Sign in to follow this  
Followers 0
niman

Partial Zika ENV Sequences - Oceania SE Asia = Singapore?

28 posts in this topic

Public Health Virology in Australia has released a series of related partial (1512 BP of env gene) sequences from a geographical range of cases with most from Oceania or Southeast Asia.  The sequences are also related to those from Japan and China travelers to Oceania (Fiji and Samoa) and may be closely related to the recent cases in Singapore.

Share this post


Link to post
Share on other sites
1.

Zika virus isolate SIS58-2015 envelope protein gene, partial cds

1,512 bp linear RNA

Accession:
 
KX216632.1
 
GI:
 
1029979471
2.

Zika virus isolate VS51-2016 envelope protein gene, partial cds

1,512 bp linear RNA

Accession:
 
KX216633.1
 
GI:
 
1029979473
3.

Zika virus isolate TS14-2016 envelope protein gene, partial cds

1,512 bp linear RNA

Accession:
 
KX216634.1
 
GI:
 
1029979475
4.

Zika virus isolate TS17-2016 envelope protein gene, partial cds

1,512 bp linear RNA

Accession:
 
KX216635.1
 
GI:
 
1029979477
5.

Zika virus isolate SS27-2016 envelope protein gene, partial cds

1,512 bp linear RNA

Accession:
 
KX216636.1
 
GI:
 
1029979479
6.

Zika virus isolate GS29-2016 envelope protein gene, partial cds

1,512 bp linear RNA

Accession:
 
KX216637.1
 
GI:
 
1029979481
7.

Zika virus isolate ESS23-2015 envelope protein gene, partial cds

1,512 bp linear RNA

Accession:
 
KX216638.1
 
GI:
 
1029979483
8.

Zika virus isolate SS57-2016 envelope protein gene, partial cds

1,512 bp linear RNA

Accession:
 
KX216639.1
 
GI:
 
1029979485
9.

Zika virus isolate CKS63-2014 envelope protein gene, partial cds

1,512 bp linear RNA

Accession:
 
KX216640.1
 
GI:
 
1029979487
10.

Zika virus isolate MS10-2016 envelope protein gene, partial cds

1,512 bp linear RNA

Accession:
 
KX380262.1
 
GI:
 
1036637436
11.

Zika virus isolate FS92-2016 envelope protein gene, partial cds

1,512 bp linear RNA

Accession:
 
KX380263.1
 
GI:
 
1036637438

Share this post


Link to post
Share on other sites

Study Details

First isolation of Zika virus in Australia from a clinical patient, imported from Tonga.

Pyke,A.T. and Moore,P.R.

 

 

Sequences in this data set

  • KX216636.1Zika virus isolate SS27-2016 envelope protein gene, partial cds
  • KX216635.1Zika virus isolate TS17-2016 envelope protein gene, partial cds
  • KX216634.1Zika virus isolate TS14-2016 envelope protein gene, partial cds
  • KX216633.1Zika virus isolate VS51-2016 envelope protein gene, partial cds
  • KX216632.1Zika virus isolate SIS58-2015 envelope protein gene, partial cds

Share this post


Link to post
Share on other sites

First isolation of Zika virus in Australia from a clinical patient, imported from Tonga.

Moore,P.R. and Pyke,A.T.

 

 

Sequences in this data set

  • KX216640.1Zika virus isolate CKS63-2014 envelope protein gene, partial cds
  • KX216639.1Zika virus isolate SS57-2016 envelope protein gene, partial cds
  • KX216638.1Zika virus isolate ESS23-2015 envelope protein gene, partial cds
  • KX216637.1Zika virus isolate GS29-2016 envelope protein gene, partial cds

Share this post


Link to post
Share on other sites
LOCUS       KX216634                1512 bp    RNA     linear   VRL 07-SEP-2016
DEFINITION  Zika virus isolate TS14-2016 envelope protein gene, partial cds.
ACCESSION   KX216634
VERSION     KX216634.1  GI:1029979475
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 1512)
  AUTHORS   Pyke,A.T. and Moore,P.R.
  TITLE     First isolation of Zika virus in Australia from a clinical patient,
            imported from Tonga
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1512)
  AUTHORS   Pyke,A.T. and Moore,P.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2016) Public Health Virology, Queensland Health
            Forensic and Scientific Services, 39 Kessels Road, Coopers Plains,
            QLD 4108, Australia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1512
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="TS14-2016"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Tonga"
                     /collection_date="2016"
                     /note="genotype: Asian"
     CDS             <1..>1512
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ANF28859.1"
                     /db_xref="GI:1029979476"
                     /translation="IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA"
ORIGIN      
        1 atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg tgggacttgg
       61 gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga caaaccgact
      121 gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag atcctactgc
      181 tatgaggcat caatatcgga catggcttcg gacagccgct gcccaacaca aggtgaagcc
      241 taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt ggacagaggc
      301 tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacatgcgc taagtttgca
      361 tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta ccggataatg
      421 ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg acatgaaact
      481 gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga agccaccctg
      541 gggggttttg gaagcctagg acttgattgt gaaccgagga caggccttga cttttcagat
      601 ttgtattact tgactatgaa taacaagcac tggttggttc acaaggagtg gttccacgac
      661 attccattac cttggcacgc tggggcagac accggaactc cacactggaa caacaaagaa
      721 gcactggtag agttcaagga cgcacatgcc aaaaggcaaa ctgtcgtggt tctagggagt
      781 caagaaggag cagttcacac ggcccttgct ggagctctgg aggctgagat ggatggtgca
      841 aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa acttagattg
      901 aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaagat cccggctgaa
      961 acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg accttgcaag
     1021 gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag gttgataacc
     1081 gctaaccccg tgatcactga aagcactgag aactctaaga tgatgctgga acttgatcca
     1141 ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac ccaccactgg
     1201 cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg tgccaagaga
     1261 atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc tctcaactca
     1321 ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt tggaggaatg
     1381 tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggtct gaacacaaag
     1441 aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt cttatccaca
     1501 gccgtctctg ct

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
2727 2727 100% 0.0 100% KX216634.1
2722 2722 100% 0.0 99% KX447521.1
2722 2722 100% 0.0 99% KX447509.1
2718 2718 100% 0.0 99% KX216635.1
2718 2718 100% 0.0 99% KX806557.1
2718 2718 100% 0.0 99% KJ776791.2
2718 2718 100% 0.0 99% KX447520.1
2718 2718 100% 0.0 99% KX447519.1
2718 2718 100% 0.0 99% KX447518.1
2718 2718 100% 0.0 99% KX447516.1
2718 2718 100% 0.0 99% KX447515.1
2718 2718 100% 0.0 99% KX447513.1
2718 2718 100% 0.0 99% KX447510.1
2718 2718 100% 0.0 99% KX576684.1
2718 2718 100% 0.0 99% KX369547.1
2718 2718 100% 0.0 99% KX280026.1
2718 2718 100% 0.0 99% KX262887.1
2713 2713 100% 0.0 99% KX216638.1
2713 2713 100% 0.0 99% KX216637.1
2713 2713 100% 0.0 99% KX216632.1
2713 2713 100% 0.0 99% KX694534.1
2713 2713 100% 0.0 99% KX447514.1
2713 2713 100% 0.0 99% KX447511.1
2713 2713 100% 0.0 99% KX446951.1
2713 2713 100% 0.0 99% KX247632.1
2713 2713 100% 0.0 99% KX051563.1
2713 2713 100% 0.0 99% KU509998.3
2713 2713 100% 0.0 99% KU991811.1
2713 2713 100% 0.0 99% KU646828.1
2709 2709 100% 0.0 99% KX380263.1
2709 2709 100% 0.0 99% KX216640.1
2709 2709 100% 0.0 99% KX216636.1
2709 2709 100% 0.0 99% KX197205.1
2709 2709 100% 0.0 99% KX447512.1
2709 2709 100% 0.0 99% KX266255.1
2709 2709 100% 0.0 99% KX446950.1
2709 2709 100% 0.0 99% KU866423.2
2709 2709 100% 0.0 99% KU758871.1
2709 2709 100% 0.0 99% KU758870.1
2709 2709 100% 0.0 99% KX253996.1
2709 2709 100% 0.0 99% KX247646.1
2709 2709 100% 0.0 99% KX198135.1
2709 2709 100% 0.0 99% KX197192.1
2709 2709 100% 0.0 99% KX185891.1
2709 2709 100% 0.0 99% KX156776.1
2709 2709 100% 0.0 99% KX156775.1
2709 2709 100% 0.0 99% KX156774.1
2709 2709 100% 0.0 99% KX117076.1
2709 2709 100% 0.0 99% KU963796.1
2709 2709 100% 0.0 99% KU955589.1
2709 2709 100% 0.0 99% KU870645.1
2709 2709 100% 0.0 99% KU922960.1
2709 2709 100% 0.0 99% KU922923.1
2709 2709 100% 0.0 99% KU820899.2
2709 2709 100% 0.0 99% KU729218.1
2709 2709 100% 0.0 99% KU527068.1
2709 2709 100% 0.0 99% KU647676.1
2709 2709 100% 0.0 99% KU321639.1
2706 2706 100% 0.0 99% KX766028.1
2704 2704 100% 0.0 99% KX380262.1
2704 2704 100% 0.0 99% KX216633.1
2704 2704 100% 0.0 99% KU820897.5
2704 2704 100% 0.0 99% KX766029.1
2704 2704 100% 0.0 99% KX447517.1
2704 2704 100% 0.0 99% KX520666.1
2704 2704 100% 0.0 99% KU758877.1
2704 2704 100% 0.0 99% KU758873.1
2704 2704 100% 0.0 99% KU758869.1
2704 2704 100% 0.0 99% KU937936.1
2704 2704 100% 0.0 99% KX087102.1
2704 2704 100% 0.0 99% KU940228.1
2704 2704 100% 0.0 99% KU926309.1
2704 2704 100% 0.0 99% KU497555.1
2704 2704 100% 0.0 99% KU501217.1
2704 2704 100% 0.0 99% KU501216.1
2704 2704 100% 0.0 99% KU365778.1
2704 2704 100% 0.0 99% KU312315.1
2704 2704 100% 0.0 99% KU312314.1
2704 2704 100% 0.0 99% KJ634273.1
2700 2700 100% 0.0 99% KX702400.1
2700 2700 100% 0.0 99% LC171327.1
2700 2700 100% 0.0 99% KX548902.1
2700 2700 100% 0.0 99% KX377337.1
2700 2700 100% 0.0 99% KU758874.1
2700 2700 100% 0.0 99% KU758868.1
2700 2700 100% 0.0 99% KU820898.1
2700 2700 100% 0.0 99% KU740184.2
2700 2700 100% 0.0 99% KU853013.1
2700 2700 100% 0.0 99% KU853012.1
2700 2700 100% 0.0 99% KU761564.1
2700 2700 100% 0.0 99% KU707826.1
2700 2700 100% 0.0 99% KU646827.1
2700 2700 100% 0.0 99% KU501215.1
2700 2700 100% 0.0 99% KU365780.1
2700 2700 100% 0.0 99% KU365779.1
2700 2700 100% 0.0 99% KU365777.1
2695 2695 100% 0.0 99% KX673530.1
2695 2695 100% 0.0 99% KX601168.1
2695 2695 100% 0.0 99% KX087101.2
2695 2695 100% 0.0 99% KX056898.1

Share this post


Link to post
Share on other sites
LOCUS       KX216635                1512 bp    RNA     linear   VRL 07-SEP-2016
DEFINITION  Zika virus isolate TS17-2016 envelope protein gene, partial cds.
ACCESSION   KX216635
VERSION     KX216635.1  GI:1029979477
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 1512)
  AUTHORS   Pyke,A.T. and Moore,P.R.
  TITLE     First isolation of Zika virus in Australia from a clinical patient,
            imported from Tonga
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1512)
  AUTHORS   Pyke,A.T. and Moore,P.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2016) Public Health Virology, Queensland Health
            Forensic and Scientific Services, 39 Kessels Road, Coopers Plains,
            QLD 4108, Australia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1512
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="TS17-2016"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Tonga"
                     /collection_date="2016"
                     /note="genotype: Asian"
     CDS             <1..>1512
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ANF28860.1"
                     /db_xref="GI:1029979478"
                     /translation="IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA"
ORIGIN      
        1 atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg tgggacttgg
       61 gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga caaaccgact
      121 gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag atcctactgc
      181 tatgaggcat caatatcgga catggcttcg gacagccgct gcccaacaca aggtgaagcc
      241 taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt ggacagaggc
      301 tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacatgcgc taagtttgca
      361 tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta ccggataatg
      421 ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg acatgaaact
      481 gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga agccaccctg
      541 gggggttttg gaagcctagg acttgattgt gaaccgagga caggccttga cttttcagat
      601 ttgtattact tgactatgaa taacaagcac tggttggttc acaaggagtg gttccacgac
      661 attccattac cttggcacgc tggggcagac accggaactc cacactggaa caacaaagaa
      721 gcactggtag agttcaagga cgcacatgcc aaaaggcaaa ctgtcgtggt tctagggagt
      781 caagaaggag cagttcacac ggcccttgct ggagctctgg aggctgagat ggatggtgca
      841 aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa acttagattg
      901 aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaagat cccggctgaa
      961 acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg accttgcaag
     1021 gtcccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag gttgataacc
     1081 gctaaccccg taatcactga aagcactgag aactctaaga tgatgctgga acttgatcca
     1141 ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac ccaccactgg
     1201 cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg tgccaagaga
     1261 atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc tctcaactca
     1321 ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt tggaggaatg
     1381 tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggtct gaacacaaag
     1441 aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt cttatccaca
     1501 gccgtctctg ct

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
2727 2727 100% 0.0 100% KX216635.1
2727 2727 100% 0.0 100% KX806557.1
2722 2722 100% 0.0 99% KX447521.1
2722 2722 100% 0.0 99% KX447509.1
2718 2718 100% 0.0 99% KX216634.1
2718 2718 100% 0.0 99% KJ776791.2
2718 2718 100% 0.0 99% KX447520.1
2718 2718 100% 0.0 99% KX447519.1
2718 2718 100% 0.0 99% KX447518.1
2718 2718 100% 0.0 99% KX447516.1
2718 2718 100% 0.0 99% KX447515.1
2718 2718 100% 0.0 99% KX447513.1
2718 2718 100% 0.0 99% KX447510.1
2718 2718 100% 0.0 99% KX576684.1
2718 2718 100% 0.0 99% KX369547.1
2718 2718 100% 0.0 99% KX280026.1
2718 2718 100% 0.0 99% KX262887.1
2713 2713 100% 0.0 99% KX216638.1
2713 2713 100% 0.0 99% KX216637.1
2713 2713 100% 0.0 99% KX216632.1
2713 2713 100% 0.0 99% KX694534.1
2713 2713 100% 0.0 99% KX447514.1
2713 2713 100% 0.0 99% KX447511.1
2713 2713 100% 0.0 99% KX446951.1
2713 2713 100% 0.0 99% KX247632.1
2713 2713 100% 0.0 99% KX051563.1
2713 2713 100% 0.0 99% KU509998.3
2713 2713 100% 0.0 99% KU991811.1
2713 2713 100% 0.0 99% KU646828.1
2709 2709 100% 0.0 99% KX380263.1
2709 2709 100% 0.0 99% KX216640.1
2709 2709 100% 0.0 99% KX216636.1
2709 2709 100% 0.0 99% KX197205.1
2709 2709 100% 0.0 99% KX447512.1
2709 2709 100% 0.0 99% KX266255.1
2709 2709 100% 0.0 99% KX446950.1
2709 2709 100% 0.0 99% KU866423.2
2709 2709 100% 0.0 99% KU758871.1
2709 2709 100% 0.0 99% KU758870.1
2709 2709 100% 0.0 99% KX253996.1
2709 2709 100% 0.0 99% KX247646.1
2709 2709 100% 0.0 99% KX198135.1
2709 2709 100% 0.0 99% KX197192.1
2709 2709 100% 0.0 99% KX185891.1
2709 2709 100% 0.0 99% KX156776.1
2709 2709 100% 0.0 99% KX156775.1
2709 2709 100% 0.0 99% KX156774.1
2709 2709 100% 0.0 99% KX117076.1
2709 2709 100% 0.0 99% KU963796.1
2709 2709 100% 0.0 99% KU955589.1
2709 2709 100% 0.0 99% KU870645.1
2709 2709 100% 0.0 99% KU922960.1
2709 2709 100% 0.0 99% KU922923.1
2709 2709 100% 0.0 99% KU820899.2
2709 2709 100% 0.0 99% KU729218.1
2709 2709 100% 0.0 99% KU527068.1
2709 2709 100% 0.0 99% KU647676.1
2709 2709 100% 0.0 99% KU321639.1
2706 2706 100% 0.0 99% KX766028.1
2704 2704 100% 0.0 99% KX380262.1
2704 2704 100% 0.0 99% KX216633.1
2704 2704 100% 0.0 99% KU820897.5
2704 2704 100% 0.0 99% KX766029.1
2704 2704 100% 0.0 99% KX447517.1
2704 2704 100% 0.0 99% KX520666.1
2704 2704 100% 0.0 99% KU758877.1
2704 2704 100% 0.0 99% KU758873.1
2704 2704 100% 0.0 99% KU758869.1
2704 2704 100% 0.0 99% KU937936.1
2704 2704 100% 0.0 99% KX087102.1
2704 2704 100% 0.0 99% KU940228.1
2704 2704 100% 0.0 99% KU926309.1
2704 2704 100% 0.0 99% KU497555.1
2704 2704 100% 0.0 99% KU501217.1
2704 2704 100% 0.0 99% KU501216.1
2704 2704 100% 0.0 99% KU365778.1
2704 2704 100% 0.0 99% KU312315.1
2704 2704 100% 0.0 99% KU312314.1
2704 2704 100% 0.0 99% KJ634273.1
2700 2700 100% 0.0 99% KX702400.1
2700 2700 100% 0.0 99% LC171327.1
2700 2700 100% 0.0 99% KX548902.1
2700 2700 100% 0.0 99% KX377337.1
2700 2700 100% 0.0 99% KU758874.1
2700 2700 100% 0.0 99% KU758868.1
2700 2700 100% 0.0 99% KU820898.1
2700 2700 100% 0.0 99% KU740184.2
2700 2700 100% 0.0 99% KU853013.1
2700 2700 100% 0.0 99% KU853012.1
2700 2700 100% 0.0 99% KU761564.1
2700 2700 100% 0.0 99% KU707826.1
2700 2700 100% 0.0 99% KU646827.1
2700 2700 100% 0.0 99% KU501215.1
2700 2700 100% 0.0 99% KU365780.1
2700 2700 100% 0.0 99% KU365779.1
2700 2700 100% 0.0 99% KU365777.1
2697 2697 100% 0.0 99% KU940224.1
2695 2695 100% 0.0 99% KX673530.1
2695 2695 100% 0.0 99% KX601168.1
2695 2695 100% 0.0 99% KX056898.1

Share this post


Link to post
Share on other sites
LOCUS       KX380263                1512 bp    RNA     linear   VRL 07-SEP-2016
DEFINITION  Zika virus isolate FS92-2016 envelope protein gene, partial cds.
ACCESSION   KX380263
VERSION     KX380263.1  GI:1036637438
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 1512)
  AUTHORS   Pyke,A.T. and Moore,P.R.
  TITLE     First isolation of Zika virus in Australia from a clinical patient,
            imported from Tonga
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1512)
  AUTHORS   Pyke,A.T. and Moore,P.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JUN-2016) Public Health Virology, Queensland Health
            Forensic and Scientific Services, 39 Kessels Road, Coopers Plains,
            QLD 4108, Australia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1512
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="FS92-2016"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Fiji"
                     /collection_date="2016"
                     /note="genotype: Asian"
     CDS             <1..>1512
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ANK57899.1"
                     /db_xref="GI:1036637439"
                     /translation="IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA"
ORIGIN      
        1 atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg tgggacttgg
       61 gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga caaaccgact
      121 gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag atcctactgc
      181 tatgaggcat caatatcgga catggcttcg gacagccgct gcccaacaca aggtgaagcc
      241 taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt ggacagaggc
      301 tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacctgcgc taagtttgca
      361 tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta ccggataatg
      421 ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg acatgaaact
      481 gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga agccaccctg
      541 gggggttttg gaagcctagg acttgattgt gaaccgagga caggccttga cttttcagat
      601 ttgtattact tgactatgaa taacaagcac tggttggttc acaaggagtg gttccacgac
      661 attccattac cttggcacgc tggggcagac accggaactc cacactggaa caacaaagaa
      721 gcactggtag agttcaagga cgcacatgcc aaaaggcaga ctgtcgtggt tctagggagt
      781 caagaaggag cagttcacac ggcccttgct ggagctctgg aggctgagat ggatggtgca
      841 aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa acttagattg
      901 aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaagat cccggctgaa
      961 acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg accttgcaag
     1021 gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag gttgataacc
     1081 gctaaccctg taatcactga aagcactgag aactctaaga tgatgctgga acttgatcca
     1141 ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac ccaccactgg
     1201 cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg tgccaagaga
     1261 atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc tctcaactca
     1321 ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt tggaggaatg
     1381 tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggtct gaacacaaag
     1441 aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt cttatccaca
     1501 gccgtctctg ct

Share this post


Link to post
Share on other sites

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
2727 2727 100% 0.0 100% KX380263.1
2713 2713 100% 0.0 99% KX447521.1
2713 2713 100% 0.0 99% KX447509.1
2709 2709 100% 0.0 99% KX216635.1
2709 2709 100% 0.0 99% KX216634.1
2709 2709 100% 0.0 99% KX806557.1
2709 2709 100% 0.0 99% KJ776791.2
2709 2709 100% 0.0 99% KX447520.1
2709 2709 100% 0.0 99% KX447519.1
2709 2709 100% 0.0 99% KX447518.1
2709 2709 100% 0.0 99% KX447516.1
2709 2709 100% 0.0 99% KX447515.1
2709 2709 100% 0.0 99% KX447513.1
2709 2709 100% 0.0 99% KX447510.1
2709 2709 100% 0.0 99% LC171327.1
2709 2709 100% 0.0 99% KX576684.1
2709 2709 100% 0.0 99% KX369547.1
2709 2709 100% 0.0 99% KX280026.1
2709 2709 100% 0.0 99% KX262887.1
2704 2704 100% 0.0 99% KX216638.1
2704 2704 100% 0.0 99% KX216637.1
2704 2704 100% 0.0 99% KX216632.1
2704 2704 100% 0.0 99% KX694534.1
2704 2704 100% 0.0 99% KX447517.1
2704 2704 100% 0.0 99% KX447514.1
2704 2704 100% 0.0 99% KX447511.1
2704 2704 100% 0.0 99% KX446951.1
2704 2704 100% 0.0 99% KX247632.1
2704 2704 100% 0.0 99% KX051563.1
2704 2704 100% 0.0 99% KU509998.3
2704 2704 100% 0.0 99% KU991811.1
2704 2704 100% 0.0 99% KU646828.1
2700 2700 100% 0.0 99% KX216640.1
2700 2700 100% 0.0 99% KX216636.1
2700 2700 100% 0.0 99% KX197205.1
2700 2700 100% 0.0 99% KX447512.1
2700 2700 100% 0.0 99% KX266255.1
2700 2700 100% 0.0 99% KX446950.1
2700 2700 100% 0.0 99% KU866423.2
2700 2700 100% 0.0 99% KU758871.1
2700 2700 100% 0.0 99% KU758870.1
2700 2700 100% 0.0 99% KX253996.1
2700 2700 100% 0.0 99% KX247646.1
2700 2700 100% 0.0 99% KX198135.1
2700 2700 100% 0.0 99% KX197192.1
2700 2700 100% 0.0 99% KX185891.1
2700 2700 100% 0.0 99% KX156776.1
2700 2700 100% 0.0 99% KX156775.1
2700 2700 100% 0.0 99% KX156774.1
2700 2700 100% 0.0 99% KX117076.1
2700 2700 100% 0.0 99% KU963796.1
2700 2700 100% 0.0 99% KU955589.1
2700 2700 100% 0.0 99% KU870645.1
2700 2700 100% 0.0 99% KU922960.1
2700 2700 100% 0.0 99% KU922923.1
2700 2700 100% 0.0 99% KU820899.2
2700 2700 100% 0.0 99% KU729218.1
2700 2700 100% 0.0 99% KU527068.1
2700 2700 100% 0.0 99% KU647676.1
2700 2700 100% 0.0 99% KU321639.1
2697 2697 100% 0.0 99% KX766028.1
2695 2695 100% 0.0 99% KX380262.1
2695 2695 100% 0.0 99% KX216633.1
2695 2695 100% 0.0 99% KU820897.5
2695 2695 100% 0.0 99% KX766029.1
2695 2695 100% 0.0 99% KX520666.1
2695 2695 100% 0.0 99% KU758877.1
2695 2695 100% 0.0 99% KU758873.1
2695 2695 100% 0.0 99% KU758869.1
2695 2695 100% 0.0 99% KU937936.1
2695 2695 100% 0.0 99% KX087102.1
2695 2695 100% 0.0 99% KU940228.1
2695 2695 100% 0.0 99% KU926309.1
2695 2695 100% 0.0 99% KU497555.1
2695 2695 100% 0.0 99% KU501217.1
2695 2695 100% 0.0 99% KU501216.1
2695 2695 100% 0.0 99% KU365778.1
2695 2695 100% 0.0 99% KU312315.1
2695 2695 100% 0.0 99% KU312314.1
2695 2695 100% 0.0 99% KJ634273.1
2691 2691 100% 0.0 99% KX702400.1
2691 2691 100% 0.0 99% KX548902.1
2691 2691 100% 0.0 99% KX377337.1
2691 2691 100% 0.0 99% KU758874.1
2691 2691 100% 0.0 99% KU758868.1
2691 2691 100% 0.0 99% KU820898.1
2691 2691 100% 0.0 99% KU740184.2
2691 2691 100% 0.0 99% KU853013.1
2691 2691 100% 0.0 99% KU853012.1
2691 2691 100% 0.0 99% KU761564.1
2691 2691 100% 0.0 99% KU707826.1
2691 2691 100% 0.0 99% KU646827.1
2691 2691 100% 0.0 99% KU501215.1
2691 2691 100% 0.0 99% KU365780.1
2691 2691 100% 0.0 99% KU365779.1
2691 2691 100% 0.0 99% KU365777.1
2686 2686 100% 0.0 99% KX673530.1
2686 2686 100% 0.0 99% KX601168.1
2686 2686 100% 0.0 99% KX087101.2
2686 2686 100% 0.0 99% KX056898.1

Share this post


Link to post
Share on other sites
LOCUS       KX216632                1512 bp    RNA     linear   VRL 07-SEP-2016
DEFINITION  Zika virus isolate SIS58-2015 envelope protein gene, partial cds.
ACCESSION   KX216632
VERSION     KX216632.1  GI:1029979471
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 1512)
  AUTHORS   Pyke,A.T. and Moore,P.R.
  TITLE     First isolation of Zika virus in Australia from a clinical patient,
            imported from Tonga
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1512)
  AUTHORS   Pyke,A.T. and Moore,P.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2016) Public Health Virology, Queensland Health
            Forensic and Scientific Services, 39 Kessels Road, Coopers Plains,
            QLD 4108, Australia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1512
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="SIS58-2015"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Solomon Islands"
                     /collection_date="2015"
                     /note="genotype: Asian"
     CDS             <1..>1512
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ANF28857.1"
                     /db_xref="GI:1029979472"
                     /translation="IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNSKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA"
ORIGIN      
        1 atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg tgggacttgg
       61 gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga caaaccgact
      121 gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag atcctactgc
      181 tatgaggcat caatatcgga catggcttcg gacagccgct gcccaacaca aggtgaagcc
      241 taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt ggacagaggc
      301 tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacatgcgc taagtttgca
      361 tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta ccggataatg
      421 ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg acatgaaact
      481 gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga agccaccctg
      541 gggggttttg gaagcctagg acttgattgt gaaccgagga caggccttga cttttcagat
      601 ttgtattact tgactatgaa tagcaagcac tggttggttc acaaggagtg gttccacgac
      661 attccattac cttggcacgc tggggcagac accggaactc cacactggaa caacaaagaa
      721 gcactggtag agttcaagga cgcacatgcc aaaaggcaaa ctgtcgtggt tctagggagt
      781 caagaaggag cagttcacac ggcccttgct ggagctctgg aggctgagat ggatggtgca
      841 aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa acttagattg
      901 aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaagat cccggctgaa
      961 acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg gccttgcaag
     1021 gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag gttgataacc
     1081 gctaaccccg taatcactga aagcactgag aactctaaga tgatgctgga acttgatcca
     1141 ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac ccaccactgg
     1201 cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg tgccaagaga
     1261 atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc tctcaactca
     1321 ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt tggaggaatg
     1381 tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggtct gaacacaaag
     1441 aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt cttatccaca
     1501 gccgtctctg ct