Sign in to follow this  
Followers 0
niman

MERS Sequences from Nigerian Camels - 2015

5 posts in this topic

LOCUS       KU201953                4062 bp    RNA     linear   VRL 16-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate Nigeria-HKU004
            spike protein (S) gene, complete cds.
ACCESSION   KU201953
VERSION     KU201953.1  GI:961442027
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 4062)
  AUTHORS   Chu,D.K., Oladipo,J.O., Perera,R.A., Kuranga,S.A., Chan,S.M.,
            Poon,L.L. and Peiris,M.
  TITLE     Middle East respiratory syndrome coronavirus (MERS-CoV) in
            dromedary camels in Nigeria, 2015
  JOURNAL   Euro Surveill. 20 (49), 3 (2015)
REFERENCE   2  (bases 1 to 4062)
  AUTHORS   Chu,D.K.W., Oladipo,J.O., Perera,R.A.P.M., Kuranga,S.A.,
            Chan,S.M.S., Poon,L.L.M. and Peiris,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2015) School of Public Health, The University of
            Hong Kong, No. 21, Sassoon Road, Pokfulam, Hong Kong SAR
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. 8.1.7
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4062
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="Nigeria-HKU004"
                     /host="Camelus dromedarius"
                     /db_xref="taxon:1335626"
                     /country="Nigeria"
                     /collection_date="13-Jan-2015"
     gene            1..4062
                     /gene="S"
     CDS             1..4062
                     /gene="S"
                     /codon_start=1
                     /product="spike protein"
                     /protein_id="ALS20350.1"
                     /db_xref="GI:961442028"
                     /translation="MIHSVFLLMFLLTPTESYVDVGPDSAKSACIEVDIQQTFFDKTW
                     PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
                     ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
                     MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNYCPAGNSYTSFATYHTPATDCSDGN
                     YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
                     NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
                     RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
                     PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
                     SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
                     DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
                     LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
                     VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVTVPVSVIYDKETKTHATLFGSVACEHI
                     SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
                     TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
                     IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSY
                     QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMH
                     QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
                     AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFQKVQDAVNNNA
                     QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
                     SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
                     IEVVSAYGLCDLANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSFNTKY
                     VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
                     TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
                     TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
ORIGIN      
        1 atgatacact cagtgtttct actgatgttc ttgttaacac ctacagaaag ttacgttgat
       61 gtagggccag attctgctaa gtctgcttgt attgaggttg atatacaaca gactttcttt
      121 gataaaactt ggcctaggcc aattgatgtt tctaaggctg acggtattat ataccctcaa
      181 ggccgtacat attctaacat aactatcact tatcaaggtc tttttcccta tcagggagac
      241 catggtgata tgtatgttta ctctgcagga catgctacag gcacaactcc acaaaagttg
      301 tttgtagcta actattctca ggacgtcaaa cagtttgcta atgggtttgt cgtccgtata
      361 ggagcagctg ccaattccac tggcactgtt attattagcc catctaccag cgctactata
      421 cgaaaaattt accctgcttt tatgctgggt tcttcagttg gtaatttctc agatggtaaa
      481 atgggccgct tcttcaatca tactctagtt cttttgcccg atggatgtgg cactttactt
      541 agagcttttt attgtattct agagcctcgc tctggaaatt attgtcctgc tggcaattcc
      601 tatacttctt ttgccactta tcacactcct gcaacagatt gttctgatgg caattacaat
      661 cgtaatgcca gtctgaactc ttttaaggag tattttaatt tacgtaactg cacctttatg
      721 tacacttata acattaccga agatgagatt ttagagtggt ttggcattac acaaactgct
      781 caaggtgttc acctcttctc atctcggtat gttgatttgt acggcggcaa tatgtttcaa
      841 tttgccacct tgcctgttta tgatactatt aagtattatt ctatcattcc tcacagtatt
      901 cgttctatcc aaagtgatag aaaagcttgg gctgccttct acgtatataa acttcaaccg
      961 ttaactttcc tgttggattt ttctgttgat ggttatatac gcagagctat agactgtggt
     1021 tttaatgatt tgtcacaact ccactgctca tatgaatcct tcgatgttga atctggagtt
     1081 tattcagttt cgtctttcga agcaaaacct tctggctcag ttgtggaaca ggctgaaggt
     1141 gttgaatgtg atttttcacc tcttctgtct ggcacacctc ctcaggttta taatttcaag
     1201 cgtttggttt ttaccaattg caattataat cttaccaaat tgctttcact tttttctgtg
     1261 aatgatttca cttgtagtca aatatctcca gcagcaattg ctagcaactg ttattcttca
     1321 ctgattttgg attacttttc atacccactt agtatgaaat ccgatctcag tgttagttct
     1381 gctggtccaa tatcccagtt taattataaa cagtcctttt ctaatcccac atgtttgatt
     1441 ttagcgactg ttcctcataa ccttactact attactaagc ctcttaagta cagctatatt
     1501 aacaagtgct ctcgtcttct ttctgatgat cgtactgaag tacctcagtt agtgaacgct
     1561 aatcaatact caccctgtgt atccattgtc ccatccactg tgtgggaaga cggtgattat
     1621 tataggaaac aactatctcc acttgaaggt ggtggctggc ttgttgctag tggctcaact
     1681 gttgccatga ctgagcaatt acagatgggc tttggtatta cagttcaata tggtacagac
     1741 accaatagtg tttgccccaa gcttgaattt gctaatgaca caaaaattgc ctctcaatta
     1801 ggcaattgcg tggaatattc cctctatggt gtttcgggcc gtggtgtttt tcagaattgc
     1861 acagctgtag gtgttcgaca gcagcgcttt gtttatgatg cgtaccagaa tttagttggc
     1921 tattattctg atgatggcaa ctactactgt ttgcgtgctt gtgttactgt tcctgtttct
     1981 gtcatctatg ataaagaaac taaaacccac gctactctat ttggtagtgt tgcatgtgaa
     2041 cacatttctt ctaccatgtc tcaatactcc cgttctacgc gatcaatgct taaacggcga
     2101 gattctacat atggccccct tcagacacct gttggttgtg tcctaggact tgttaattcc
     2161 tctttgttcg tagaggactg caagttgcct cttggtcaat ctctctgtgc tcttcctgac
     2221 acacctagta ctctcacacc tcgcagtgtg cgctctgttc caggtgaaat gcgcttggca
     2281 tccattgctt ttaatcatcc tattcaggtt gatcaactta atagtagtta ttttaaatta
     2341 agtataccca ctaatttttc ctttggtgtg actcaggagt acattcagac aaccattcag
     2401 aaagttactg ttgattgtaa acagtacgtt tgcaatggtt ttcagaagtg tgagcaatta
     2461 ctgcgcgagt atggccagtt ttgttccaaa ataaaccagg cgctccatgg tgccaattta
     2521 cgccaggatg attctgtacg taatttgttt gcgagcgtga aaagctatca atcatctcct
     2581 atcataccag gttttggagg tgactttaat ttgacacttc tagaacctgt ttctatatct
     2641 actggcagtc gtagtgcacg tagtgctatt gaggatttgc tatttgacaa agtcactata
     2701 gctgatcctg gttatatgca aggttacgat gattgcatgc atcaaggtcc agcatcagct
     2761 cgtgatctta tttgtgctca atatgtggct ggttacaaag tattacctcc tcttatggat
     2821 gttaatatgg aagccgcgta tacttcatct ttgcttggca gcatagcagg tgttggctgg
     2881 actgctgggt tatcctcctt tgctgctatt ccatttgcac agagtatctt ttataggtta
     2941 aacggtgttg gcattactca acaggttctt tcagagaacc aaaagcttat tgccaataag
     3001 tttaatcagg ctctgggagc tatgcaaaca ggcttcacta caactaatga agcttttcag
     3061 aaggttcagg atgctgtgaa caacaatgca caggctctat ccaaattagc tagcgagcta
     3121 tctaatacct ttggtgctat ttccgcctct attggagaca tcatacaacg tcttgatgtt
     3181 ctcgaacagg acgcccaaat agacagactt attaatggcc gtttgacaac actaaatgct
     3241 tttgttgcgc agcagcttgt tcgttccgaa tcagctgctc tttcggctca attggctaaa
     3301 gataaagtca atgagtgtgt caaggcacaa tccaagcgtt ctggattttg cggtcaaggc
     3361 acacatatag tgtcctttgt tgtaaatgcc cctaatggcc tttacttcat gcatgttggt
     3421 tattacccta gcaaccacat tgaggttgtt tctgcttatg gtctttgcga tttagctaac
     3481 cctactaatt gtatagcccc tgttaatggc tactttatta aaactaataa cactaggatt
     3541 gttgatgagt ggtcatatac tggctcgtcc ttctatgcac ctgagcccat cacctccttt
     3601 aatactaagt atgttgcacc acaggtgaca taccaaaaca tttctactaa cctccctcct
     3661 cctcttctcg gcaattccac cgggattgac tttcaagatg agttggatga gtttttcaaa
     3721 aatgttagca ccagtatacc taattttggt tctctaacac agattaatac tacattactc
     3781 gatcttacct acgagatgtt gtctcttcaa caagttgtta aagcccttaa tgagtcttac
     3841 atagacctta aagagcttgg caattatact tattacaaca aatggccgtg gtacatttgg
     3901 cttggtttca ttgctgggct tgttgcctta gctctatgcg tcttcttcat actgtgctgc
     3961 actggttgtg gcacaaattg tatgggaaaa cttaagtgta atcgttgttg tgatagatat
     4021 gaggaatacg acctcgagcc gcataaggtt catgttcact aa

Share this post


Link to post
Share on other sites
72457245100%0.099%KC776174.1
72407240100%0.099%KJ614529.1
72367236100%0.099%JX869059.2
72217221100%0.099%KF917527.1
72217221100%0.099%KJ556336.1
72217221100%0.099%KJ156949.1
72187218100%0.099%KJ156944.1
72187218100%0.099%KJ156881.1
72187218100%0.099%KF192507.1
72187218100%0.099%KC164505.2
72187218100%0.099%KC667074.1
72127212100%0.099%KP966104.1
72127212100%0.099%KJ361503.1
72127212100%0.099%KJ713296.1
72127212100%0.099%KJ156952.1
72127212100%0.099%KF600652.1
72127212100%0.099%KF600620.1
72127212100%0.099%KF600612.1
72117211100%0.099%KJ361500.1
72117211100%0.099%KJ361499.1
72097209100%0.099%KR011266.1
72097209100%0.099%KR011264.1
72097209100%0.099%KR011263.1
72097209100%0.099%KJ361501.1
72097209100%0.099%KM027261.1
72097209100%0.099%KM027260.1
72097209100%0.099%KM027259.1
72097209100%0.099%KM027257.1
72097209100%0.099%KM027256.1
72097209100%0.099%KM027255.1
72097209100%0.099%KM027263.1
72097209100%0.099%KJ650098.1
72097209100%0.099%KJ713295.1
72097209100%0.099%KJ156876.1
72097209100%0.099%KF745068.1
72097209100%0.099%KF600630.1
72057205100%0.099%KR011265.1
72057205100%0.099%KJ782549.1
72057205100%0.099%KF600613.1
72037203100%0.099%KT121580.1
72037203100%0.099%KT121577.1
72037203100%0.099%KT121576.1
72037203100%0.099%KT121575.1
72037203100%0.099%KT121574.1
72037203100%0.099%KT121573.1
72037203100%0.099%KT121572.1
72037203100%0.099%KP223131.1
72037203100%0.099%KM027262.1
72037203100%0.099%KM027258.1
72037203100%0.099%KM027281.1
72037203100%0.099%KM027278.1
72037203100%0.099%KM027276.1
72037203100%0.099%KM027275.1
72037203100%0.099%KM027274.1
72037203100%0.099%KM027271.1
72037203100%0.099%KM027270.1
72037203100%0.099%KM027268.1
72037203100%0.099%KJ829365.1
72037203100%0.099%KJ813439.1
72037203100%0.099%KJ713298.1
72027202100%0.099%KM027273.1
72027202100%0.099%KF811036.1
72007200100%0.099%KM210278.1
72007200100%0.099%KM015348.1
71967196100%0.099%KF600645.1
71947194100%0.099%KT121578.1
71947194100%0.099%KM210277.1
71947194100%0.099%KJ713297.1
71947194100%0.099%KJ156939.1
71947194100%0.099%KJ156872.1
71947194100%0.099%KJ156869.1
71947194100%0.099%KJ156866.1
71947194100%0.099%KF600651.1
71947194100%0.099%KF600647.1
71947194100%0.099%KF600644.1
71947194100%0.099%KF600636.1
71947194100%0.099%KF600632.1
71947194100%0.099%KF600627.1
71947194100%0.099%KF600623.1
71947194100%0.099%KF186565.1
71947194100%0.099%KF186567.1
71947194100%0.099%KF186566.1
71947194100%0.099%KF186564.1
71917191100%0.099%KT121581.1
71917191100%0.099%KT225476.2
71917191100%0.099%KT026453.1
71917191100%0.099%KP209313.1
71917191100%0.099%KP209309.1
71917191100%0.099%KP209306.1
71917191100%0.099%KJ156901.1
71917191100%0.099%KJ156874.1
71917191100%0.099%KF600643.1
71917191100%0.099%KF600634.1
71877187100%0.099%KP209308.1
71857185100%0.099%KT121579.1
71857185100%0.099%KP405226.1
71857185100%0.099%KP405225.1
71857185100%0.099%KT156561.1
71857185100%0.099%KT156560.1
71857185100%0.099%KT026454.1

Share this post


Link to post
Share on other sites
LOCUS       KU201959                5347 bp    RNA     linear   VRL 16-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate Nigeria-HKU004
            ORF1b gene, partial cds.
ACCESSION   KU201959
VERSION     KU201959.1  GI:961442039
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 5347)
  AUTHORS   Chu,D.K., Oladipo,J.O., Perera,R.A., Kuranga,S.A., Chan,S.M.,
            Poon,L.L. and Peiris,M.
  TITLE     Middle East respiratory syndrome coronavirus (MERS-CoV) in
            dromedary camels in Nigeria, 2015
  JOURNAL   Euro Surveill. 20 (49), 3 (2015)
REFERENCE   2  (bases 1 to 5347)
  AUTHORS   Chu,D.K.W., Oladipo,J.O., Perera,R.A.P.M., Kuranga,S.A.,
            Chan,S.M.S., Poon,L.L.M. and Peiris,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2015) School of Public Health, The University of
            Hong Kong, No. 21, Sassoon Road, Pokfulam, Hong Kong SAR
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. 8.1.7
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5347
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="Nigeria-HKU004"
                     /host="Camelus dromedarius"
                     /db_xref="taxon:1335626"
                     /country="Nigeria"
                     /collection_date="13-Jan-2015"
     CDS             <1..>5347
                     /codon_start=3
                     /product="ORF1b"
                     /protein_id="ALS20356.1"
                     /db_xref="GI:961442040"
                     /translation="NLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGAT
                     CVIGTTKFYGGWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGT
                     CCTTRDRFYRLANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTA
                     NVSALMGANGNKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSD
                     DGVVCYNSDYAAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTL
                     YIKDGDDGYFLPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIE
                     YQNVFWVYLQYIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAV
                     GSCVVCHSQTSLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDV
                     TKLYLGGMSYFCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESG
                     DYTLANTTTEPLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPL
                     NRNYVFTGYHITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVAT
                     LMAPTIVNQERYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFA
                     IGLAIYYPTARVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNE
                     TNSQYLFSTINALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAP
                     RTLLTRGTLEPENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKE
                     LSGQCFKILYKGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARS
                     ILGLTTQTVDSSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALF
                     DSLEFTELSFTNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVN
                     LNLPANVPYSRVISRMGFKLDATIPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNA
                     CGTNVPLQLGFSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAA
                     WPIVRRRIVQMLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAA
                     YSSPLQSYACWTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDA
                     IMTRCLAIHSCFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDI
                     GNPKGIPIVDDPVVDWHYFDAQPLTRKVQQLFYTEDMASSFADGLCLFWNCNVPKYPN
                     NAIVCRFDTRVHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPC
                     EVHGNGSMIEDIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLW
                     CYKTFDIYNLWSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDI
                     CMFENKTTLPTNIAFELYAKRAVRSHPDFKFLHNLQADICYKFVLWDYERSNIYGTAT
                     IGVCKYTDIDVNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYF
                     NGAIIRDSDVVKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFD
                     SDVFIKKYGLEKYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSS"
ORIGIN      
        1 tgaatctaaa atatgctatt agtgctaaga atagagctcg cactgttgca ggcgtgtcca
       61 tacttagcac aatgactaat cgccagtacc atcagaaaat gcttaagtcc atggctgcaa
      121 ctcgtggagc gacttgcgtc attggtacta caaagttcta tggtggctgg gatttcatgc
      181 ttaaaacatt gtacaaagat gttgataatc cgcatcttat gggttgggat taccctaagt
      241 gtgatagagc tatgcctaat atgtgtagaa tcttcgcttc actcatatta gctcgtaaac
      301 atggcacttg ttgtactaca agggacagat tttatcgctt ggcaaatgag tgtgctcagg
      361 tgctaagcga atatgttcta tgtggtggtg gttactacgt caaacctgga ggtaccagta
      421 gcggagatgc caccactgca tatgccaata gtgtctttaa cattttgcag gcgacaactg
      481 ctaatgtcag tgcacttatg ggtgctaatg gcaacaagat tgttgacaaa gaagttaaag
      541 acatgcagtt tgatttgtat gtcaatgttt acaggagcac tagcccagac cccaaatttg
      601 ttgataaata ctatgctttt cttaataagc acttttctat gatgatactg tctgatgacg
      661 gtgtcgtttg ctataatagt gattatgcag ctaagggtta cattgctgga atacagaatt
      721 ttaaggaaac gctgtattat cagaacaatg tctttatgtc tgaagctaaa tgctgggtgg
      781 aaaccgatct gaagaaaggg ccacatgaat tctgttcaca gcatacgctt tatattaagg
      841 atggcgacga tggttacttc cttccttatc cagacccttc aagaattttg tctgccggtt
      901 gctttgtaga tgacatcgtt aagactgacg gtacactcat ggtagagcgg tttgtgtctt
      961 tggctataga tgcttaccct ctcacaaagc atgaagatat agaataccag aatgtattct
     1021 gggtctactt acagtatata gaaaaactgt ataaagacct tacaggacac atgcttgaca
     1081 gttattctgt catgctatgt ggtgataatt ctgctaagtt ttgggaagag gcattctata
     1141 gagatctcta tagttcgcct accactttgc aggctgtcgg ttcatgcgtt gtatgccatt
     1201 cacagacttc cttacgctgt gggacatgca tccgtagacc atttctctgt tgtaaatgct
     1261 gctatgatca tgttatagca actccacata agatggtttt gtctgtttct ccttacgttt
     1321 gtaatgcccc tggttgtggc gtttcagacg ttactaagct atatttaggt ggtatgagct
     1381 acttttgtgt agatcataga cctgtgtgta gttttccact ttgcgctaat ggtcttgtat
     1441 tcggcttata caagaatatg tgcacaggta gtccttctat agttgaattt aataggttgg
     1501 ctacctgtga ctggactgaa agtggtgatt acacccttgc caatactaca acagaaccac
     1561 tcaaactttt tgctgctgag actttacgtg ccactgaaga ggcgtctaag cagtcttatg
     1621 ctattgccac catcaaagaa attgttggtg agcgccaact attacttgtg tgggaggctg
     1681 gcaagtccaa accaccactc aatcgtaatt atgtttttac tggttatcat ataaccaaaa
     1741 atagtaaagt gcagctcggt gagtacatct tcgagcgcat tgattatagt gatgctgtat
     1801 cctacaagtc tagtacaacg tataaactga ctgtaggtga catcttcgta cttacctctc
     1861 actcggtggc taccttgatg gcgcccacaa ttgtgaatca agagaggtat gttaaaatta
     1921 ctgggttgta cccaaccatt acggtacctg aagagttcgc aagtcatgtt gccaacttcc
     1981 aaaaatcagg ttatagtaaa tatgtcactg ttcagggacc acctggcact ggcaaaagtc
     2041 attttgctat agggttagcg atttactacc ctacagcacg tgttgtttat acagcatgtt
     2101 cacacgcagc tgttgacgct ttgtgtgaaa aagcttttaa atatttgaac attgctaaat
     2161 gttcccgtat cattcctgca aaggcacgtg ttgagtgcta tgacaggttt aaagttaatg
     2221 agacaaattc tcaatatttg tttagtacta ttaatgctct accagaaact tctgccgata
     2281 ttctggtggt tgatgaggtt agtatgtgca ctaattatga tctttcaatt attaatgcac
     2341 gtattaaagc taagcacatt gtctatgtag gagatccagc acagttgcca gctcctagga
     2401 ctttgttgac tagaggcaca ttggaaccag aaaatttcaa tagtgtcact agattgatgt
     2461 gtaacttagg tcctgacata tttttaagta tgtgctacag gtgtcctaag gaaatagtaa
     2521 gcactgtgag tgctcttgtc tacaataata aattgttagc caagaaggag ctttcaggcc
     2581 agtgctttaa aatactctat aagggcaatg tgacgcatga tgctagctct gccattaata
     2641 gaccacaact cacatttgtg aagaatttta ttactgccaa tccggcatgg agtaaggcag
     2701 tctttatttc gccttataat tcacagaatg ctgtggctcg ttcaattctg ggtcttacca
     2761 ctcagactgt tgattcctca cagggttcag aataccagta tgttatcttc tgtcaaacag
     2821 cagatacggc acatgctaac aacattaaca gatttaatgt tgcaatcact cgtgcccaaa
     2881 aaggtattct ttgtgttatg acatctcagg cactctttga ttccttagag tttactgaat
     2941 tgtcttttac taattacaag ctccagtctc agattgtaac tggccttttt aaagattgct
     3001 ctagagaaac ttctggcctc tcacctgctt atgcaccaac atacgttagt gttgatgaca
     3061 agtataagac gagtgatgag ctttgcgtga atcttaattt acccgcaaat gtcccatact
     3121 ctcgtgttat ttccaggatg ggctttaaac tcgatgcaac aattcctgga tatcctaagc
     3181 ttttcattac tcgtgaagag gctgtaaggc aagttcgaag ctggataggc ttcgatgttg
     3241 agggtgctca tgcttcccgt aatgcatgtg gcaccaatgt gcctctacaa ttaggatttt
     3301 caactggtgt gaactttgtt gttcagccag ttggtgttgt agacactgag tggggtaaca
     3361 tgttaacggg cattgctgcc cgtcctccac caggtgaaca gtttaagcac ctcgtgcctc
     3421 ttatgcataa gggggctgca tggcctattg ttagacgacg tatagtgcaa atgttgtccg
     3481 acactttaga caaattgtct gattactgta cgtttgtttg ttgggctcat ggctttgaat
     3541 taacgtctgc atcatacttt tgcaagatag gtaaggaaca gaagtgttgc atgtgcaata
     3601 gacgcgctgc agcgtactct tcacctctgc aatcttatgc ctgctggact cattcctgcg
     3661 gttatgatta tgtctacaac cctttctttg tcgatgttca acagtggggt tatgtaggca
     3721 atcttgctac taatcacgat cgttattgct ctgtccatca aggagctcat gtggcttcta
     3781 atgatgcaat aatgactcgt tgtttagcta ttcattcttg ttttatagaa cgtgtggatt
     3841 gggatataga gtatccttat atctcacatg aaaagaaatt gaattcctgt tgtagaatcg
     3901 ttgagcgcaa cgtcgtacgt gctgctcttc ttgccggttc atttgacaaa gtctatgata
     3961 ttggcaatcc taaaggaatt cctattgttg atgaccctgt ggttgattgg cattattttg
     4021 atgcacagcc cttgaccagg aaggtacaac agcttttcta tacagaggac atggcctcaa
     4081 gttttgctga tgggctctgc ttattttgga actgtaatgt accaaaatat cctaataatg
     4141 caattgtatg caggtttgac acacgtgtgc attctgagtt caatttgcca ggttgtgatg
     4201 gcggtagttt gtatgttaac aagcacgctt ttcatacacc agcatatgat gtgagtgcat
     4261 tccgtgatct gaaaccttta ccattctttt attattctac tacaccatgt gaagtgcatg
     4321 gtaatggtag tatgatagag gatattgatt atgtacccct aaaatctgca gtctgtatta
     4381 cagcttgtaa tttagggggc gctgtttgta ggaagcatgc tacagagtac agagagtata
     4441 tggaagcata taatcttgtc tctgcatcag gtttccgcct ttggtgttat aagacctttg
     4501 atatttataa tctctggtct acttttacaa aagttcaagg tttggaaaac attgctttta
     4561 atgttgttaa acaaggccat tttattggtg ttgagggtga actacctgta gctgtagtca
     4621 atgataagat cttcaccaag agtggcgtta atgacatttg tatgtttgag aataaaacca
     4681 ctttgcctac taatatagct tttgaactct atgctaagcg tgccgtacgc tcgcatcccg
     4741 atttcaaatt tctacacaat ttacaagcag acatttgtta taagttcgtc ctttgggatt
     4801 atgaacgtag caatatttat ggtactgcta ctattggtgt atgtaagtac actgatattg
     4861 atgttaattc agctttgaat atatgttttg acatacgcga taatggttca ttggagaaat
     4921 tcatgtctac tcccaatgcc atctttattt ctgatagaaa aatcaagaaa tacccttgta
     4981 tggtaggtcc tgattatgct tacttcaatg gtgctatcat ccgtgatagt gatgttgtta
     5041 aacaaccagt gaagttctac ttgtataaga aagtcaataa tgagtttatt gatcctactg
     5101 agtgtattta cactcagagt cgctcttgta gtgacttcct acccctgtct gacatggaga
     5161 aagactttct atcttttgat agtgatgttt tcattaagaa gtatggcttg gaaaaatatg
     5221 cttttgagca cgtagtctat ggagacttct ctcatactac gttaggcggt cttcacttgc
     5281 ttattggttt atacaagaag caacaggaag gtcatattat tatggaagaa atgctaaaag
     5341 gtagctc

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
95489548100%0.099%KJ713298.1
95449544100%0.099%KJ713296.1
95449544100%0.099%KJ156942.1
95449544100%0.099%KJ156910.1
95449544100%0.099%KJ156874.1
95449544100%0.099%KF600652.1
95449544100%0.099%KF600630.1
95449544100%0.099%KF600628.1
95449544100%0.099%KF192507.1
95399539100%0.099%KM210277.1
95399539100%0.099%KP223131.1
95399539100%0.099%KM027261.1
95399539100%0.099%KM027259.1
95399539100%0.099%KM027258.1
95399539100%0.099%KM027256.1
95399539100%0.099%KM027255.1
95399539100%0.099%KM015348.1
95399539100%0.099%KJ829365.1
95399539100%0.099%KJ477102.1
95399539100%0.099%KJ156916.1
95399539100%0.099%KJ156952.1
95399539100%0.099%KJ156881.1
95399539100%0.099%KJ156866.1
95399539100%0.099%KF961222.1
95399539100%0.099%KF600651.1
95399539100%0.099%KF600636.1
95399539100%0.099%KF600634.1
95399539100%0.099%KF600627.1
95399539100%0.099%KF186565.1
95399539100%0.099%KF186567.1
95399539100%0.099%KF186566.1
95399539100%0.099%KF186564.1
95379537100%0.099%KM210278.1
95359535100%0.099%KT121581.1
95359535100%0.099%KT121580.1
95359535100%0.099%KT121579.1
95359535100%0.099%KT121577.1
95359535100%0.099%KT121576.1
95359535100%0.099%KT121575.1
95359535100%0.099%KT121574.1
95359535100%0.099%KT121573.1
95359535100%0.099%KT121572.1
95359535100%0.099%KT156560.1
95359535100%0.099%KM027257.1
95359535100%0.099%KJ650098.1
95359535100%0.099%KJ713297.1
95359535100%0.099%KJ614529.1
95359535100%0.099%KF917527.1
95359535100%0.099%KJ156941.1
95359535100%0.099%KJ156949.1
95359535100%0.099%KJ156944.1
95359535100%0.099%KJ156869.1
95359535100%0.099%KF600645.1
95359535100%0.099%KF600644.1
95359535100%0.099%KF600632.1
95359535100%0.099%KF600613.1
95359535100%0.099%KC164505.2
95359535100%0.099%KC776174.1
95359535100%0.099%KC667074.1
95339533100%0.099%KF600643.1
95329532100%0.099%KF961221.1
95309530100%0.099%KT121578.1
95309530100%0.099%KT029139.1
95309530100%0.099%KJ361503.1
95309530100%0.099%KJ361502.1
95309530100%0.099%KJ361500.1
95309530100%0.099%KJ361499.1
95309530100%0.099%KP209312.1
95309530100%0.099%KM027260.1
95309530100%0.099%KJ713295.1
95309530100%0.099%KJ650297.1
95309530100%0.099%KJ650296.1
95309530100%0.099%KJ650295.1
95309530100%0.099%KJ156934.1
95309530100%0.099%KF600647.1
95309530100%0.099%KF600612.1
95269526100%0.099%KT374057.1
95269526100%0.099%KT374056.1
95269526100%0.099%KT374055.1
95269526100%0.099%KT374054.1
95269526100%0.099%KT374052.1
95269526100%0.099%KT374051.1
95269526100%0.099%KT374050.1
95269526100%0.099%KT156561.1
95269526100%0.099%KT036374.1
95269526100%0.099%KT036373.1
95269526100%0.099%KT036372.1
95269526100%0.099%KT006149.2
95269526100%0.099%KJ361501.1
95269526100%0.099%KP209313.1
95269526100%0.099%KP209309.1
95269526100%0.099%KP209307.1
95269526100%0.099%KP209306.1
95269526100%0.099%KJ813439.1
95269526100%0.099%KF745068.1
95239523100%0.099%KJ556336.1
95219521100%0.099%KT374053.1
95219521100%0.099%KT026453.1
95219521100%0.099%KP719933.1
95219521100%0.099%KP719932.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.