/swine/Nebraska/A01394342/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI492409A/swine/North Carolina/A01290442/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI492351A/swine/Indiana/A00968364/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI487944A/swine/Minnesota/A01394278/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI485857A/swine/Michigan/A01259075/2013 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI467890A/swine/Nebraska/A01397576/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI464431A/swine/Ohio/A01351184/2013 (A/H1N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI451230A/swine/Ohio/A01208181/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI449017A/swine/Wyoming/A01379346/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI446881A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI446873A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI446857A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI446832A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI446824A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI446733A/swine/Ohio/A01349572/2013 (A/H1N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI433321A/swine/Wyoming/A01444560/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI427146A/swine/Maryland/A01444460/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI427131A/swine/Wyoming/A01444562/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI414181A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI407274A/Minnesota/18/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI406513A/swine/Iowa/A01432069/2012 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI401715A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI401659A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI401625A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI401615A/swine/Minnesota/A01301908/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI399378A/swine/North Carolina/A01300819/2012 (A/H1N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI398545A/swine/Ohio/A00152576/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI398537A/swine/Ohio/A01208457/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI398122A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI397957A/Ohio/88/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI397943A/Ohio/84/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI397902A/Hawaii/03/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI397551A/Ohio/86/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI397535A/Ohio/56/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI397435A/Wisconsin/30/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI397421A/Minnesota/15/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI396197A/Ohio/79/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI396187A/Ohio/77/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI396172A/Ohio/80/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI395930A/swine/Ohio/12TOSU293/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI395877A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI395869A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI395845A/mink/Wisconsin/31512-7/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI395354A/Pennsylvania/17/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI395340A/Wisconsin/28/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI395268A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI394928A/Wisconsin/23/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI393916A/swine/Indiana/A00968380/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI393699A/Ohio/64/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI391459A/swine/Wisconsin/A01203142/2012 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI390675A/swine/Indiana/A01243254/2012 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI383548A/swine/Iowa/A01203503/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI347602A/Iowa/07/2011 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI346435A/Iowa/08/2011 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI346427A/Iowa/07/2011 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI346419A/Iowa/09/2011 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI341736A/swine/Iowa/A01049970/2011 (A/H1N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI394067A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP)1757.30.000000e+00971/981 (98%)
text_code_colored.pngEPI502568A/swine/Nebraska/A01395675/2013 (A/H3N2) segment 7 (MP)1755.40.000000e+00971/982 (98%)
text_code_colored.pngEPI673003A/swine/North Carolina/120138/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI669232A/swine/North Carolina/A02025765/2015 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI653895A/swine/North Carolina/A02034953/2015 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI612561A/swine/North Carolina/A02076144/2015 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI600424A/swine/North Carolina/A01476920/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI598966A/swine/North Carolina/A01476757/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI598963A/swine/North Carolina/A01477737/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI596341A/swine/North Carolina/A01841556/2015 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI596335A/swine/North Carolina/A01841555/2015 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI593903A/swine/North Carolina/A01840366/2015 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI586129A/swine/North Carolina/A01555663/2015 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI573798A/swine/North Carolina/A01840320/2015 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI568716A/swine/North Carolina/A01555212/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI568693A/swine/North Carolina/A01840329/2015 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI560137A/swine/Nebraska/A01565950/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI558833A/swine/North Carolina/A01476714/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI557795A/swine/North Carolina/A01477770/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI550295A/swine/Iowa/A01410971/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI550280A/swine/Indiana/13TOSU4382/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI550224A/swine/Indiana/13TOSU4561/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI550215A/swine/Indiana/13TOSU4293/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI550173A/swine/Indiana/13TOSU1999/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI550138A/swine/Texas/13TOSU0060/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI550117A/swine/Indiana/13TOSU4284/2013 (A/H0) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI550103A/swine/Indiana/13TOSU4563/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI550082A/swine/Ohio/13TOSU0726/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI550068A/swine/Indiana/13TOSU5669/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI550061A/swine/Indiana/13TOSU5238/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI549963A/swine/Indiana/13TOSU5869/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI548246A/swine/North Carolina/A01476535/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI547388A/swine/Indiana/13TOSU1991/2013 (A/H0) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI545842A/swine/North Carolina/A01476427/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI542550A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI542544A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI538919A/swine/Iowa/A01501685/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI538666A/swine/Iowa/A01410752/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI534949A/swine/Iowa/A01501048/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI533784A/swine/North Carolina/A01410800/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI532375A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI531013A/swine/North Carolina/A01475255/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI530998A/swine/Iowa/A01410600/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI528475A/swine/Ohio/13TOSU0410/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI528427A/swine/Indiana/13TOSU1042/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI527868A/swine/Indiana/13TOSU1050/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI527099A/swine/Indiana/13TOSU1319/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI527088A/swine/Ohio/13TOSU0411/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI526885A/swine/Indiana/13TOSU1043/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI509787A/swine/Indiana/A01260445/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI509784A/swine/Indiana/A01260443/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI509775A/swine/Indiana/A01260426/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI509759A/swine/Minnesota/A01366992/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI507295A/swine/Illinois/A00843193/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI505083A/swine/Illinois/A01409611/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI505070A/swine/Illinois/A01411232/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI505038A/swine/Illinois/A01409717/2014 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI502690A/swine/North Carolina/A01290799/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI502385A/swine/Illinois/A01427136/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI499988A/swine/Nebraska/A01394567/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI499890A/swine/Indiana/A01260398/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI492390A/swine/Iowa/A01290438/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI492377A/swine/Iowa/A01399987/2013 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI487955A/swine/Indiana/A01260366/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI485991A/swine/Indiana/13TOSU1128/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI485983A/swine/Indiana/13TOSU1122/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI484455A/swine/North Carolina/A01291329/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI482815A/Indiana/21/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI482812A/Indiana/11/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI476669A/swine/Michigan/A01259074/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI476530A/swine/Illinois/A01398587/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI472212A/swine/Indiana/A01260313/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI472197A/swine/Iowa/A01432817/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI472194A/swine/Iowa/A01432826/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI468209A/swine/Indiana/13TOSU490/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI468201A/swine/Indiana/13TOSU482/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)

Share this post


Link to post
Share on other sites
LOCUS       KU160699                1701 bp    cRNA    linear   VRL 13-DEC-2015
DEFINITION  Influenza A virus (A/swine/North Carolina/A01944727/2015(mixed))
            clone H3 segment 4 hemagglutinin (HA) gene, complete cds.
ACCESSION   KU160699
VERSION     KU160699.1  GI:960314548
KEYWORDS    .
SOURCE      Influenza A virus (A/swine/North Carolina/A01944727/2015(mixed))
  ORGANISM  Influenza A virus (A/swine/North Carolina/A01944727/2015(mixed))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1701)
  AUTHORS   Lin,K., Huang,H. and Zhang,J.
  CONSRTM   USDA SIV Survelliance
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) National Veterinary Services Laboratory,
            USDA, 1920 Dayton, Ames, IA 50010, USA
FEATURES             Location/Qualifiers
     source          1..1701
                     /organism="Influenza A virus (A/swine/North
                     Carolina/A01944727/2015(mixed))"
                     /mol_type="viral cRNA"
                     /strain="A/swine/North Carolina/A01944727/2015"
                     /serotype="mixed"
                     /isolation_source="nasal swab"
                     /host="swine"
                     /db_xref="taxon:1757152"
                     /segment="4"
                     /clone="H3"
                     /country="USA: North Carolina"
                     /collection_date="16-Oct-2015"
                     /note="mixed infection: H1H3,N1N2"
     gene            1..1701
                     /gene="HA"
     CDS             1..1701
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="ALR83344.1"
                     /db_xref="GI:960314549"
                     /translation="MKTIIAFSCILCLIFAQKLPGSDNSMATLCLGHHAVPNGTLVKT
                     ITDDQIEVTNATELVQSSSTGRICNSPHQILDGKNCTLIDALLGDPHCDDFQNKKWDL
                     FVERSTAYSNCYPYYVPDYATLRSLIASSGNLEFTQESFNWTGVAQDGSSYACRRGSV
                     KSFFSRLNWLYNLNYKYPEQNVTMPNNDKFDKLYIWGVHHPGTDKDQTNLYVQASGRV
                     IVSTKRSQQTVIPNIGSRPWVRGVSSIISIYWTIVKPGDILLINSTGNLIAPRGYFKI
                     QSGKSSIMRSDAHIDECNSECITPNGSIPNDKPFQNVNKITYGACPRYVKQNTLKLAT
                     GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAIDQ
                     ITGKLNRVIKKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
                     HTLDLTDSEMSKLFERTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDIYR
                     NEALNNRFQIKGVQLKSGYKDWILWISFAISCFLLCVVLLGFIMWACQKGNIRCNICI
                     "
     sig_peptide     1..48
                     /gene="HA"
     mat_peptide     49..1035
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1036..1698
                     /gene="HA"
                     /product="HA2"
     misc_feature    1..1701
                     /db_xref="IRD:IRD-A01944727.4a"
ORIGIN      
        1 atgaagacta tcattgcttt tagctgcatt ctatgtctga tttttgctca aaaacttccc
       61 ggaagtgaca acagcatggc aacgctgtgc ctaggacacc acgcagtgcc aaacggaaca
      121 ttagtgaaaa caatcacgga tgaccaaatt gaagtgacta atgctactga gctggtccag
      181 agttcctcaa caggtagaat atgcaacagt cctcaccaaa tccttgatgg gaaaaattgc
      241 acactgatag atgctttatt gggggaccct cattgtgatg acttccaaaa caagaaatgg
      301 gacctttttg ttgaacgaag cacagcctac agcaactgtt acccttatta tgtgccagat
      361 tatgctaccc ttaggtcact aattgcctca tctggcaacc tggaatttac ccaagaaagc
      421 ttcaattgga ctggtgttgc tcaagacgga tcaagctatg cctgcagaag gggttctgtt
      481 aaaagtttct ttagtagatt aaattggttg tataacttga attacaagta tccagaacag
      541 aacgtaacta tgccaaacaa tgacaaattt gacaaattat acatttgggg ggttcaccac
      601 ccgggtacgg acaaagacca aaccaaccta tatgtccaag catcagggag ggttatagtc
      661 tcaaccaaaa gaagccaaca aactgtaatc ccgaatatcg ggtctagacc ctgggtgagg
      721 ggtgtctcca gcataataag catctattgg acgatagtaa aaccaggaga catacttttg
      781 attaacagca cagggaatct aattgcccct cggggttact tcaaaataca aagtgggaaa
      841 agctcaataa tgagatcaga tgcacacatt gatgaatgca attctgaatg cattactcca
      901 aatggaagca ttcccaatga caaacctttt caaaatgtaa acaagatcac atatggagcc
      961 tgtcccagat atgttaagca aaacaccctg aaattggcaa caggaatgcg gaatgtacca
     1021 gagaagcaaa ctagaggcat attcggcgca attgcaggtt tcatagaaaa tggttgggag
     1081 ggaatggtag acggttggta cggtttcagg catcagaatt ctgaaggcac aggacaagca
     1141 gcagatctta aaagcactca agcggcaatc gaccaaatca ccgggaaact aaatagagta
     1201 atcaagaaaa cgaacgagaa atttcatcaa atcgaaaaag aattctcaga agtagaaggg
     1261 agaattcagg acctagagaa atacgttgaa gacactaaaa tagatctctg gtcttacaac
     1321 gctgagcttc ttgttgccct ggagaaccaa catacacttg atttaaccga ctcagagatg
     1381 agcaaactgt tcgaaagaac aagaaggcaa ctgcgggaaa atgctgagga catgggcaat
     1441 ggttgcttca aaatatacca caaatgtgac aacgcctgca taggatcaat cagaaatgga
     1501 acttatgacc atgatatata cagaaacgag gcattaaaca atcggttcca gatcaaaggt
     1561 gttcagctaa agtcaggata caaagattgg atcctatgga tttcctttgc catatcatgc
     1621 tttttgcttt gtgttgttct gctgggtttc attatgtggg cctgccaaaa aggcaacatt
     1681 aggtgcaaca tttgcattta a

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI573818A/swine/North Carolina/A01555273/2015 (A/H3N2) segment 4 (HA)3125.70.000000e+001698/1701 (99%)
text_code_colored.pngEPI600431A/swine/North Carolina/A01476974/2014 (A/H3N2) segment 4 (HA)3105.30.000000e+001694/1701 (99%)
text_code_colored.pngEPI669135A/swine/North Carolina/A02025687/2015 (A/H0) segment 4 (HA)3099.80.000000e+001693/1701 (99%)
text_code_colored.pngEPI573011A/swine/Arkansas/A01555090/2014 (A/H3N2) segment 4 (HA)3099.80.000000e+001693/1701 (99%)
text_code_colored.pngEPI542524A/swine/North Carolina/A01477142/2014 (A/H3N2) segment 4 (HA)3083.20.000000e+001690/1701 (99%)
text_code_colored.pngEPI532373A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 4 (HA)3081.30.000000e+001690/1701 (99%)
text_code_colored.pngEPI573807A/swine/North Carolina/A01840322/2015 (A/H3N2) segment 4 (HA)3077.60.000000e+001689/1701 (99%)
text_code_colored.pngEPI542551A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI542447A/swine/North Carolina/A01476196/2014 (A/H3N2) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI623626A/swine/North Carolina/A02024129/2015 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI574154A/Kansas/A01377457/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI531059A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI597655A/swine/North Carolina/A01476848/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001688/1702 (99%)
text_code_colored.pngEPI572994A/swine/North Carolina/A01840071/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI545416A/swine/North Carolina/A01478000/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI534947A/swine/Iowa/A01501048/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI532376A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI538664A/swine/Iowa/A01410752/2014 (A/H3N2) segment 4 (HA)3061.00.000000e+001686/1701 (99%)
text_code_colored.pngEPI533782A/swine/North Carolina/A01410800/2014 (A/H3N2) segment 4 (HA)3061.00.000000e+001686/1701 (99%)
text_code_colored.pngEPI559548A/swine/North Carolina/A01476688/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI558883A/swine/North Carolina/A01476771/2014 (A/H0) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI558842A/swine/North Carolina/A01477778/2014 (A/H0) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI558839A/swine/North Carolina/A01478182/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI558834A/swine/North Carolina/A01476730/2014 (A/H0) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI558819A/swine/North Carolina/A01476734/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI550293A/swine/Iowa/A01410971/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI530996A/swine/Iowa/A01410600/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI542548A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 4 (HA)3055.50.000000e+001685/1701 (99%)
text_code_colored.pngEPI586151A/swine/North Carolina/A01555667/2015 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI559025A/swine/North Carolina/A01566286/2014 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI545858A/swine/North Carolina/A01476419/2014 (A/H0) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI545840A/swine/North Carolina/A01476427/2014 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI545816A/swine/North Carolina/A01476354/2014 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI545379A/swine/Iowa/A01476223/2014 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI538670A/swine/Oklahoma/A01475757/2014 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI597661A/swine/North Carolina/A01476883/2014 (A/H3N2) segment 4 (HA)3049.90.000000e+001684/1701 (99%)
text_code_colored.pngEPI573035A/swine/North Carolina/A01555111/2014 (A/H3N2) segment 4 (HA)3049.90.000000e+001684/1701 (99%)
text_code_colored.pngEPI593956A/swine/Minnesota/A01489046/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI584808A/swine/North Carolina/A01841335/2015 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI573793A/swine/North Carolina/A01840289/2015 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI573479A/swine/North Carolina/A01840158/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI573350A/swine/Minnesota/A01567013/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI550296A/swine/Iowa/A01410995/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI548259A/swine/Iowa/A01476428/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI545407A/swine/Iowa/A01476267/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI542563A/swine/North Carolina/A01476078/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI542542A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI623700A/swine/Indiana/A01260863/2015 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI600344A/swine/North Carolina/A01476954/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI573020A/swine/North Carolina/A01840022/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI559533A/swine/North Carolina/A01476698/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI559530A/swine/North Carolina/A01476719/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI545813A/swine/North Carolina/A01476367/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI542474A/swine/Kansas/018050-1/2014 (A/H3N2) segment 4 (HA)3040.70.000000e+001680/1698 (98%)
text_code_colored.pngEPI620523A/swine/Iowa/A02076873/2015 (A/H3N2) segment 4 (HA)3038.90.000000e+001682/1701 (98%)
text_code_colored.pngEPI600449A/swine/North Carolina/A01477954/2014 (A/H3N2) segment 4 (HA)3038.90.000000e+001682/1701 (98%)
text_code_colored.pngEPI669209A/swine/North Carolina/A01857100/2015 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI623703A/swine/Indiana/A01260882/2015 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI620514A/swine/Iowa/A02076659/2015 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI598964A/swine/North Carolina/A01476757/2014 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI573452A/swine/Iowa/A01555142/2014 (A/H3N2) segment 4 (HA)3033.30.000000e+001681/1701 (98%)
text_code_colored.pngEPI672951A/swine/North Carolina/A01945243/2015 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI620526A/swine/Iowa/A02077538/2015 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI557544A/Wisconsin/24/2014 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI557542A/Wisconsin/24/2014 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI542530A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI623651A/swine/Illinois/A02076874/2015 (A/H3N2) segment 4 (HA)3029.60.000000e+001680/1701 (98%)
text_code_colored.pngEPI558851A/swine/Minnesota/A01477780/2014 (A/H3N2) segment 4 (HA)3029.60.000000e+001679/1699 (98%)
text_code_colored.pngEPI669224A/swine/North Carolina/A01857097/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI620490A/swine/North Carolina/A02077505/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI612571A/swine/North Carolina/A02076180/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI573599A/swine/Indiana/A01840253/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI573017A/swine/Ohio/A01840053/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI573003A/swine/Arkansas/A01555074/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI557534A/Wisconsin/24/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI510214A/swine/Illinois/A01475015/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI510211A/swine/Illinois/A01409994/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI510199A/swine/Illinois/A01410268/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI510190A/swine/Illinois/A01411463/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI510173A/swine/Illinois/A01411461/2014 (A/H0) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI507284A/swine/Illinois/A01411097/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI505102A/swine/Iowa/A01409518/2013 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI504864A/swine/Illinois/A01411096/2013 (A/H0) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI460390A/swine/Indiana/A01260254/2013 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI647569A/swine/North Carolina/A02035784/2015 (A/H3N2) segment 4 (HA)3024.10.000000e+001679/1701 (98%)
text_code_colored.pngEPI600347A/swine/North Carolina/A01476949/2014 (A/H3N2) segment 4 (HA)3024.10.000000e+001679/1701 (98%)
text_code_colored.pngEPI590659A/swine/North Carolina/A01841712/2015 (A/H3N2) segment 4 (HA)3024.10.000000e+001680/1702 (98%)
text_code_colored.pngEPI600470A/swine/Arkansas/A01476939/2014 (A/H3N2) segment 4 (HA)3022.20.000000e+001679/1701 (98%)
text_code_colored.pngEPI672887A/swine/North Carolina/A01945112/2015 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI669154A/swine/North Carolina/A02025678/2015 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI663380A/swine/North Carolina/A02025575/2015 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI663334A/swine/North Carolina/A01770073/2015 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI647584A/swine/North Carolina/A02025402/2015 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI573495A/swine/Indiana/A01840133/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI573486A/swine/Arkansas/A01555162/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI573448A/swine/Indiana/A01840146/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI545852A/swine/Iowa/A01476426/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI538990A/swine/Michigan/A01410962/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI530299A/swine/Illinois/A01410453/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI530284A/swine/Illinois/A01475190/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI508836A/swine/Illinois/A01409932/2014 (A/H0) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI460381A/swine/Indiana/A01260284/2013 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI573445A/swine/Arkansas/A01840147/2014 (A/H3N2) segment 4 (HA)3016.70.000000e+001678/1701 (98%)
text_code_colored.pngEPI508858A/swine/Illinois/A01410110/2014 (A/H3N2) segment 4 (HA)3016.70.000000e+001678/1701 (98%)
text_code_colored.pngEPI669236A/swine/North Carolina/A01857103/2015 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI663367A/swine/North Carolina/A01769650/2015 (A/H0) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI530309A/swine/North Carolina/A01410529/2014 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI505062A/swine/Illinois/A01409657/2014 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI460387A/swine/Indiana/A01260252/2013 (A/H3N2) segment 4 (HA)3014.90.000000e+001679/1702 (98%)
text_code_colored.pngEPI460372A/swine/Indiana/A01260276/2013 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI573602A/swine/Indiana/A01840254/2014 (A/H3N2) segment 4 (HA)3013.00.000000e+001677/1701 (98%)
text_code_colored.pngEPI573000A/swine/Arkansas/A01840096/2014 (A/H3N2) segment 4 (HA)3013.00.000000e+001677/1701 (98%)
text_code_colored.pngEPI663313A/swine/North Carolina/A01770059/2015 (A/H3N2) segment 4 (HA)3011.20.000000e+001677/1701 (98%)
text_code_colored.pngEPI669247A/swine/North Carolina/A02025897/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI669178A/swine/Indiana/A01260958/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI653893A/swine/North Carolina/A02034953/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI647504A/swine/North Carolina/A02034471/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI586038A/swine/Illinois/A01555570/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI584802A/swine/Indiana/A01841389/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI531097A/swine/Minnesota/A01493481/2014 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI505039A/swine/Illinois/A01410018/2013 (A/H0) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI573714A/swine/Kansas/14-032477/2014 (A/H3N2) segment 4 (HA)3005.60.000000e+001676/1701 (98%)
text_code_colored.pngEPI584734A/swine/Illinois/A01555638/2015 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI398672A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI391413A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI391404A/swine/Ohio/A01203186/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI366030A/Utah/10/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI642513A/Michigan/39/2015 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI558822A/swine/Indiana/A01476743/2014 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI509764A/swine/Indiana/A01260416/2013 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI493012A/swine/Kansas/A01377090/2013 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI453427A/swine/Korea/D79/2011 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI426890A/swine/Indiana/A01432300/2013 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI408199A/swine/Indiana/A01260093/2012 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI396270A/Indiana/133/2012 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI394913A/Indiana/132/2012 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI388332A/Utah/10/2012 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI388327A/Indiana/14/2012 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI342603A/swine/NY/A01104005/2011 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI671792A/swine/Illinois/A01857433/2015 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI559527A/swine/North Carolina/A01476560/2014 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI645058A/swine/Indiana/A01260926/2015 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI573566A/swine/Minnesota/A01469329/2014 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI573051A/swine/Iowa/A01840061/2014 (A/H3N2) segment 4 (HA)2989.00.000000e+001673/1701 (98%)
text_code_colored.pngEPI528431A/swine/Ohio/13TOSU1547/2013 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI527870A/swine/Ohio/13TOSU2043/2013 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI527113A/swine/Ohio/13TOSU2052/2013 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI453426A/swine/Korea/A18/2011 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI451202A/swine/Alabama/A01104056/2012 (A/H0) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI446888A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI446879A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI446800A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI443550A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI426887A/swine/Iowa/A01432271/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI414186A/swine/Indiana/A00968394/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI414170A/swine/Indiana/A00968398/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI408202A/swine/Indiana/A01260099/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI406576A/swine/Iowa/A01203863/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI406504A/swine/Iowa/A01267939/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI404890A/Iowa/16/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI401609A/swine/Ohio/A00138552/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397913A/Indiana/123/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397906A/Illinois/11/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397905A/Hawaii/03/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397662A/Maryland/28/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397396A/Indiana/93/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397210A/Maryland/25/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397006A/Ohio/78/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI396262A/Indiana/127/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI396254A/Indiana/126/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI395883A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI395259A/Ohio/35/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI394944A/Maryland/22/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI393306A/Indiana/18/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI392926A/Maryland/20/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI388352A/Indiana/20/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI388346A/Indiana/15/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI388298A/Indiana/19/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI388282A/Indiana/13/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI383528A/swine/Indiana/A01203509/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI381873A/Hawaii/03/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI351662A/swine/Iowa/A01202659/2011 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI346493A/West Virginia/06/2011 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI339171A/Maine/06/2011 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI573439A/swine/Missouri/A01555163/2014 (A/H3N2) segment 4 (HA)2987.20.000000e+001673/1701 (98%)
text_code_colored.pngEPI398492A/swine/Maryland/A01104048/2012 (A/H3N2) segment 4 (HA)2985.30.000000e+001671/1699 (98%)
text_code_colored.pngEPI395328A/West Virginia/06/2011 (A/H3N2) segment 4 (HA)2985.30.000000e+001671/1699 (98%)
text_code_colored.pngEPI653868A/swine/Illinois/A00857134/2011 (A/H0) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI653857A/swine/Illinois/A00857131/2011 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI653774A/swine/Illinois/A00857129/2011 (A/H0) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI492349A/swine/Indiana/A00968364/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI446927A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI446919A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI446863A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI446830A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI443558A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI443526A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI433540A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI433533A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI433306A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI433298A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI424073A/swine/Michigan/A01259003/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI414178A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI406530A/swine/Illinois/A01432127/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI401702A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI401684A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI401680A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI401667A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI400105A/swine/Indiana/A00968308/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398542A/swine/Ohio/A00152576/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398534A/swine/Ohio/A01208457/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398526A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398518A/swine/Ohio/A01133464/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398500A/swine/Ohio/A01133466/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398479A/swine/Maryland/A01104040/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397969A/Wisconsin/34/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397962A/Wisconsin/30/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397954A/Ohio/85/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397939A/Ohio/41/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397548A/Ohio/84/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397540A/Ohio/56/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397532A/Ohio/47/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397524A/Ohio/44/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397516A/Ohio/36/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397503A/Indiana/104/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397446A/Wisconsin/31/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397432A/Ohio/81/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397426A/Minnesota/15/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397385A/Indiana/138/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397351A/Ohio/37/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397340A/Indiana/150/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397089A/Indiana/52/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396299A/Maryland/23/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396280A/Indiana/144/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396208A/Indiana/149/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396192A/Ohio/77/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396183A/Indiana/77/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396175A/Ohio/80/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395874A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395866A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395718A/swine/Indiana/A01104023/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395711A/swine/Indiana/A01104016/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395357A/Pennsylvania/17/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395344A/Wisconsin/28/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395270A/Pennsylvania/11/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395267A/Ohio/65/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI394937A/Ohio/75/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI394933A/Wisconsin/23/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI394921A/Ohio/69/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI394077A/Wisconsin/27/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)

Share this post


Link to post
Share on other sites
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI600432A/swine/North Carolina/A01476974/2014 (A/H3N2) segment 6 (NA)2582.70.000000e+001406/1410 (99%)
text_code_colored.pngEPI573819A/swine/North Carolina/A01555273/2015 (A/H3N2) segment 6 (NA)2579.00.000000e+001405/1410 (99%)
text_code_colored.pngEPI573012A/swine/Arkansas/A01555090/2014 (A/H3N2) segment 6 (NA)2571.70.000000e+001404/1410 (99%)
text_code_colored.pngEPI542525A/swine/North Carolina/A01477142/2014 (A/H3N2) segment 6 (NA)2560.60.000000e+001402/1410 (99%)
text_code_colored.pngEPI669136A/swine/North Carolina/A02025687/2015 (A/H0) segment 6 (NA)2542.10.000000e+001398/1410 (99%)
text_code_colored.pngEPI532374A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 6 (NA)2534.70.000000e+001397/1410 (99%)
text_code_colored.pngEPI574155A/Kansas/A01377457/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI531060A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI533783A/swine/North Carolina/A01410800/2014 (A/H3N2) segment 6 (NA)2529.20.000000e+001396/1410 (99%)
text_code_colored.pngEPI532377A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 6 (NA)2529.20.000000e+001396/1410 (99%)
text_code_colored.pngEPI573351A/swine/Minnesota/A01567013/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI545408A/swine/Iowa/A01476267/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI545380A/swine/Iowa/A01476223/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI542531A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI538665A/swine/Iowa/A01410752/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI534948A/swine/Iowa/A01501048/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI530997A/swine/Iowa/A01410600/2014 (A/H3N2) segment 6 (NA)2523.60.000000e+001395/1410 (98%)
text_code_colored.pngEPI600348A/swine/North Carolina/A01476949/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI573808A/swine/North Carolina/A01840322/2015 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI573480A/swine/North Carolina/A01840158/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI559534A/swine/North Carolina/A01476698/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI558882A/swine/North Carolina/A01476771/2014 (A/H0) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI558852A/swine/Minnesota/A01477780/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI558843A/swine/North Carolina/A01477778/2014 (A/H0) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI550294A/swine/Iowa/A01410971/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI542448A/swine/North Carolina/A01476196/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI647585A/swine/North Carolina/A02025402/2015 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI598965A/swine/North Carolina/A01476757/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI572995A/swine/North Carolina/A01840071/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI545841A/swine/North Carolina/A01476427/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI542564A/swine/North Carolina/A01476078/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI542552A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI542543A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI538671A/swine/Oklahoma/A01475757/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI533959A/swine/Iowa/A01501046/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI663314A/swine/North Carolina/A01770059/2015 (A/H3N2) segment 6 (NA)2512.60.000000e+001393/1410 (98%)
text_code_colored.pngEPI542549A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 6 (NA)2512.60.000000e+001393/1410 (98%)
text_code_colored.pngEPI647624A/swine/Michigan/A01104086/2015 (A/H0) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI620515A/swine/Iowa/A02076659/2015 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI612572A/swine/North Carolina/A02076180/2015 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI600450A/swine/North Carolina/A01477954/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI573036A/swine/North Carolina/A01555111/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI573021A/swine/North Carolina/A01840022/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI559531A/swine/North Carolina/A01476719/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI559026A/swine/North Carolina/A01566286/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI558840A/swine/North Carolina/A01478182/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI558835A/swine/North Carolina/A01476730/2014 (A/H0) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI558820A/swine/North Carolina/A01476734/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI550297A/swine/Iowa/A01410995/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI548260A/swine/Iowa/A01476428/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI460388A/swine/Indiana/A01260252/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI460382A/swine/Indiana/A01260284/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI460373A/swine/Indiana/A01260276/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI460367A/swine/Indiana/A01260261/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397623A/Indiana/150/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397502A/Indiana/104/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397403A/Indiana/99/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI396207A/Indiana/149/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI396182A/Indiana/77/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI394059A/Indiana/38/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393518A/Indiana/65/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393297A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393291A/Indiana/38/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392752A/Indiana/16/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392698A/Indiana/46/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392695A/Indiana/43/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI593957A/swine/Minnesota/A01489046/2014 (A/H3N2) segment 6 (NA)2507.00.000000e+001392/1410 (98%)
text_code_colored.pngEPI600345A/swine/North Carolina/A01476954/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI584809A/swine/North Carolina/A01841335/2015 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI545817A/swine/North Carolina/A01476354/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001393/1411 (98%)
text_code_colored.pngEPI545417A/swine/North Carolina/A01478000/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001393/1411 (98%)
text_code_colored.pngEPI460391A/swine/Indiana/A01260254/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI446797A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI443547A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI443523A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI433303A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI433295A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI414172A/swine/Indiana/A00968398/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI401685A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI401681A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI400106A/swine/Indiana/A00968308/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI400096A/swine/Indiana/A00968390/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI398520A/swine/Ohio/A01133464/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI398502A/swine/Ohio/A01133466/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI398494A/swine/Maryland/A01104048/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI398486A/swine/Maryland/A01104040/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI398034A/Maryland/22/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397661A/Maryland/28/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397620A/Maryland/25/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397531A/Ohio/47/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397523A/Ohio/44/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397515A/Ohio/36/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397431A/Ohio/81/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397384A/Indiana/138/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397350A/Ohio/37/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397208A/Ohio/78/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397097A/Indiana/103/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397088A/Indiana/52/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396276A/Indiana/135/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396261A/Indiana/127/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396253A/Indiana/126/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396234A/Ohio/34/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395885A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395336A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395266A/Ohio/65/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395258A/Ohio/35/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395250A/Indiana/152/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI394062A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393694A/West Virginia/16/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393680A/West Virginia/10/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393672A/Ohio/71/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393316A/Ohio/38/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393310A/West Virginia/09/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393305A/Indiana/18/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI392704A/Indiana/52/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI392683A/Indiana/13/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI669248A/swine/North Carolina/A02025897/2015 (A/H3N2) segment 6 (NA)2501.50.000000e+001391/1410 (98%)
text_code_colored.pngEPI395712A/swine/Indiana/A01104016/2012 (A/H3N2) segment 6 (NA)2501.50.000000e+001391/1410 (98%)
text_code_colored.pngEPI669155A/swine/North Carolina/A02025678/2015 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI653894A/swine/North Carolina/A02034953/2015 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI573794A/swine/North Carolina/A01840289/2015 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI573453A/swine/Iowa/A01555142/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI559549A/swine/North Carolina/A01476688/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI558823A/swine/Indiana/A01476743/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI545859A/swine/North Carolina/A01476419/2014 (A/H0) segment 6 (NA)2499.60.000000e+001392/1411 (98%)
text_code_colored.pngEPI530300A/swine/Illinois/A01410453/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI530285A/swine/Illinois/A01475190/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI510212A/swine/Illinois/A01409994/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI507285A/swine/Illinois/A01411097/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI505103A/swine/Iowa/A01409518/2013 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI502642A/swine/South Dakota/A01366093/2013 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI446924A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI446916A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI446868A/swine/Ohio/12TOSU411/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI446860A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI446835A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI433542A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI433535A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI416856A/swine/Tennessee/A01104055/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI408203A/swine/Indiana/A01260099/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI406575A/swine/Iowa/A01203863/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI401703A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI401688A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI398671A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI398544A/swine/Ohio/A00152576/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI398536A/swine/Ohio/A01208457/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI397946A/Ohio/84/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI397904A/Hawaii/03/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI397626A/Ohio/57/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI397554A/Ohio/86/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI397425A/Minnesota/15/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI396298A/Maryland/23/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI396191A/Ohio/77/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI395876A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI395868A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI394925A/Illinois/11/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI393701A/Ohio/64/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI392691A/Indiana/31/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI383539A/swine/Indiana/A01203509/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI542475A/swine/Kansas/018050-1/2014 (A/H3N2) segment 6 (NA)2495.90.000000e+001391/1411 (98%)
text_code_colored.pngEPI504865A/swine/Illinois/A01411096/2013 (A/H0) segment 6 (NA)2495.90.000000e+001390/1410 (98%)
text_code_colored.pngEPI672888A/swine/North Carolina/A01945112/2015 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI663381A/swine/North Carolina/A02025575/2015 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI623701A/swine/Indiana/A01260863/2015 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI620491A/swine/North Carolina/A02077505/2015 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI586152A/swine/North Carolina/A01555667/2015 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI573600A/swine/Indiana/A01840253/2014 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI545814A/swine/North Carolina/A01476367/2014 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI542445A/swine/Nebraska/A01476165/2014 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI530310A/swine/North Carolina/A01410529/2014 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI509736A/swine/Iowa/13H075/2013 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI505063A/swine/Illinois/A01409657/2014 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI492350A/swine/Indiana/A00968364/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI446885A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI446876A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI446827A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI443555A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI443539A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI443531A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI443515A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI443507A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI427179A/swine/Indiana/A01260015/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI426886A/swine/Iowa/A01432271/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI414188A/swine/Indiana/A00968394/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI406470A/swine/Indiana/A01260041/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI404892A/Iowa/16/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI401610A/swine/Ohio/A00138552/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI400102A/swine/Indiana/A00968397/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI399293A/swine/Minnesota/A01327922/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI398123A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397931A/Ohio/19/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397918A/Ohio/17/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397750A/Ohio/87/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397627A/Ohio/63/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397625A/Ohio/43/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397624A/Ohio/80/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397621A/Ohio/79/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397547A/Ohio/83/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397539A/Ohio/56/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397395A/Indiana/93/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397377A/Indiana/123/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397363A/Ohio/23/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI396279A/Indiana/144/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI396269A/Indiana/133/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395958A/swine/Indiana/A00968379/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395950A/swine/Indiana/A00968376/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395934A/swine/Indiana/A00968370/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395921A/swine/Ohio/12TOSU268/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395860A/swine/Ohio/12TOSU464/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395852A/swine/Ohio/12TOSU467/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395742A/swine/Indiana/A00968386/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395330A/West Virginia/06/2011 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395327A/West Virginia/06/2011 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI394936A/Ohio/75/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI394932A/Wisconsin/23/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI394920A/Ohio/69/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI394912A/Indiana/132/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI394905A/Ohio/62/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393696A/Indiana/20/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393687A/Ohio/23/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393666A/Ohio/28/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393510A/Ohio/52/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393294A/Ohio/24/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI392677A/Ohio/13/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388365A/Ohio/17/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388345A/Indiana/15/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388338A/Ohio/16/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388329A/Ohio/20/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388320A/Ohio/18/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388318A/Ohio/20/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388311A/Ohio/15/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388304A/Ohio/14/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI383540A/swine/Minnesota/A01203517/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI378522A/Indiana/09/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI378514A/Indiana/07/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393526A/West Virginia/15/2012 (A/H3N2) segment 6 (NA)2492.30.000000e+001387/1406 (98%)
text_code_colored.pngEPI397924A/Ohio/18/2012 (A/H3N2) segment 6 (NA)2490.40.000000e+001389/1410 (98%)
text_code_colored.pngEPI647505A/swine/North Carolina/A02034471/2015 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI620794A/swine/Nebraska/A01847244/2015 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI590761A/swine/Nebraska/A01847145/2015 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI590758A/swine/Nebraska/A01847132/2015 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI590660A/swine/North Carolina/A01841712/2015 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI573810A/swine/Indiana/A01840344/2014 (A/H1N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI559528A/swine/North Carolina/A01476560/2014 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI505043A/swine/Illinois/A01410018/2013 (A/H0) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI499948A/swine/Iowa/13H087/2013 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI499655A/swine/North Carolina/A01409048/2013 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI493013A/swine/Kansas/A01377090/2013 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI448835A/swine/Kansas/13-105721a/2013 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI433281A/swine/Minnesota/A01280462/2013 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)

Share this post


Link to post
Share on other sites

 

AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI600433A/swine/North Carolina/A01476974/2014 (A/H3N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568695A/swine/North Carolina/A01555273/2015 (A/H3N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI542526A/swine/North Carolina/A01477142/2014 (A/H3N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI573013A/swine/Arkansas/A01555090/2014 (A/H3N2) segment 7 (MP)1799.80.000000e+00979/982 (99%)
text_code_colored.pngEPI550295A/swine/Iowa/A01410971/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550280A/swine/Indiana/13TOSU4382/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550224A/swine/Indiana/13TOSU4561/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550215A/swine/Indiana/13TOSU4293/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550173A/swine/Indiana/13TOSU1999/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550138A/swine/Texas/13TOSU0060/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550117A/swine/Indiana/13TOSU4284/2013 (A/H0) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550103A/swine/Indiana/13TOSU4563/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550082A/swine/Ohio/13TOSU0726/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550068A/swine/Indiana/13TOSU5669/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550061A/swine/Indiana/13TOSU5238/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI549963A/swine/Indiana/13TOSU5869/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI547388A/swine/Indiana/13TOSU1991/2013 (A/H0) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI542550A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI542544A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI538919A/swine/Iowa/A01501685/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI538666A/swine/Iowa/A01410752/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI534949A/swine/Iowa/A01501048/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI532375A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI530998A/swine/Iowa/A01410600/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI528475A/swine/Ohio/13TOSU0410/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI528427A/swine/Indiana/13TOSU1042/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI527868A/swine/Indiana/13TOSU1050/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI527099A/swine/Indiana/13TOSU1319/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI527088A/swine/Ohio/13TOSU0411/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI526885A/swine/Indiana/13TOSU1043/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI509787A/swine/Indiana/A01260445/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI509784A/swine/Indiana/A01260443/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI509775A/swine/Indiana/A01260426/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI507295A/swine/Illinois/A00843193/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI505083A/swine/Illinois/A01409611/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI505070A/swine/Illinois/A01411232/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI505038A/swine/Illinois/A01409717/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI502385A/swine/Illinois/A01427136/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI499890A/swine/Indiana/A01260398/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI485991A/swine/Indiana/13TOSU1128/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI485983A/swine/Indiana/13TOSU1122/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI482815A/Indiana/21/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI482812A/Indiana/11/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI476669A/swine/Michigan/A01259074/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI472212A/swine/Indiana/A01260313/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI472197A/swine/Iowa/A01432817/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI468209A/swine/Indiana/13TOSU490/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI468201A/swine/Indiana/13TOSU482/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI465418A/Indiana/17/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI465389A/Indiana/09/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI465386A/Indiana/10/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI465383A/Indiana/07/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI463710A/swine/Illinois/A01432795/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI460975A/swine/Minnesota/A01350866/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI451205A/swine/Alabama/A01104056/2012 (A/H0) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI448836A/swine/Kansas/13-105721a/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI447028A/swine/Iowa/A01432604/2013 (A/H1N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI443110A/swine/Ohio/A01349495/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI443107A/swine/Ohio/A01349485/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI443100A/swine/Ohio/A01349302/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI443097A/swine/Ohio/A01349305/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI441501A/swine/Minnesota/A01349160/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI427186A/swine/Indiana/A01260163/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI426885A/swine/Iowa/A01432271/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI424076A/swine/Michigan/A01259003/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI414154A/swine/Iowa/A01244302/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI406528A/swine/Illinois/A01432127/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI406505A/swine/Iowa/A01267939/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI404893A/Iowa/16/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI499949A/swine/Iowa/13H087/2013 (A/H3N2) segment 7 (MP)1794.20.000000e+00978/982 (99%)
text_code_colored.pngEPI673002A/swine/Minnesota/A01940148/2015 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI672998A/swine/Minnesota/A01940427/2015 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI597657A/swine/North Carolina/A01476848/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI573352A/swine/Minnesota/A01567013/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI572996A/swine/North Carolina/A01840071/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI568725A/swine/North Carolina/A01840158/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI559027A/swine/North Carolina/A01566286/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI550298A/swine/Iowa/A01410995/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI549991A/swine/Indiana/13TOSU5730/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI546902A/swine/Indiana/13TOSU1982/2013 (A/H0) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI545815A/swine/North Carolina/A01476367/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI542565A/swine/North Carolina/A01476078/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI542553A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI542532A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI532378A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI531061A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI531031A/swine/Illinois/A01475266/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI528443A/swine/Ohio/13TOSU2194/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI526923A/swine/Indiana/13TOSU1155/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI509751A/swine/Iowa/13H068/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI509744A/swine/Iowa/13H081/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI509737A/swine/Iowa/13H075/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI509723A/swine/Iowa/13H082/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI505077A/swine/Illinois/A01409675/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI501536A/swine/Minnesota/A01366050/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI499940A/swine/Iowa/13H069/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI499924A/swine/Iowa/13H094/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI493014A/swine/Kansas/A01377090/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI492351A/swine/Indiana/A00968364/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI485857A/swine/Michigan/A01259075/2013 (A/H1N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI472185A/swine/Iowa/A01432840/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI467959A/swine/Ohio/A01351573/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI466711A/Illinois/03/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI465380A/Indiana/05/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI464501A/Indiana/04/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI464498A/Indiana/05/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI463731A/swine/Iowa/A01432784/2013 (A/H1N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI451230A/swine/Ohio/A01208181/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446881A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446873A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446857A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446832A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446824A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446736A/swine/Ohio/A01349615/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI414181A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI407274A/Minnesota/18/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI401715A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI401659A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI401615A/swine/Minnesota/A01301908/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI398545A/swine/Ohio/A00152576/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI398537A/swine/Ohio/A01208457/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397957A/Ohio/88/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397943A/Ohio/84/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397902A/Hawaii/03/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397551A/Ohio/86/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397535A/Ohio/56/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397435A/Wisconsin/30/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397421A/Minnesota/15/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI396197A/Ohio/79/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI396187A/Ohio/77/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI396172A/Ohio/80/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395930A/swine/Ohio/12TOSU293/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395877A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395869A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395354A/Pennsylvania/17/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395340A/Wisconsin/28/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395268A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI394928A/Wisconsin/23/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI393916A/swine/Indiana/A00968380/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI393699A/Ohio/64/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI394067A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP)1790.50.000000e+00977/981 (99%)
text_code_colored.pngEPI557797A/swine/North Carolina/A01476771/2014 (A/H0) segment 7 (MP)1788.70.000000e+00977/982 (99%)
text_code_colored.pngEPI394917A/Ohio/69/2012 (A/H3N2) segment 7 (MP)1788.70.000000e+00977/982 (99%)
text_code_colored.pngEPI669137A/swine/North Carolina/A02025687/2015 (A/H0) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI600424A/swine/North Carolina/A01476920/2014 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI598966A/swine/North Carolina/A01476757/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI598963A/swine/North Carolina/A01477737/2014 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI573811A/swine/Indiana/A01840344/2014 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI573601A/swine/Indiana/A01840253/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI560131A/swine/Iowa/A01565921/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI558878A/swine/Nebraska/A01477775/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI557795A/swine/North Carolina/A01477770/2014 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI557790A/swine/Indiana/A01476743/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI550131A/swine/Indiana/13TOSU5147/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI548261A/swine/Iowa/A01476428/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI545842A/swine/North Carolina/A01476427/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI545409A/swine/Iowa/A01476267/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI542449A/swine/North Carolina/A01476196/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI538992A/swine/Michigan/A01410962/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI538957A/swine/South Dakota/A01481811/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI538672A/swine/Oklahoma/A01475757/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI534946A/swine/Iowa/A01501240/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI533784A/swine/North Carolina/A01410800/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI528007A/swine/Ohio/13TOSU0888/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI528003A/swine/Ohio/13TOSU1221/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI528000A/swine/Ohio/13TOSU1238/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI527093A/swine/Ohio/13TOSU1541/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI510216A/swine/Illinois/A01475015/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI510213A/swine/Illinois/A01409994/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI510201A/swine/Illinois/A01410268/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI510192A/swine/Illinois/A01411463/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI510175A/swine/Illinois/A01411461/2014 (A/H0) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI509772A/swine/Indiana/A01260424/2013 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI507286A/swine/Illinois/A01411097/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI505104A/swine/Iowa/A01409518/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI505064A/swine/Illinois/A01409657/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI504869A/swine/Illinois/A01411096/2013 (A/H0) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI502745A/swine/Iowa/A01290820/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI493691A/swine/Iowa/13E045/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492999A/swine/Illinois/A01394861/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492969A/swine/Illinois/A01394862/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492963A/swine/Minnesota/A01394248/2013 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492390A/swine/Iowa/A01290438/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492380A/swine/Minnesota/A01392079/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492377A/swine/Iowa/A01399987/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI489727A/swine/Minnesota/A01394021/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI487345A/swine/Illinois/A01392224/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI484455A/swine/North Carolina/A01291329/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI484437A/swine/Indiana/A01260322/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI467962A/swine/Minnesota/A01351603/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI467724A/swine/Indiana/A01260321/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI461015A/swine/South Dakota/A01350803/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI460762A/Indiana/07/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00973/976 (99%)
text_code_colored.pngEPI453568A/swine/Indiana/A01260230/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI451224A/swine/Ohio/A01208180/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI446921A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI446913A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI443536A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI443528A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI443512A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI443504A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI441498A/swine/Ohio/A01349140/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI440749A/swine/Indiana/A01432492/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433543A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433536A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433300A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433292A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433280A/swine/Minnesota/A01280462/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433271A/swine/Ohio/A01280357/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI427192A/swine/Indiana/A01260169/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI426905A/swine/Iowa/A01432308/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI426874A/swine/Ohio/A01280112/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414189A/swine/Indiana/A00968394/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414173A/swine/Indiana/A00968398/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414110A/swine/Ohio/A01279763/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414104A/swine/Ohio/A01279737/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414053A/swine/Ohio/A01279640/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414050A/swine/Ohio/A01279687/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414038A/swine/Ohio/A01279522/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI408339A/swine/Indiana/A01432186/2012 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI408210A/swine/Indiana/A01260110/2012 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI408204A/swine/Indiana/A01260099/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI408198A/swine/Indiana/A01260048/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI407026A/swine/Ohio/A01279011/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI406574A/swine/Iowa/A01203863/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI406535A/swine/Ohio/A01267959/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI406471A/swine/Indiana/A01260041/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI406468A/swine/Indiana/A01260029/2012 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI401623A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI401619A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI400107A/swine/Indiana/A00968308/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI400104A/swine/Indiana/A00968397/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398690A/swine/North Carolina/A01270266/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398529A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398503A/swine/Ohio/A01133466/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398150A/swine/Ohio/25/2012 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398039A/West Virginia/09/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398038A/Ohio/38/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397940A/Ohio/81/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397921A/Ohio/18/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397754A/Wisconsin/35/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397746A/Ohio/87/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397558A/Wisconsin/29/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397543A/Ohio/83/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397527A/Ohio/47/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397519A/Ohio/44/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397499A/Indiana/104/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397407A/Michigan/16/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397399A/Indiana/99/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397391A/Indiana/93/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)

Share this post


Link to post
Share on other sites
LOCUS       KU160741                1701 bp    cRNA    linear   VRL 13-DEC-2015
DEFINITION  Influenza A virus (A/swine/North Carolina/A01944728/2015(H3N2))
            segment 4 hemagglutinin (HA) gene, complete cds.
ACCESSION   KU160741
VERSION     KU160741.1  GI:960314745
KEYWORDS    .
SOURCE      Influenza A virus (A/swine/North Carolina/A01944728/2015(H3N2))
  ORGANISM  Influenza A virus (A/swine/North Carolina/A01944728/2015(H3N2))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1701)
  AUTHORS   Lin,K., Huang,H. and Zhang,J.
  CONSRTM   USDA SIV Survelliance
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) National Veterinary Services Laboratory,
            USDA, 1920 Dayton, Ames, IA 50010, USA
FEATURES             Location/Qualifiers
     source          1..1701
                     /organism="Influenza A virus (A/swine/North
                     Carolina/A01944728/2015(H3N2))"
                     /mol_type="viral cRNA"
                     /strain="A/swine/North Carolina/A01944728/2015"
                     /serotype="H3N2"
                     /isolation_source="nasal swab"
                     /host="swine"
                     /db_xref="taxon:1757153"
                     /segment="4"
                     /country="USA: North Carolina"
                     /collection_date="16-Oct-2015"
     gene            1..1701
                     /gene="HA"
     CDS             1..1701
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="ALR83399.1"
                     /db_xref="GI:960314746"
                     /translation="MKTIIAFSCILCLIFAQKLPGSDNSMATLCLGHHAVPNGTLVKT
                     ITDDQIEVTNATELVQSSSTGRICNSPHQILDGKNCTLIDALLGDPHCDDFQNKKWDL
                     FVERSTAYSNCYPYYVPDYATLRSLIASSGNLEFTQESFNWTGVAQDGSSYACRRGSV
                     KSFFSRLNWLYNLNYKYPEQNVTMPNNDKFDKLYIWGVHHPGTDKDQTNLYVQASGRV
                     IVSTKRSQQTVIPNIGSRPWVRGVSSIISIYWTIVKPGDILLINSTGNLIAPRGYFKI
                     QSGKSSIMRSDAHIDECNSECITPNGSIPNDKPFQNVNKITYGACPRYVKQNTLKLAT
                     GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAIDQ
                     ITGKLNRVIKKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
                     HTLDLTDSEMSKLFERTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDIYR
                     NEALNNRFQIKGVQLKSGYKDWILWISFAISCFLLCVVLLGFIMWACQKGNIRCNICI
                     "
     sig_peptide     1..48
                     /gene="HA"
     mat_peptide     49..1035
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1036..1698
                     /gene="HA"
                     /product="HA2"
     misc_feature    1..1701
                     /db_xref="IRD:IRD-A01944728.4"
ORIGIN      
        1 atgaagacta tcattgcttt tagctgcatt ctatgtctga tttttgctca aaaacttccc
       61 ggaagtgaca acagcatggc aacgctgtgc ctaggacacc acgcagtgcc aaacggaaca
      121 ttagtgaaaa caatcacgga tgaccaaatt gaagtgacta atgctactga gctggtccag
      181 agttcctcaa caggtagaat atgcaacagt cctcaccaaa tccttgatgg gaaaaattgc
      241 acactgatag atgctttatt gggggaccct cattgtgatg acttccaaaa caagaaatgg
      301 gacctttttg ttgaacgaag cacagcctac agcaactgtt acccttatta tgtgccagat
      361 tatgctaccc ttaggtcact aattgcctca tctggcaacc tggaatttac ccaagaaagc
      421 ttcaattgga ctggtgttgc tcaagacgga tcaagctatg cctgcagaag gggttctgtt
      481 aaaagtttct ttagtagatt aaattggttg tataacttga attacaagta tccagaacag
      541 aacgtaacta tgccaaacaa tgacaaattt gacaaattat acatttgggg ggttcaccac
      601 ccgggtacgg acaaagacca aaccaaccta tatgtccaag catcagggag ggttatagtc
      661 tcaaccaaaa gaagccaaca aactgtaatc ccgaatatcg ggtctagacc ctgggtgagg
      721 ggtgtctcca gcataataag catctattgg acgatagtaa aaccaggaga catacttttg
      781 attaacagca cagggaatct aattgcccct cggggttact tcaaaataca aagtgggaaa
      841 agctcaataa tgagatcaga tgcacacatt gatgaatgca attctgaatg cattactcca
      901 aatggaagca ttcccaatga caaacctttt caaaatgtaa acaagatcac atatggagcc
      961 tgtcccagat atgttaagca aaacaccctg aaattggcaa caggaatgcg gaatgtacca
     1021 gagaagcaaa ctagaggcat attcggcgca attgcaggtt tcatagaaaa tggttgggag
     1081 ggaatggtag acggttggta cggtttcagg catcagaatt ctgaaggcac aggacaagca
     1141 gcagatctta aaagcactca agcggcaatc gaccaaatca ccgggaaact aaatagagta
     1201 atcaagaaaa cgaacgagaa atttcatcaa atcgaaaaag aattctcaga agtagaaggg
     1261 agaattcagg acctagagaa atacgttgaa gacactaaaa tagatctctg gtcttacaac
     1321 gctgagcttc ttgttgccct ggagaaccaa catacacttg atttaaccga ctcagagatg
     1381 agcaaactgt tcgaaagaac aagaaggcaa ctgcgggaaa atgctgagga catgggcaat
     1441 ggttgcttca aaatatacca caaatgtgac aacgcctgca taggatcaat cagaaatgga
     1501 acttatgacc atgatatata cagaaacgag gcattaaaca atcggttcca gatcaaaggt
     1561 gttcagctaa agtcaggata caaagattgg atcctatgga tttcctttgc catatcatgc
     1621 tttttgcttt gtgttgttct gctgggtttc attatgtggg cctgccaaaa aggcaacatt
     1681 aggtgcaaca tttgcattta a

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI573818A/swine/North Carolina/A01555273/2015 (A/H3N2) segment 4 (HA)3125.70.000000e+001698/1701 (99%)
text_code_colored.pngEPI600431A/swine/North Carolina/A01476974/2014 (A/H3N2) segment 4 (HA)3105.30.000000e+001694/1701 (99%)
text_code_colored.pngEPI669135A/swine/North Carolina/A02025687/2015 (A/H0) segment 4 (HA)3099.80.000000e+001693/1701 (99%)
text_code_colored.pngEPI573011A/swine/Arkansas/A01555090/2014 (A/H3N2) segment 4 (HA)3099.80.000000e+001693/1701 (99%)
text_code_colored.pngEPI542524A/swine/North Carolina/A01477142/2014 (A/H3N2) segment 4 (HA)3083.20.000000e+001690/1701 (99%)
text_code_colored.pngEPI532373A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 4 (HA)3081.30.000000e+001690/1701 (99%)
text_code_colored.pngEPI573807A/swine/North Carolina/A01840322/2015 (A/H3N2) segment 4 (HA)3077.60.000000e+001689/1701 (99%)
text_code_colored.pngEPI542551A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI542447A/swine/North Carolina/A01476196/2014 (A/H3N2) segment 4 (HA)3075.80.000000e+001689/1701 (99%)
text_code_colored.pngEPI623626A/swine/North Carolina/A02024129/2015 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI574154A/Kansas/A01377457/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI531059A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI597655A/swine/North Carolina/A01476848/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001688/1702 (99%)
text_code_colored.pngEPI572994A/swine/North Carolina/A01840071/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI545416A/swine/North Carolina/A01478000/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI534947A/swine/Iowa/A01501048/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI532376A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 4 (HA)3064.70.000000e+001687/1701 (99%)
text_code_colored.pngEPI538664A/swine/Iowa/A01410752/2014 (A/H3N2) segment 4 (HA)3061.00.000000e+001686/1701 (99%)
text_code_colored.pngEPI533782A/swine/North Carolina/A01410800/2014 (A/H3N2) segment 4 (HA)3061.00.000000e+001686/1701 (99%)
text_code_colored.pngEPI559548A/swine/North Carolina/A01476688/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI558883A/swine/North Carolina/A01476771/2014 (A/H0) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI558842A/swine/North Carolina/A01477778/2014 (A/H0) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI558839A/swine/North Carolina/A01478182/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI558834A/swine/North Carolina/A01476730/2014 (A/H0) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI558819A/swine/North Carolina/A01476734/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI550293A/swine/Iowa/A01410971/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI530996A/swine/Iowa/A01410600/2014 (A/H3N2) segment 4 (HA)3059.20.000000e+001686/1701 (99%)
text_code_colored.pngEPI542548A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 4 (HA)3055.50.000000e+001685/1701 (99%)
text_code_colored.pngEPI586151A/swine/North Carolina/A01555667/2015 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI559025A/swine/North Carolina/A01566286/2014 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI545858A/swine/North Carolina/A01476419/2014 (A/H0) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI545840A/swine/North Carolina/A01476427/2014 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI545816A/swine/North Carolina/A01476354/2014 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI545379A/swine/Iowa/A01476223/2014 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI538670A/swine/Oklahoma/A01475757/2014 (A/H3N2) segment 4 (HA)3053.60.000000e+001685/1701 (99%)
text_code_colored.pngEPI597661A/swine/North Carolina/A01476883/2014 (A/H3N2) segment 4 (HA)3049.90.000000e+001684/1701 (99%)
text_code_colored.pngEPI573035A/swine/North Carolina/A01555111/2014 (A/H3N2) segment 4 (HA)3049.90.000000e+001684/1701 (99%)
text_code_colored.pngEPI593956A/swine/Minnesota/A01489046/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI584808A/swine/North Carolina/A01841335/2015 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI573793A/swine/North Carolina/A01840289/2015 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI573479A/swine/North Carolina/A01840158/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI573350A/swine/Minnesota/A01567013/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI550296A/swine/Iowa/A01410995/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI548259A/swine/Iowa/A01476428/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI545407A/swine/Iowa/A01476267/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI542563A/swine/North Carolina/A01476078/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI542542A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 4 (HA)3048.10.000000e+001684/1701 (99%)
text_code_colored.pngEPI623700A/swine/Indiana/A01260863/2015 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI600344A/swine/North Carolina/A01476954/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI573020A/swine/North Carolina/A01840022/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI559533A/swine/North Carolina/A01476698/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI559530A/swine/North Carolina/A01476719/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI545813A/swine/North Carolina/A01476367/2014 (A/H3N2) segment 4 (HA)3042.60.000000e+001683/1701 (98%)
text_code_colored.pngEPI542474A/swine/Kansas/018050-1/2014 (A/H3N2) segment 4 (HA)3040.70.000000e+001680/1698 (98%)
text_code_colored.pngEPI620523A/swine/Iowa/A02076873/2015 (A/H3N2) segment 4 (HA)3038.90.000000e+001682/1701 (98%)
text_code_colored.pngEPI600449A/swine/North Carolina/A01477954/2014 (A/H3N2) segment 4 (HA)3038.90.000000e+001682/1701 (98%)
text_code_colored.pngEPI669209A/swine/North Carolina/A01857100/2015 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI623703A/swine/Indiana/A01260882/2015 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI620514A/swine/Iowa/A02076659/2015 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI598964A/swine/North Carolina/A01476757/2014 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI573452A/swine/Iowa/A01555142/2014 (A/H3N2) segment 4 (HA)3033.30.000000e+001681/1701 (98%)
text_code_colored.pngEPI672951A/swine/North Carolina/A01945243/2015 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI620526A/swine/Iowa/A02077538/2015 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI557544A/Wisconsin/24/2014 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI557542A/Wisconsin/24/2014 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI542530A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 4 (HA)3031.50.000000e+001681/1701 (98%)
text_code_colored.pngEPI623651A/swine/Illinois/A02076874/2015 (A/H3N2) segment 4 (HA)3029.60.000000e+001680/1701 (98%)
text_code_colored.pngEPI558851A/swine/Minnesota/A01477780/2014 (A/H3N2) segment 4 (HA)3029.60.000000e+001679/1699 (98%)
text_code_colored.pngEPI669224A/swine/North Carolina/A01857097/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI620490A/swine/North Carolina/A02077505/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI612571A/swine/North Carolina/A02076180/2015 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI573599A/swine/Indiana/A01840253/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI573017A/swine/Ohio/A01840053/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI573003A/swine/Arkansas/A01555074/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI557534A/Wisconsin/24/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI510214A/swine/Illinois/A01475015/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI510211A/swine/Illinois/A01409994/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI510199A/swine/Illinois/A01410268/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI510190A/swine/Illinois/A01411463/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI510173A/swine/Illinois/A01411461/2014 (A/H0) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI507284A/swine/Illinois/A01411097/2014 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI505102A/swine/Iowa/A01409518/2013 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI504864A/swine/Illinois/A01411096/2013 (A/H0) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI460390A/swine/Indiana/A01260254/2013 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI647569A/swine/North Carolina/A02035784/2015 (A/H3N2) segment 4 (HA)3024.10.000000e+001679/1701 (98%)
text_code_colored.pngEPI600347A/swine/North Carolina/A01476949/2014 (A/H3N2) segment 4 (HA)3024.10.000000e+001679/1701 (98%)
text_code_colored.pngEPI590659A/swine/North Carolina/A01841712/2015 (A/H3N2) segment 4 (HA)3024.10.000000e+001680/1702 (98%)
text_code_colored.pngEPI600470A/swine/Arkansas/A01476939/2014 (A/H3N2) segment 4 (HA)3022.20.000000e+001679/1701 (98%)
text_code_colored.pngEPI672887A/swine/North Carolina/A01945112/2015 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI669154A/swine/North Carolina/A02025678/2015 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI663380A/swine/North Carolina/A02025575/2015 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI663334A/swine/North Carolina/A01770073/2015 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI647584A/swine/North Carolina/A02025402/2015 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI573495A/swine/Indiana/A01840133/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI573486A/swine/Arkansas/A01555162/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI573448A/swine/Indiana/A01840146/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI545852A/swine/Iowa/A01476426/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI538990A/swine/Michigan/A01410962/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI530299A/swine/Illinois/A01410453/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI530284A/swine/Illinois/A01475190/2014 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI508836A/swine/Illinois/A01409932/2014 (A/H0) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI460381A/swine/Indiana/A01260284/2013 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI573445A/swine/Arkansas/A01840147/2014 (A/H3N2) segment 4 (HA)3016.70.000000e+001678/1701 (98%)
text_code_colored.pngEPI508858A/swine/Illinois/A01410110/2014 (A/H3N2) segment 4 (HA)3016.70.000000e+001678/1701 (98%)
text_code_colored.pngEPI669236A/swine/North Carolina/A01857103/2015 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI663367A/swine/North Carolina/A01769650/2015 (A/H0) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI530309A/swine/North Carolina/A01410529/2014 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI505062A/swine/Illinois/A01409657/2014 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI460387A/swine/Indiana/A01260252/2013 (A/H3N2) segment 4 (HA)3014.90.000000e+001679/1702 (98%)
text_code_colored.pngEPI460372A/swine/Indiana/A01260276/2013 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI573602A/swine/Indiana/A01840254/2014 (A/H3N2) segment 4 (HA)3013.00.000000e+001677/1701 (98%)
text_code_colored.pngEPI573000A/swine/Arkansas/A01840096/2014 (A/H3N2) segment 4 (HA)3013.00.000000e+001677/1701 (98%)
text_code_colored.pngEPI663313A/swine/North Carolina/A01770059/2015 (A/H3N2) segment 4 (HA)3011.20.000000e+001677/1701 (98%)
text_code_colored.pngEPI669247A/swine/North Carolina/A02025897/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI669178A/swine/Indiana/A01260958/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI653893A/swine/North Carolina/A02034953/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI647504A/swine/North Carolina/A02034471/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI586038A/swine/Illinois/A01555570/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI584802A/swine/Indiana/A01841389/2015 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI531097A/swine/Minnesota/A01493481/2014 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI505039A/swine/Illinois/A01410018/2013 (A/H0) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI573714A/swine/Kansas/14-032477/2014 (A/H3N2) segment 4 (HA)3005.60.000000e+001676/1701 (98%)
text_code_colored.pngEPI584734A/swine/Illinois/A01555638/2015 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI398672A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI391413A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI391404A/swine/Ohio/A01203186/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI366030A/Utah/10/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001674/1699 (98%)
text_code_colored.pngEPI642513A/Michigan/39/2015 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI558822A/swine/Indiana/A01476743/2014 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI509764A/swine/Indiana/A01260416/2013 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI493012A/swine/Kansas/A01377090/2013 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI453427A/swine/Korea/D79/2011 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI426890A/swine/Indiana/A01432300/2013 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI408199A/swine/Indiana/A01260093/2012 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI396270A/Indiana/133/2012 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI394913A/Indiana/132/2012 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI388332A/Utah/10/2012 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI388327A/Indiana/14/2012 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI342603A/swine/NY/A01104005/2011 (A/H3N2) segment 4 (HA)2994.50.000000e+001673/1699 (98%)
text_code_colored.pngEPI671792A/swine/Illinois/A01857433/2015 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI559527A/swine/North Carolina/A01476560/2014 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI645058A/swine/Indiana/A01260926/2015 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI573566A/swine/Minnesota/A01469329/2014 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI573051A/swine/Iowa/A01840061/2014 (A/H3N2) segment 4 (HA)2989.00.000000e+001673/1701 (98%)
text_code_colored.pngEPI528431A/swine/Ohio/13TOSU1547/2013 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI527870A/swine/Ohio/13TOSU2043/2013 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI527113A/swine/Ohio/13TOSU2052/2013 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI453426A/swine/Korea/A18/2011 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI451202A/swine/Alabama/A01104056/2012 (A/H0) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI446888A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI446879A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI446800A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI443550A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI426887A/swine/Iowa/A01432271/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI414186A/swine/Indiana/A00968394/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI414170A/swine/Indiana/A00968398/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI408202A/swine/Indiana/A01260099/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI406576A/swine/Iowa/A01203863/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI406504A/swine/Iowa/A01267939/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI404890A/Iowa/16/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI401609A/swine/Ohio/A00138552/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397913A/Indiana/123/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397906A/Illinois/11/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397905A/Hawaii/03/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397662A/Maryland/28/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397396A/Indiana/93/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397210A/Maryland/25/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI397006A/Ohio/78/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI396262A/Indiana/127/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI396254A/Indiana/126/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI395883A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI395259A/Ohio/35/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI394944A/Maryland/22/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI393306A/Indiana/18/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI392926A/Maryland/20/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI388352A/Indiana/20/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI388346A/Indiana/15/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI388298A/Indiana/19/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI388282A/Indiana/13/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI383528A/swine/Indiana/A01203509/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI381873A/Hawaii/03/2012 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI351662A/swine/Iowa/A01202659/2011 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI346493A/West Virginia/06/2011 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI339171A/Maine/06/2011 (A/H3N2) segment 4 (HA)2989.00.000000e+001672/1699 (98%)
text_code_colored.pngEPI573439A/swine/Missouri/A01555163/2014 (A/H3N2) segment 4 (HA)2987.20.000000e+001673/1701 (98%)
text_code_colored.pngEPI398492A/swine/Maryland/A01104048/2012 (A/H3N2) segment 4 (HA)2985.30.000000e+001671/1699 (98%)
text_code_colored.pngEPI395328A/West Virginia/06/2011 (A/H3N2) segment 4 (HA)2985.30.000000e+001671/1699 (98%)
text_code_colored.pngEPI653868A/swine/Illinois/A00857134/2011 (A/H0) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI653857A/swine/Illinois/A00857131/2011 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI653774A/swine/Illinois/A00857129/2011 (A/H0) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI492349A/swine/Indiana/A00968364/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI446927A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI446919A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI446863A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI446830A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI443558A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI443526A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI433540A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI433533A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI433306A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI433298A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI424073A/swine/Michigan/A01259003/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI414178A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI406530A/swine/Illinois/A01432127/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI401702A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI401684A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI401680A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI401667A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI400105A/swine/Indiana/A00968308/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398542A/swine/Ohio/A00152576/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398534A/swine/Ohio/A01208457/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398526A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398518A/swine/Ohio/A01133464/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398500A/swine/Ohio/A01133466/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI398479A/swine/Maryland/A01104040/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397969A/Wisconsin/34/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397962A/Wisconsin/30/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397954A/Ohio/85/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397939A/Ohio/41/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397548A/Ohio/84/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397540A/Ohio/56/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397532A/Ohio/47/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397524A/Ohio/44/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397516A/Ohio/36/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397503A/Indiana/104/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397446A/Wisconsin/31/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397432A/Ohio/81/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397426A/Minnesota/15/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397385A/Indiana/138/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397351A/Ohio/37/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397340A/Indiana/150/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI397089A/Indiana/52/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396299A/Maryland/23/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396280A/Indiana/144/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396208A/Indiana/149/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396192A/Ohio/77/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396183A/Indiana/77/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI396175A/Ohio/80/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395874A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395866A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395718A/swine/Indiana/A01104023/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395711A/swine/Indiana/A01104016/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395357A/Pennsylvania/17/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395344A/Wisconsin/28/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395270A/Pennsylvania/11/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI395267A/Ohio/65/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI394937A/Ohio/75/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI394933A/Wisconsin/23/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI394921A/Ohio/69/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)
text_code_colored.pngEPI394077A/Wisconsin/27/2012 (A/H3N2) segment 4 (HA)2983.50.000000e+001671/1699 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI600432A/swine/North Carolina/A01476974/2014 (A/H3N2) segment 6 (NA)2582.70.000000e+001406/1410 (99%)
text_code_colored.pngEPI573819A/swine/North Carolina/A01555273/2015 (A/H3N2) segment 6 (NA)2579.00.000000e+001405/1410 (99%)
text_code_colored.pngEPI573012A/swine/Arkansas/A01555090/2014 (A/H3N2) segment 6 (NA)2571.70.000000e+001404/1410 (99%)
text_code_colored.pngEPI542525A/swine/North Carolina/A01477142/2014 (A/H3N2) segment 6 (NA)2560.60.000000e+001402/1410 (99%)
text_code_colored.pngEPI669136A/swine/North Carolina/A02025687/2015 (A/H0) segment 6 (NA)2542.10.000000e+001398/1410 (99%)
text_code_colored.pngEPI532374A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 6 (NA)2534.70.000000e+001397/1410 (99%)
text_code_colored.pngEPI574155A/Kansas/A01377457/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI531060A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI533783A/swine/North Carolina/A01410800/2014 (A/H3N2) segment 6 (NA)2529.20.000000e+001396/1410 (99%)
text_code_colored.pngEPI532377A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 6 (NA)2529.20.000000e+001396/1410 (99%)
text_code_colored.pngEPI573351A/swine/Minnesota/A01567013/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI545408A/swine/Iowa/A01476267/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI545380A/swine/Iowa/A01476223/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI542531A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI538665A/swine/Iowa/A01410752/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI534948A/swine/Iowa/A01501048/2014 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI530997A/swine/Iowa/A01410600/2014 (A/H3N2) segment 6 (NA)2523.60.000000e+001395/1410 (98%)
text_code_colored.pngEPI600348A/swine/North Carolina/A01476949/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI573808A/swine/North Carolina/A01840322/2015 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI573480A/swine/North Carolina/A01840158/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI559534A/swine/North Carolina/A01476698/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI558882A/swine/North Carolina/A01476771/2014 (A/H0) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI558852A/swine/Minnesota/A01477780/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI558843A/swine/North Carolina/A01477778/2014 (A/H0) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI550294A/swine/Iowa/A01410971/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI542448A/swine/North Carolina/A01476196/2014 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI647585A/swine/North Carolina/A02025402/2015 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI598965A/swine/North Carolina/A01476757/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI572995A/swine/North Carolina/A01840071/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI545841A/swine/North Carolina/A01476427/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI542564A/swine/North Carolina/A01476078/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI542552A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI542543A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI538671A/swine/Oklahoma/A01475757/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI533959A/swine/Iowa/A01501046/2014 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI663314A/swine/North Carolina/A01770059/2015 (A/H3N2) segment 6 (NA)2512.60.000000e+001393/1410 (98%)
text_code_colored.pngEPI542549A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 6 (NA)2512.60.000000e+001393/1410 (98%)
text_code_colored.pngEPI647624A/swine/Michigan/A01104086/2015 (A/H0) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI620515A/swine/Iowa/A02076659/2015 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI612572A/swine/North Carolina/A02076180/2015 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI600450A/swine/North Carolina/A01477954/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI573036A/swine/North Carolina/A01555111/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI573021A/swine/North Carolina/A01840022/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI559531A/swine/North Carolina/A01476719/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI559026A/swine/North Carolina/A01566286/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI558840A/swine/North Carolina/A01478182/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI558835A/swine/North Carolina/A01476730/2014 (A/H0) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI558820A/swine/North Carolina/A01476734/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI550297A/swine/Iowa/A01410995/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI548260A/swine/Iowa/A01476428/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI460388A/swine/Indiana/A01260252/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI460382A/swine/Indiana/A01260284/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI460373A/swine/Indiana/A01260276/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI460367A/swine/Indiana/A01260261/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397623A/Indiana/150/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397502A/Indiana/104/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397403A/Indiana/99/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI396207A/Indiana/149/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI396182A/Indiana/77/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI394059A/Indiana/38/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393518A/Indiana/65/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393297A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393291A/Indiana/38/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392752A/Indiana/16/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392698A/Indiana/46/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392695A/Indiana/43/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI593957A/swine/Minnesota/A01489046/2014 (A/H3N2) segment 6 (NA)2507.00.000000e+001392/1410 (98%)
text_code_colored.pngEPI600345A/swine/North Carolina/A01476954/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI584809A/swine/North Carolina/A01841335/2015 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI545817A/swine/North Carolina/A01476354/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001393/1411 (98%)
text_code_colored.pngEPI545417A/swine/North Carolina/A01478000/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001393/1411 (98%)
text_code_colored.pngEPI460391A/swine/Indiana/A01260254/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI446797A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI443547A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI443523A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI433303A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI433295A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI414172A/swine/Indiana/A00968398/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI401685A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI401681A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI400106A/swine/Indiana/A00968308/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI400096A/swine/Indiana/A00968390/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI398520A/swine/Ohio/A01133464/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI398502A/swine/Ohio/A01133466/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI398494A/swine/Maryland/A01104048/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI398486A/swine/Maryland/A01104040/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI398034A/Maryland/22/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397661A/Maryland/28/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397620A/Maryland/25/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397531A/Ohio/47/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397523A/Ohio/44/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397515A/Ohio/36/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397431A/Ohio/81/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397384A/Indiana/138/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397350A/Ohio/37/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397208A/Ohio/78/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397097A/Indiana/103/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397088A/Indiana/52/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396276A/Indiana/135/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396261A/Indiana/127/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396253A/Indiana/126/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396234A/Ohio/34/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395885A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395336A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395266A/Ohio/65/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395258A/Ohio/35/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395250A/Indiana/152/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI394062A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393694A/West Virginia/16/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393680A/West Virginia/10/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393672A/Ohio/71/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393316A/Ohio/38/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393310A/West Virginia/09/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI393305A/Indiana/18/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI392704A/Indiana/52/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI392683A/Indiana/13/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI669248A/swine/North Carolina/A02025897/2015 (A/H3N2) segment 6 (NA)2501.50.000000e+001391/1410 (98%)
text_code_colored.pngEPI395712A/swine/Indiana/A01104016/2012 (A/H3N2) segment 6 (NA)2501.50.000000e+001391/1410 (98%)
text_code_colored.pngEPI669155A/swine/North Carolina/A02025678/2015 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI653894A/swine/North Carolina/A02034953/2015 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI573794A/swine/North Carolina/A01840289/2015 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI573453A/swine/Iowa/A01555142/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI559549A/swine/North Carolina/A01476688/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI558823A/swine/Indiana/A01476743/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI545859A/swine/North Carolina/A01476419/2014 (A/H0) segment 6 (NA)2499.60.000000e+001392/1411 (98%)
text_code_colored.pngEPI530300A/swine/Illinois/A01410453/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI530285A/swine/Illinois/A01475190/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI510212A/swine/Illinois/A01409994/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI507285A/swine/Illinois/A01411097/2014 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI505103A/swine/Iowa/A01409518/2013 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI502642A/swine/South Dakota/A01366093/2013 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI446924A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI446916A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI446868A/swine/Ohio/12TOSU411/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI446860A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI446835A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI433542A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI433535A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI416856A/swine/Tennessee/A01104055/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI408203A/swine/Indiana/A01260099/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI406575A/swine/Iowa/A01203863/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI401703A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI401688A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI398671A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI398544A/swine/Ohio/A00152576/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI398536A/swine/Ohio/A01208457/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI397946A/Ohio/84/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI397904A/Hawaii/03/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI397626A/Ohio/57/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI397554A/Ohio/86/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI397425A/Minnesota/15/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI396298A/Maryland/23/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI396191A/Ohio/77/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI395876A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI395868A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI394925A/Illinois/11/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI393701A/Ohio/64/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI392691A/Indiana/31/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI383539A/swine/Indiana/A01203509/2012 (A/H3N2) segment 6 (NA)2499.60.000000e+001391/1410 (98%)
text_code_colored.pngEPI542475A/swine/Kansas/018050-1/2014 (A/H3N2) segment 6 (NA)2495.90.000000e+001391/1411 (98%)
text_code_colored.pngEPI504865A/swine/Illinois/A01411096/2013 (A/H0) segment 6 (NA)2495.90.000000e+001390/1410 (98%)
text_code_colored.pngEPI672888A/swine/North Carolina/A01945112/2015 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI663381A/swine/North Carolina/A02025575/2015 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI623701A/swine/Indiana/A01260863/2015 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI620491A/swine/North Carolina/A02077505/2015 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI586152A/swine/North Carolina/A01555667/2015 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI573600A/swine/Indiana/A01840253/2014 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI545814A/swine/North Carolina/A01476367/2014 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI542445A/swine/Nebraska/A01476165/2014 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI530310A/swine/North Carolina/A01410529/2014 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI509736A/swine/Iowa/13H075/2013 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI505063A/swine/Illinois/A01409657/2014 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI492350A/swine/Indiana/A00968364/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI446885A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI446876A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI446827A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI443555A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI443539A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI443531A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI443515A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI443507A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI427179A/swine/Indiana/A01260015/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI426886A/swine/Iowa/A01432271/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI414188A/swine/Indiana/A00968394/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI406470A/swine/Indiana/A01260041/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI404892A/Iowa/16/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI401610A/swine/Ohio/A00138552/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI400102A/swine/Indiana/A00968397/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI399293A/swine/Minnesota/A01327922/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI398123A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397931A/Ohio/19/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397918A/Ohio/17/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397750A/Ohio/87/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397627A/Ohio/63/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397625A/Ohio/43/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397624A/Ohio/80/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397621A/Ohio/79/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397547A/Ohio/83/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397539A/Ohio/56/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397395A/Indiana/93/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397377A/Indiana/123/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI397363A/Ohio/23/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI396279A/Indiana/144/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI396269A/Indiana/133/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395958A/swine/Indiana/A00968379/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395950A/swine/Indiana/A00968376/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395934A/swine/Indiana/A00968370/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395921A/swine/Ohio/12TOSU268/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395860A/swine/Ohio/12TOSU464/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395852A/swine/Ohio/12TOSU467/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395742A/swine/Indiana/A00968386/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395330A/West Virginia/06/2011 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI395327A/West Virginia/06/2011 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI394936A/Ohio/75/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI394932A/Wisconsin/23/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI394920A/Ohio/69/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI394912A/Indiana/132/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI394905A/Ohio/62/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393696A/Indiana/20/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393687A/Ohio/23/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393666A/Ohio/28/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393510A/Ohio/52/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393294A/Ohio/24/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI392677A/Ohio/13/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388365A/Ohio/17/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388345A/Indiana/15/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388338A/Ohio/16/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388329A/Ohio/20/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388320A/Ohio/18/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388318A/Ohio/20/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388311A/Ohio/15/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI388304A/Ohio/14/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI383540A/swine/Minnesota/A01203517/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI378522A/Indiana/09/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI378514A/Indiana/07/2012 (A/H3N2) segment 6 (NA)2494.10.000000e+001390/1410 (98%)
text_code_colored.pngEPI393526A/West Virginia/15/2012 (A/H3N2) segment 6 (NA)2492.30.000000e+001387/1406 (98%)
text_code_colored.pngEPI397924A/Ohio/18/2012 (A/H3N2) segment 6 (NA)2490.40.000000e+001389/1410 (98%)
text_code_colored.pngEPI647505A/swine/North Carolina/A02034471/2015 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI620794A/swine/Nebraska/A01847244/2015 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI590761A/swine/Nebraska/A01847145/2015 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI590758A/swine/Nebraska/A01847132/2015 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI590660A/swine/North Carolina/A01841712/2015 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI573810A/swine/Indiana/A01840344/2014 (A/H1N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI559528A/swine/North Carolina/A01476560/2014 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI505043A/swine/Illinois/A01410018/2013 (A/H0) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI499948A/swine/Iowa/13H087/2013 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI499655A/swine/North Carolina/A01409048/2013 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI493013A/swine/Kansas/A01377090/2013 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI448835A/swine/Kansas/13-105721a/2013 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI433281A/swine/Minnesota/A01280462/2013 (A/H3N2) segment 6 (NA)2488.60.000000e+001389/1410 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI600433A/swine/North Carolina/A01476974/2014 (A/H3N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568695A/swine/North Carolina/A01555273/2015 (A/H3N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI542526A/swine/North Carolina/A01477142/2014 (A/H3N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI573013A/swine/Arkansas/A01555090/2014 (A/H3N2) segment 7 (MP)1799.80.000000e+00979/982 (99%)
text_code_colored.pngEPI550295A/swine/Iowa/A01410971/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550280A/swine/Indiana/13TOSU4382/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550224A/swine/Indiana/13TOSU4561/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550215A/swine/Indiana/13TOSU4293/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550173A/swine/Indiana/13TOSU1999/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550138A/swine/Texas/13TOSU0060/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550117A/swine/Indiana/13TOSU4284/2013 (A/H0) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550103A/swine/Indiana/13TOSU4563/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550082A/swine/Ohio/13TOSU0726/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550068A/swine/Indiana/13TOSU5669/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550061A/swine/Indiana/13TOSU5238/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI549963A/swine/Indiana/13TOSU5869/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI547388A/swine/Indiana/13TOSU1991/2013 (A/H0) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI542550A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI542544A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI538919A/swine/Iowa/A01501685/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI538666A/swine/Iowa/A01410752/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI534949A/swine/Iowa/A01501048/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI532375A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI530998A/swine/Iowa/A01410600/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI528475A/swine/Ohio/13TOSU0410/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI528427A/swine/Indiana/13TOSU1042/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI527868A/swine/Indiana/13TOSU1050/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI527099A/swine/Indiana/13TOSU1319/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI527088A/swine/Ohio/13TOSU0411/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI526885A/swine/Indiana/13TOSU1043/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI509787A/swine/Indiana/A01260445/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI509784A/swine/Indiana/A01260443/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI509775A/swine/Indiana/A01260426/2013 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI507295A/swine/Illinois/A00843193/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI505083A/swine/Illinois/A01409611/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI505070A/swine/Illinois/A01411232/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI505038A/swine/Illinois/A01409717/2014 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI502385A/swine/Illinois/A01427136/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI499890A/swine/Indiana/A01260398/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI485991A/swine/Indiana/13TOSU1128/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI485983A/swine/Indiana/13TOSU1122/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI482815A/Indiana/21/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI482812A/Indiana/11/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI476669A/swine/Michigan/A01259074/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI472212A/swine/Indiana/A01260313/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI472197A/swine/Iowa/A01432817/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI468209A/swine/Indiana/13TOSU490/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI468201A/swine/Indiana/13TOSU482/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI465418A/Indiana/17/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI465389A/Indiana/09/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI465386A/Indiana/10/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI465383A/Indiana/07/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI463710A/swine/Illinois/A01432795/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI460975A/swine/Minnesota/A01350866/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI451205A/swine/Alabama/A01104056/2012 (A/H0) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI448836A/swine/Kansas/13-105721a/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI447028A/swine/Iowa/A01432604/2013 (A/H1N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI443110A/swine/Ohio/A01349495/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI443107A/swine/Ohio/A01349485/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI443100A/swine/Ohio/A01349302/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI443097A/swine/Ohio/A01349305/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI441501A/swine/Minnesota/A01349160/2013 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI427186A/swine/Indiana/A01260163/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI426885A/swine/Iowa/A01432271/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI424076A/swine/Michigan/A01259003/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI414154A/swine/Iowa/A01244302/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI406528A/swine/Illinois/A01432127/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI406505A/swine/Iowa/A01267939/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI404893A/Iowa/16/2012 (A/H3N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI499949A/swine/Iowa/13H087/2013 (A/H3N2) segment 7 (MP)1794.20.000000e+00978/982 (99%)
text_code_colored.pngEPI673002A/swine/Minnesota/A01940148/2015 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI672998A/swine/Minnesota/A01940427/2015 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI597657A/swine/North Carolina/A01476848/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI573352A/swine/Minnesota/A01567013/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI572996A/swine/North Carolina/A01840071/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI568725A/swine/North Carolina/A01840158/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI559027A/swine/North Carolina/A01566286/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI550298A/swine/Iowa/A01410995/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI549991A/swine/Indiana/13TOSU5730/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI546902A/swine/Indiana/13TOSU1982/2013 (A/H0) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI545815A/swine/North Carolina/A01476367/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI542565A/swine/North Carolina/A01476078/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI542553A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI542532A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI532378A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI531061A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI531031A/swine/Illinois/A01475266/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI528443A/swine/Ohio/13TOSU2194/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI526923A/swine/Indiana/13TOSU1155/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI509751A/swine/Iowa/13H068/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI509744A/swine/Iowa/13H081/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI509737A/swine/Iowa/13H075/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI509723A/swine/Iowa/13H082/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI505077A/swine/Illinois/A01409675/2014 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI501536A/swine/Minnesota/A01366050/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI499940A/swine/Iowa/13H069/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI499924A/swine/Iowa/13H094/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI493014A/swine/Kansas/A01377090/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI492351A/swine/Indiana/A00968364/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI485857A/swine/Michigan/A01259075/2013 (A/H1N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI472185A/swine/Iowa/A01432840/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI467959A/swine/Ohio/A01351573/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI466711A/Illinois/03/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI465380A/Indiana/05/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI464501A/Indiana/04/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI464498A/Indiana/05/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI463731A/swine/Iowa/A01432784/2013 (A/H1N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI451230A/swine/Ohio/A01208181/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446881A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446873A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446857A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446832A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446824A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI446736A/swine/Ohio/A01349615/2013 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI414181A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI407274A/Minnesota/18/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI401715A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI401659A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI401615A/swine/Minnesota/A01301908/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI398545A/swine/Ohio/A00152576/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI398537A/swine/Ohio/A01208457/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397957A/Ohio/88/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397943A/Ohio/84/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397902A/Hawaii/03/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397551A/Ohio/86/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397535A/Ohio/56/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397435A/Wisconsin/30/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI397421A/Minnesota/15/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI396197A/Ohio/79/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI396187A/Ohio/77/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI396172A/Ohio/80/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395930A/swine/Ohio/12TOSU293/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395877A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395869A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395354A/Pennsylvania/17/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395340A/Wisconsin/28/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI395268A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI394928A/Wisconsin/23/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI393916A/swine/Indiana/A00968380/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI393699A/Ohio/64/2012 (A/H3N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI394067A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP)1790.50.000000e+00977/981 (99%)
text_code_colored.pngEPI557797A/swine/North Carolina/A01476771/2014 (A/H0) segment 7 (MP)1788.70.000000e+00977/982 (99%)
text_code_colored.pngEPI394917A/Ohio/69/2012 (A/H3N2) segment 7 (MP)1788.70.000000e+00977/982 (99%)
text_code_colored.pngEPI669137A/swine/North Carolina/A02025687/2015 (A/H0) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI600424A/swine/North Carolina/A01476920/2014 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI598966A/swine/North Carolina/A01476757/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI598963A/swine/North Carolina/A01477737/2014 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI573811A/swine/Indiana/A01840344/2014 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI573601A/swine/Indiana/A01840253/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI560131A/swine/Iowa/A01565921/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI558878A/swine/Nebraska/A01477775/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI557795A/swine/North Carolina/A01477770/2014 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI557790A/swine/Indiana/A01476743/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI550131A/swine/Indiana/13TOSU5147/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI548261A/swine/Iowa/A01476428/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI545842A/swine/North Carolina/A01476427/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI545409A/swine/Iowa/A01476267/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI542449A/swine/North Carolina/A01476196/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI538992A/swine/Michigan/A01410962/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI538957A/swine/South Dakota/A01481811/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI538672A/swine/Oklahoma/A01475757/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI534946A/swine/Iowa/A01501240/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI533784A/swine/North Carolina/A01410800/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI528007A/swine/Ohio/13TOSU0888/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI528003A/swine/Ohio/13TOSU1221/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI528000A/swine/Ohio/13TOSU1238/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI527093A/swine/Ohio/13TOSU1541/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI510216A/swine/Illinois/A01475015/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI510213A/swine/Illinois/A01409994/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI510201A/swine/Illinois/A01410268/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI510192A/swine/Illinois/A01411463/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI510175A/swine/Illinois/A01411461/2014 (A/H0) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI509772A/swine/Indiana/A01260424/2013 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI507286A/swine/Illinois/A01411097/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI505104A/swine/Iowa/A01409518/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI505064A/swine/Illinois/A01409657/2014 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI504869A/swine/Illinois/A01411096/2013 (A/H0) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI502745A/swine/Iowa/A01290820/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI493691A/swine/Iowa/13E045/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492999A/swine/Illinois/A01394861/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492969A/swine/Illinois/A01394862/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492963A/swine/Minnesota/A01394248/2013 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492390A/swine/Iowa/A01290438/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492380A/swine/Minnesota/A01392079/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI492377A/swine/Iowa/A01399987/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI489727A/swine/Minnesota/A01394021/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI487345A/swine/Illinois/A01392224/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI484455A/swine/North Carolina/A01291329/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI484437A/swine/Indiana/A01260322/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI467962A/swine/Minnesota/A01351603/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI467724A/swine/Indiana/A01260321/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI461015A/swine/South Dakota/A01350803/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI460762A/Indiana/07/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00973/976 (99%)
text_code_colored.pngEPI453568A/swine/Indiana/A01260230/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI451224A/swine/Ohio/A01208180/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI446921A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI446913A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI443536A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI443528A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI443512A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI443504A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI441498A/swine/Ohio/A01349140/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI440749A/swine/Indiana/A01432492/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433543A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433536A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433300A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433292A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433280A/swine/Minnesota/A01280462/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI433271A/swine/Ohio/A01280357/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI427192A/swine/Indiana/A01260169/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI426905A/swine/Iowa/A01432308/2013 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI426874A/swine/Ohio/A01280112/2013 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414189A/swine/Indiana/A00968394/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414173A/swine/Indiana/A00968398/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414110A/swine/Ohio/A01279763/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414104A/swine/Ohio/A01279737/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414053A/swine/Ohio/A01279640/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414050A/swine/Ohio/A01279687/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI414038A/swine/Ohio/A01279522/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI408339A/swine/Indiana/A01432186/2012 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI408210A/swine/Indiana/A01260110/2012 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI408204A/swine/Indiana/A01260099/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI408198A/swine/Indiana/A01260048/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI407026A/swine/Ohio/A01279011/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI406574A/swine/Iowa/A01203863/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI406535A/swine/Ohio/A01267959/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI406471A/swine/Indiana/A01260041/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI406468A/swine/Indiana/A01260029/2012 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI401623A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI401619A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI400107A/swine/Indiana/A00968308/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI400104A/swine/Indiana/A00968397/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398690A/swine/North Carolina/A01270266/2012 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398529A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398503A/swine/Ohio/A01133466/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398150A/swine/Ohio/25/2012 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398039A/West Virginia/09/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI398038A/Ohio/38/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397940A/Ohio/81/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397921A/Ohio/18/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397754A/Wisconsin/35/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397746A/Ohio/87/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397558A/Wisconsin/29/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397543A/Ohio/83/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397527A/Ohio/47/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397519A/Ohio/44/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397499A/Indiana/104/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397407A/Michigan/16/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397399A/Indiana/99/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI397391A/Indiana/93/2012 (A/H3N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)

Share this post


Link to post
Share on other sites
LOCUS       KU143646                1701 bp    cRNA    linear   VRL 13-DEC-2015
DEFINITION  Influenza A virus (A/swine/North Carolina/A01945726/2015(H3N2))
            segment 4 hemagglutinin (HA) gene, complete cds.
ACCESSION   KU143646
VERSION     KU143646.1  GI:960313649
KEYWORDS    .
SOURCE      Influenza A virus (A/swine/North Carolina/A01945726/2015(H3N2))
  ORGANISM  Influenza A virus (A/swine/North Carolina/A01945726/2015(H3N2))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1701)
  AUTHORS   Lin,K., Huang,H. and Zhang,J.
  CONSRTM   USDA SIV Survelliance
  TITLE     Direct Submission
  JOURNAL   Submitted (12-NOV-2015) National Veterinary Services Laboratory,
            USDA, 1920 Dayton, Ames, IA 50010, USA
FEATURES             Location/Qualifiers
     source          1..1701
                     /organism="Influenza A virus (A/swine/North
                     Carolina/A01945726/2015(H3N2))"
                     /mol_type="viral cRNA"
                     /strain="A/swine/North Carolina/A01945726/2015"
                     /serotype="H3N2"
                     /isolation_source="lung"
                     /host="swine"
                     /db_xref="taxon:1755982"
                     /segment="4"
                     /country="USA: North Carolina"
                     /collection_date="19-Oct-2015"