Sign in to follow this  
Followers 0
niman

Partial Zika ENV Sequences - Oceania SE Asia = Singapore?

28 posts in this topic

Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
2727 2727 100% 0.0 100% KX380262.1
2713 2713 100% 0.0 99% KX447520.1
2713 2713 100% 0.0 99% KX447519.1
2713 2713 100% 0.0 99% KX447518.1
2713 2713 100% 0.0 99% KX447513.1
2713 2713 100% 0.0 99% KX447510.1
2713 2713 100% 0.0 99% KX576684.1
2713 2713 100% 0.0 99% KX369547.1
2713 2713 100% 0.0 99% KX280026.1
2713 2713 100% 0.0 99% KX262887.1
2709 2709 100% 0.0 99% KX216638.1
2709 2709 100% 0.0 99% KX216637.1
2709 2709 100% 0.0 99% KX694534.1
2709 2709 100% 0.0 99% KX447521.1
2709 2709 100% 0.0 99% KX447511.1
2709 2709 100% 0.0 99% KX447509.1
2709 2709 100% 0.0 99% KX446951.1
2709 2709 100% 0.0 99% KX247632.1
2709 2709 100% 0.0 99% KX051563.1
2709 2709 100% 0.0 99% KU509998.3
2709 2709 100% 0.0 99% KU991811.1
2709 2709 100% 0.0 99% KU646828.1
2704 2704 100% 0.0 99% KX216635.1
2704 2704 100% 0.0 99% KX216634.1
2704 2704 100% 0.0 99% KX806557.1
2704 2704 100% 0.0 99% KX197205.1
2704 2704 100% 0.0 99% KJ776791.2
2704 2704 100% 0.0 99% KX447516.1
2704 2704 100% 0.0 99% KX447515.1
2704 2704 100% 0.0 99% KX447512.1
2704 2704 100% 0.0 99% KX446950.1
2704 2704 100% 0.0 99% KU758871.1
2704 2704 100% 0.0 99% KU758870.1
2704 2704 100% 0.0 99% KX247646.1
2704 2704 100% 0.0 99% KX198135.1
2704 2704 100% 0.0 99% KX197192.1
2704 2704 100% 0.0 99% KX156776.1
2704 2704 100% 0.0 99% KX156775.1
2704 2704 100% 0.0 99% KX156774.1
2704 2704 100% 0.0 99% KU870645.1
2704 2704 100% 0.0 99% KU922960.1
2704 2704 100% 0.0 99% KU922923.1
2704 2704 100% 0.0 99% KU729218.1
2704 2704 100% 0.0 99% KU527068.1
2704 2704 100% 0.0 99% KU646827.1
2704 2704 100% 0.0 99% KU647676.1
2704 2704 100% 0.0 99% KU321639.1
2702 2702 100% 0.0 99% KX766028.1
2700 2700 100% 0.0 99% KX216632.1
2700 2700 100% 0.0 99% KU820897.5
2700 2700 100% 0.0 99% KX766029.1
2700 2700 100% 0.0 99% KX447514.1
2700 2700 100% 0.0 99% KX520666.1
2700 2700 100% 0.0 99% KU758877.1
2700 2700 100% 0.0 99% KU758873.1
2700 2700 100% 0.0 99% KU758869.1
2700 2700 100% 0.0 99% KU937936.1
2700 2700 100% 0.0 99% KX087102.1
2700 2700 100% 0.0 99% KU940228.1
2700 2700 100% 0.0 99% KU926309.1
2700 2700 100% 0.0 99% KU497555.1
2700 2700 100% 0.0 99% KU501217.1
2700 2700 100% 0.0 99% KU501216.1
2700 2700 100% 0.0 99% KU365778.1
2700 2700 100% 0.0 99% KU312315.1
2700 2700 100% 0.0 99% KU312314.1
2695 2695 100% 0.0 99% KX380263.1
2695 2695 100% 0.0 99% KX216640.1
2695 2695 100% 0.0 99% KX216636.1
2695 2695 100% 0.0 99% KX702400.1
2695 2695 100% 0.0 99% KX266255.1
2695 2695 100% 0.0 99% KX548902.1
2695 2695 100% 0.0 99% KX377337.1
2695 2695 100% 0.0 99% KU866423.2
2695 2695 100% 0.0 99% KU758874.1
2695 2695 100% 0.0 99% KU758868.1
2695 2695 100% 0.0 99% KX253996.1
2695 2695 100% 0.0 99% KX185891.1
2695 2695 100% 0.0 99% KX117076.1
2695 2695 100% 0.0 99% KU963796.1
2695 2695 100% 0.0 99% KU955589.1
2695 2695 100% 0.0 99% KU820898.1
2695 2695 100% 0.0 99% KU740184.2
2695 2695 100% 0.0 99% KU853013.1
2695 2695 100% 0.0 99% KU853012.1
2695 2695 100% 0.0 99% KU820899.2
2695 2695 100% 0.0 99% KU761564.1
2695 2695 100% 0.0 99% KU707826.1
2695 2695 100% 0.0 99% KU501215.1
2695 2695 100% 0.0 99% KU365780.1
2695 2695 100% 0.0 99% KU365779.1
2695 2695 100% 0.0 99% KU365777.1
2693 2693 100% 0.0 99% KU940224.1
2691 2691 100% 0.0 99% KX216633.1
2691 2691 100% 0.0 99% KX673530.1
2691 2691 100% 0.0 99% KX447517.1
2691 2691 100% 0.0 99% KX601168.1
2691 2691 100% 0.0 99% KX087101.2
2691 2691 100% 0.0 99% KX056898.1
2691 2691 100% 0.0 99% KU955590.1

Share this post


Link to post
Share on other sites
LOCUS       KX380263                1512 bp    RNA     linear   VRL 07-SEP-2016
DEFINITION  Zika virus isolate FS92-2016 envelope protein gene, partial cds.
ACCESSION   KX380263
VERSION     KX380263.1  GI:1036637438
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 1512)
  AUTHORS   Pyke,A.T. and Moore,P.R.
  TITLE     First isolation of Zika virus in Australia from a clinical patient,
            imported from Tonga
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1512)
  AUTHORS   Pyke,A.T. and Moore,P.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JUN-2016) Public Health Virology, Queensland Health
            Forensic and Scientific Services, 39 Kessels Road, Coopers Plains,
            QLD 4108, Australia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1512
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="FS92-2016"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Fiji"
                     /collection_date="2016"
                     /note="genotype: Asian"
     CDS             <1..>1512
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ANK57899.1"
                     /db_xref="GI:1036637439"
                     /translation="IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA"
ORIGIN      
        1 atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg tgggacttgg
       61 gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga caaaccgact
      121 gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag atcctactgc
      181 tatgaggcat caatatcgga catggcttcg gacagccgct gcccaacaca aggtgaagcc
      241 taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt ggacagaggc
      301 tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacctgcgc taagtttgca
      361 tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta ccggataatg
      421 ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg acatgaaact
      481 gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga agccaccctg
      541 gggggttttg gaagcctagg acttgattgt gaaccgagga caggccttga cttttcagat
      601 ttgtattact tgactatgaa taacaagcac tggttggttc acaaggagtg gttccacgac
      661 attccattac cttggcacgc tggggcagac accggaactc cacactggaa caacaaagaa
      721 gcactggtag agttcaagga cgcacatgcc aaaaggcaga ctgtcgtggt tctagggagt
      781 caagaaggag cagttcacac ggcccttgct ggagctctgg aggctgagat ggatggtgca
      841 aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa acttagattg
      901 aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaagat cccggctgaa
      961 acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg accttgcaag
     1021 gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag gttgataacc
     1081 gctaaccctg taatcactga aagcactgag aactctaaga tgatgctgga acttgatcca
     1141 ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac ccaccactgg
     1201 cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg tgccaagaga
     1261 atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc tctcaactca
     1321 ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt tggaggaatg
     1381 tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggtct gaacacaaag
     1441 aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt cttatccaca
     1501 gccgtctctg ct

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
2727 2727 100% 0.0 100% KX380263.1
2713 2713 100% 0.0 99% KX447521.1
2713 2713 100% 0.0 99% KX447509.1
2709 2709 100% 0.0 99% KX216635.1
2709 2709 100% 0.0 99% KX216634.1
2709 2709 100% 0.0 99% KX806557.1
2709 2709 100% 0.0 99% KJ776791.2
2709 2709 100% 0.0 99% KX447520.1
2709 2709 100% 0.0 99% KX447519.1
2709 2709 100% 0.0 99% KX447518.1
2709 2709 100% 0.0 99% KX447516.1
2709 2709 100% 0.0 99% KX447515.1
2709 2709 100% 0.0 99% KX447513.1
2709 2709 100% 0.0 99% KX447510.1
2709 2709 100% 0.0 99% LC171327.1
2709 2709 100% 0.0 99% KX576684.1
2709 2709 100% 0.0 99% KX369547.1
2709 2709 100% 0.0 99% KX280026.1
2709 2709 100% 0.0 99% KX262887.1
2704 2704 100% 0.0 99% KX216638.1
2704 2704 100% 0.0 99% KX216637.1
2704 2704 100% 0.0 99% KX216632.1
2704 2704 100% 0.0 99% KX694534.1
2704 2704 100% 0.0 99% KX447517.1
2704 2704 100% 0.0 99% KX447514.1
2704 2704 100% 0.0 99% KX447511.1
2704 2704 100% 0.0 99% KX446951.1
2704 2704 100% 0.0 99% KX247632.1
2704 2704 100% 0.0 99% KX051563.1
2704 2704 100% 0.0 99% KU509998.3
2704 2704 100% 0.0 99% KU991811.1
2704 2704 100% 0.0 99% KU646828.1
2700 2700 100% 0.0 99% KX216640.1
2700 2700 100% 0.0 99% KX216636.1
2700 2700 100% 0.0 99% KX197205.1
2700 2700 100% 0.0 99% KX447512.1
2700 2700 100% 0.0 99% KX266255.1
2700 2700 100% 0.0 99% KX446950.1
2700 2700 100% 0.0 99% KU866423.2
2700 2700 100% 0.0 99% KU758871.1
2700 2700 100% 0.0 99% KU758870.1
2700 2700 100% 0.0 99% KX253996.1
2700 2700 100% 0.0 99% KX247646.1
2700 2700 100% 0.0 99% KX198135.1
2700 2700 100% 0.0 99% KX197192.1
2700 2700 100% 0.0 99% KX185891.1
2700 2700 100% 0.0 99% KX156776.1
2700 2700 100% 0.0 99% KX156775.1
2700 2700 100% 0.0 99% KX156774.1
2700 2700 100% 0.0 99% KX117076.1
2700 2700 100% 0.0 99% KU963796.1
2700 2700 100% 0.0 99% KU955589.1
2700 2700 100% 0.0 99% KU870645.1
2700 2700 100% 0.0 99% KU922960.1
2700 2700 100% 0.0 99% KU922923.1
2700 2700 100% 0.0 99% KU820899.2
2700 2700 100% 0.0 99% KU729218.1
2700 2700 100% 0.0 99% KU527068.1
2700 2700 100% 0.0 99% KU647676.1
2700 2700 100% 0.0 99% KU321639.1
2697 2697 100% 0.0 99% KX766028.1
2695 2695 100% 0.0 99% KX380262.1
2695 2695 100% 0.0 99% KX216633.1
2695 2695 100% 0.0 99% KU820897.5
2695 2695 100% 0.0 99% KX766029.1
2695 2695 100% 0.0 99% KX520666.1
2695 2695 100% 0.0 99% KU758877.1
2695 2695 100% 0.0 99% KU758873.1
2695 2695 100% 0.0 99% KU758869.1
2695 2695 100% 0.0 99% KU937936.1
2695 2695 100% 0.0 99% KX087102.1
2695 2695 100% 0.0 99% KU940228.1
2695 2695 100% 0.0 99% KU926309.1
2695 2695 100% 0.0 99% KU497555.1
2695 2695 100% 0.0 99% KU501217.1
2695 2695 100% 0.0 99% KU501216.1
2695 2695 100% 0.0 99% KU365778.1
2695 2695 100% 0.0 99% KU312315.1
2695 2695 100% 0.0 99% KU312314.1
2695 2695 100% 0.0 99% KJ634273.1
2691 2691 100% 0.0 99% KX702400.1
2691 2691 100% 0.0 99% KX548902.1
2691 2691 100% 0.0 99% KX377337.1
2691 2691 100% 0.0 99% KU758874.1
2691 2691 100% 0.0 99% KU758868.1
2691 2691 100% 0.0 99% KU820898.1
2691 2691 100% 0.0 99% KU740184.2
2691 2691 100% 0.0 99% KU853013.1
2691 2691 100% 0.0 99% KU853012.1
2691 2691 100% 0.0 99% KU761564.1
2691 2691 100% 0.0 99% KU707826.1
2691 2691 100% 0.0 99% KU646827.1
2691 2691 100% 0.0 99% KU501215.1
2691 2691 100% 0.0 99% KU365780.1
2691 2691 100% 0.0 99% KU365779.1
2691 2691 100% 0.0 99% KU365777.1
2686 2686 100% 0.0 99% KX673530.1
2686 2686 100% 0.0 99% KX601168.1
2686 2686 100% 0.0 99% KX087101.2
2686 2686 100% 0.0 99% KX056898.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.