Sign in to follow this  
Followers 0
niman

2015 Taiwan H5N8 Matches Crane from Japan

10 posts in this topic

LOCUS       KT388444                1704 bp    cRNA    linear   VRL 17-DEC-2015
DEFINITION  Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) segment 4 cRNA
            sequence.
ACCESSION   KT388444
VERSION     KT388444.1  GI:923093318
KEYWORDS    .
SOURCE      Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8))
  ORGANISM  Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1704)
  AUTHORS   Huang,P.Y., Lee,C.C., Yip,C.H., Cheung,C.L., Yu,G., Lam,T.Y.,
            Smith,D.K., Zhu,H. and Guan,Y.
  TITLE     Genetic characterization of highly pathogenic H5 influenza viruses
            from poultry in Taiwan, 2015
  JOURNAL   Infect. Genet. Evol. (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 1704)
  AUTHORS   Huang,P.Y., Lee,C.C., Yip,C.H., Cheung,C.L., Yu,G., Lam,T.Y.,
            Smith,D.K., Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-AUG-2015) Centre of Influenza Research, School of
            Public Health, The University of Hong Kong, Laboratory Block, LKS
            Faculty of Medicine Building, 21 Sassoon Road, Pokfulam, Hong Kong
            SAR, China
COMMENT     GenBank Accession Numbers KT388441-KT388448 represent sequences
            from the 8 segments of Influenza A virus
            (A/goose/Taiwan/TNC1/2015(H5N8)).
            
            ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; 454; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1704
                     /organism="Influenza A virus
                     (A/goose/Taiwan/TNC1/2015(H5N8))"
                     /mol_type="viral cRNA"
                     /strain="A/goose/Taiwan/TNC1/2015"
                     /serotype="H5N8"
                     /isolation_source="cloacal"
                     /host="goose"
                     /db_xref="taxon:1701764"
                     /segment="4"
                     /country="Taiwan"
                     /collection_date="17-Jan-2015"
                     /note="passage details: E1"
     gene            1..1704
                     /gene="HA"
     CDS             1..1704
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="ALB07376.1"
                     /db_xref="GI:923093319"
                     /translation="MEKIVLLLAVISPVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
                     AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
                     NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF
                     RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
                     STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
                     DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
                     NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
                     VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
                     RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
                     EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
                     I"
     sig_peptide     1..48
                     /gene="HA"
     mat_peptide     49..1035
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1036..1701
                     /gene="HA"
                     /product="HA2"
ORIGIN      
        1 atggagaaaa tagtgcttct tcttgcagtg attagccctg ttaaaagtga tcagatttgc
       61 attggttacc atgcaaacaa ctcaacaaag caggttgaca cgataatgga gaaaaacgtc
      121 actgttacac atgcccaaga catactggaa aagacacaca acgggaagct ctgcgatctt
      181 aatggagtga agcccctgat tctaaaggat tgtagcgtag ctgggtggct ccttggaaat
      241 ccaatgtgcg acgagttcat cagggtgccg gaatggtctt acatcgtgga gagggctaac
      301 ccagccaacg acctctgtta cccagggacc ctcaatgact atgaggaact gaaacaccta
      361 ttgagcagaa taaatcattt tgagaaaact ctgatcatcc ccaggagttc ttggcccaat
      421 catgaaacat cattaggggt gagcgcagca tgtccatacc agggagcatc ctcatttttc
      481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc cgacaataaa gataagctac
      541 aataatacca atcgggaaga tcttttgata ctgtggggga ttcatcattc caacaatgca
      601 gcagagcaga caaatctcta taaaaaccca gacacttatg tttccgtggg gacatcaaca
      661 ttaaaccaga gattggtgcc aaaaatagct actagatccc aagtaaacgg gcaaagagga
      721 agaatggatt tcttctggac aattttaaaa ccgaatgatg caatccactt tgagagtaat
      781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt
      841 atgaaaagtg aaatggagta tggccactgc aacaccaaat gtcaaactcc aataggggcg
      901 ataaactcta gcatgccatt ccacaatata caccctctca ccatcgggga atgccccaaa
      961 tacgtgaagt caaacaaatt agtccttgcg actgggctca gaaatagtcc tctaagagaa
     1021 agaagaagaa aaagaggact atttggagct atagcagggt ttatagaggg aggatggcag
     1081 ggaatggtag acggttggta tgggtatcat catagcaatg agcaggggag tggatacgct
     1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcaatc
     1201 attgacaaaa tgaacactca atttgaggcc gttggaaggg aatttaataa cttagaaagg
     1261 agaatagaga atttaaacaa gaaaatggaa gacggattcc tagatgtctg gacttataat
     1321 gctgaacttt tagttctcat ggaaaatgag agaactctag atttccatga ctcaaatgtc
     1381 aagaaccttt acgacaaagt ccggctacag cttagggata atgcaaaaga gctgggtaat
     1441 ggttgtttcg agttctatca caaatgtgat aacgaatgta tggagagcgt aagaaatggg
     1501 acgtatgact accctaagta ttcagaagaa gcaatattaa aaagagaaga aataagcgga
     1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt
     1621 tccctagcac tggcaatcat agtggctggt ctatctttat ggatgtgctc taatgggtcg
     1681 ttacaatgca gaatttgcat ctaa

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588968A/chicken/Taiwan/a174/2015 (A/H5N3) segment 4 (HA)3131.20.000000e+001701/1704 (99%)
text_code_colored.pngEPI573638A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA)3131.20.000000e+001701/1704 (99%)
text_code_colored.pngEPI588976A/duck/Taiwan/a068/2015 (A/H5N8) segment 4 (HA)3114.60.000000e+001698/1704 (99%)
text_code_colored.pngEPI588960A/duck/Taiwan/a043/2015 (A/H5N2) segment 4 (HA)3114.60.000000e+001698/1704 (99%)
text_code_colored.pngEPI553208A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA)3105.30.000000e+001695/1702 (99%)
text_code_colored.pngEPI588952A/goose/Taiwan/a015/2015 (A/H5N8) segment 4 (HA)3098.00.000000e+001695/1704 (99%)
text_code_colored.pngEPI586534A/chicken/BC/FAV22/2014 (A/H5N2) segment 4 (HA)3088.70.000000e+001693/1704 (99%)
text_code_colored.pngEPI590712A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)
text_code_colored.pngEPI586550A/chicken/BC/FAV24/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)
text_code_colored.pngEPI586518A/chicken/BC/FAV20/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)
text_code_colored.pngEPI586509A/poultry/BC/FAV19/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)
text_code_colored.pngEPI584079A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)
text_code_colored.pngEPI573298A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)
text_code_colored.pngEPI569383A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)
text_code_colored.pngEPI662744A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI662723A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI590740A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI590733A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI590719A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI586542A/chicken/BC/FAV23/2014 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI586526A/chicken/BC/FAV21/2014 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI586493A/poultry/BC/FAV15/2014 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI585092A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI576470A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI569390A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI569376A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI569372A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA)3081.30.000000e+001692/1704 (99%)
text_code_colored.pngEPI662737A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI662701A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI620408A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI590726A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI590699A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI590692A/chicken/Washington/3490-18/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI587633A/chicken/Iowa/04-20/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI587521A/American wigeon/BC/050-31/2015 (A/H5N8) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI586501A/poultry/BC/FAV17/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI585084A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI576477A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI573281A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI662709A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI662688A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI590685A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI586558A/chicken/BC/FAV25/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI573271A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI573208A/gadwall/Korea/H1351/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI561570A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI662730A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001690/1705 (99%)
text_code_colored.pngEPI662716A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI662694A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001690/1705 (99%)
text_code_colored.pngEPI620422A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001690/1705 (99%)
text_code_colored.pngEPI585595A/baikal teal/Korea/2417/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI585589A/baikal teal/Korea/2399/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI585586A/baikal teal/Korea/1456/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI573276A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI573242A/Common Teal/Korea/H844/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI561646A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI561626A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI561605A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI561591A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI561529A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI561508A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI561341A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI620436A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001689/1705 (99%)
text_code_colored.pngEPI585594A/baikal teal/Korea/2416/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI585592A/baikal teal/Korea/2406/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI585591A/baikal teal/Korea/2403/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI585590A/baikal teal/Korea/2402/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI585582A/baikal teal/Korea/1448/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI585581A/baikal teal/Korea/1447/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI585579A/baikal teal/Korea/1445/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI585577A/baikal teal/Korea/1437/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI573286A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI573199A/breeder chicken/Korea/H1068/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI573197A/chicken/Korea/H881/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI561674A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI561612A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI561577A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI561563A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI561542A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI561522A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI620457A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)
text_code_colored.pngEPI620450A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)
text_code_colored.pngEPI620443A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)
text_code_colored.pngEPI620415A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)
text_code_colored.pngEPI585593A/baikal teal/Korea/2414/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI585587A/baikal teal/Korea/1457/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI585584A/baikal teal/Korea/1452/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI585583A/baikal teal/Korea/1449/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561705A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561667A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001688/1705 (99%)
text_code_colored.pngEPI561653A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561633A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI509704A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI662681A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI620429A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 4 (HA)3048.10.000000e+001687/1705 (98%)
text_code_colored.pngEPI585580A/baikal teal/Korea/1446/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI573200A/Korean native chicken/Korea/H1139/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI573196A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI573194A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561697A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588954A/goose/Taiwan/a015/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI588978A/duck/Taiwan/a068/2015 (A/H5N8) segment 6 (NA)2593.80.000000e+001410/1413 (99%)
text_code_colored.pngEPI573640A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 6 (NA)2549.50.000000e+001400/1410 (99%)
text_code_colored.pngEPI587523A/American wigeon/BC/050-31/2015 (A/H5N8) segment 6 (NA)2532.90.000000e+001399/1413 (99%)
text_code_colored.pngEPI569378A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 6 (NA)2527.30.000000e+001398/1413 (98%)
text_code_colored.pngEPI569374A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 6 (NA)2527.30.000000e+001398/1413 (98%)
text_code_colored.pngEPI553210A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI569392A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 6 (NA)2516.30.000000e+001396/1413 (98%)
text_code_colored.pngEPI585086A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561669A/mallard/Korea/H297/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561544A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI585633A/baikal teal/Korea/2417/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585632A/baikal teal/Korea/2416/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585630A/baikal teal/Korea/2406/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585629A/baikal teal/Korea/2403/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585628A/baikal teal/Korea/2402/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585626A/baikal teal/Korea/1458/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585624A/baikal teal/Korea/1456/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585623A/baikal teal/Korea/1454/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585620A/baikal teal/Korea/1448/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585619A/baikal teal/Korea/1447/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585617A/baikal teal/Korea/1445/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585616A/baikal teal/Korea/1441/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561676A/bean goose/Korea/H328/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561662A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561655A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561648A/breeder duck/Korea/H249/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561635A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561628A/mallard/Korea/H207/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561621A/breeder duck/Korea/H200/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561614A/breeder duck/Korea/H158/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561579A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561510A/bean goose/Korea/H53/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561362A/broiler duck/Korea/H49/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561355A/broiler duck/Korea/H48/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561350A/broiler duck/Korea/H47/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561343A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561209A/broiler duck/Korea/H31/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561198A/broiler duck/Korea/H29/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI509714A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI509706A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585627A/baikal teal/Korea/2399/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI585625A/baikal teal/Korea/1457/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI585622A/baikal teal/Korea/1452/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561707A/bean goose/Korea/H40/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561699A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561683A/tundra swan/Korea/H411/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561607A/broiler duck/Korea/H145/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561600A/broiler duck/Korea/H133/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001393/1414 (98%)
text_code_colored.pngEPI561593A/breeder duck/Korea/H128/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561572A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561565A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561558A/Coot/Korea/H81/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561551A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561531A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561524A/broiler duck/Korea/H65/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI561517A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI553345A/chicken/Miyazaki/7/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI595143A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI595135A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI595130A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI595121A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI595113A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI595104A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI595096A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI595084A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI595068A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI585631A/baikal teal/Korea/2414/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI585621A/baikal teal/Korea/1449/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI585618A/baikal teal/Korea/1446/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI585615A/baikal teal/Korea/1437/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI561692A/common teal/Korea/H455-30/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI561189A/waterfowl/Korea/S005/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI542632A/mallard/Korea/W452/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI517163A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 6 (NA)2483.00.000000e+001390/1413 (98%)
text_code_colored.pngEPI573655A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI573648A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI552748A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI544759A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI543012A/duck/Beijing/CT01/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001387/1410 (98%)
text_code_colored.pngEPI573682A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI573674A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI558000A/duck/England/36226/14 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI543004A/duck/Beijing/FS01/2014 (A/H5N8) segment 6 (NA)2471.90.000000e+001386/1410 (98%)
text_code_colored.pngEPI595060A/common teal/Korea/KU-12/2015 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)
text_code_colored.pngEPI573666A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)
text_code_colored.pngEPI573167A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)
text_code_colored.pngEPI558007A/duck/England/36038/14 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)
text_code_colored.pngEPI553364A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)
text_code_colored.pngEPI553350A/wigeon/Sakha/1/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)
text_code_colored.pngEPI548495A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)
text_code_colored.pngEPI548487A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)
text_code_colored.pngEPI547683A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)
text_code_colored.pngEPI595076A/mallard/Korea/N15-99/2015 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)
text_code_colored.pngEPI576393A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)
text_code_colored.pngEPI576382A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)
text_code_colored.pngEPI573181A/duck/Netherlands/14015898/2014 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)
text_code_colored.pngEPI573173A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)
text_code_colored.pngEPI548626A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)
text_code_colored.pngEPI553152A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 6 (NA)2455.30.000000e+001386/1414 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588979A/duck/Taiwan/a068/2015 (A/H5N8) segment 7 (MP)1801.60.000000e+00979/981 (99%)
text_code_colored.pngEPI588955A/goose/Taiwan/a015/2015 (A/H5N8) segment 7 (MP)1801.60.000000e+00979/981 (99%)
text_code_colored.pngEPI586561A/chicken/BC/FAV25/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI586553A/chicken/BC/FAV24/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI586521A/chicken/BC/FAV20/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI586504A/poultry/BC/FAV17/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585651A/baikal teal/Korea/2416/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585650A/baikal teal/Korea/2414/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585649A/baikal teal/Korea/2406/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585647A/baikal teal/Korea/2402/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585646A/baikal teal/Korea/2399/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585645A/baikal teal/Korea/1458/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585644A/baikal teal/Korea/1457/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585643A/baikal teal/Korea/1456/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585642A/baikal teal/Korea/1454/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585641A/baikal teal/Korea/1452/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585639A/baikal teal/Korea/1448/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585638A/baikal teal/Korea/1447/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585637A/baikal teal/Korea/1446/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585635A/baikal teal/Korea/1441/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585634A/baikal teal/Korea/1437/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI585087A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI584082A/turkey/BC/FAV14/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI576480A/chicken/BC/FAV9/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI576473A/chicken/BC/FAV8/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI573301A/turkey/BC/FAV10/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI569386A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561700A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561693A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561684A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561677A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561670A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561656A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561649A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561636A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561629A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561622A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561601A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561594A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561580A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561573A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561566A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561559A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561552A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561532A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561525A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561511A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561351A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561344A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561211A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561199A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI561190A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI553211A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI542633A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI517164A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI509756A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI509711A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI588971A/chicken/Taiwan/a174/2015 (A/H5N3) segment 7 (MP)1796.10.000000e+00978/981 (99%)
text_code_colored.pngEPI588963A/duck/Taiwan/a043/2015 (A/H5N2) segment 7 (MP)1796.10.000000e+00978/981 (99%)
text_code_colored.pngEPI662740A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI662726A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI662719A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI662712A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI662705A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI662691A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI620411A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI590743A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI590736A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI590729A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI590722A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI590708A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI590695A/chicken/Washington/3490-18/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI590688A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI587524A/American wigeon/BC/050-31/2015 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI586545A/chicken/BC/FAV23/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI586537A/chicken/BC/FAV22/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI586529A/chicken/BC/FAV21/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI586513A/poultry/BC/FAV19/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI586496A/poultry/BC/FAV15/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI585652A/baikal teal/Korea/2417/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI585648A/baikal teal/Korea/2403/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI585640A/baikal teal/Korea/1449/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI585636A/baikal teal/Korea/1445/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI585095A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI573289A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI573164A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI569393A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI568702A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI568701A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI568699A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI568698A/turkey/Washington/61-22/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI568697A/chicken/Washington/61-9/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI561708A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI561663A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI561615A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI561608A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI561545A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI561518A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI561363A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI561356A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588949A/goose/Taiwan/a015/2015 (A/H5N8) segment 1 (PB2)4189.30.000000e+002276/2280 (99%)
text_code_colored.pngEPI573635A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 1 (PB2)4172.70.000000e+002273/2280 (99%)
text_code_colored.pngEPI553205A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2)4167.20.000000e+002272/2280 (99%)
text_code_colored.pngEPI569380A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 1 (PB2)4156.10.000000e+002270/2280 (99%)
text_code_colored.pngEPI662721A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI662699A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI590738A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI586531A/chicken/BC/FAV22/2014 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI586498A/poultry/BC/FAV17/2014 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI586490A/poultry/BC/FAV15/2014 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI585081A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI573296A/turkey/BC/FAV10/2014 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI569369A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI569367A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI662704A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI662686A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI620455A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI620427A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI620420A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI620413A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI587630A/chicken/Iowa/04-20/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI587519A/American wigeon/BC/050-31/2015 (A/H5N8) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI586555A/chicken/BC/FAV25/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI586547A/chicken/BC/FAV24/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI586539A/chicken/BC/FAV23/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI586523A/chicken/BC/FAV21/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI584076A/turkey/BC/FAV14/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI576475A/chicken/BC/FAV9/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI576468A/chicken/BC/FAV8/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI569379A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI662742A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI662735A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI662728A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI662707A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI662679A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI620448A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI620441A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI620434A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI620406A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI590724A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI590683A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI586515A/chicken/BC/FAV20/2014 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI573283A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI573279A/turkey/Washington/61-22/2014 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI573274A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI586506A/poultry/BC/FAV19/2014 (A/H5N2) segment 1 (PB2)4135.80.000000e+002266/2280 (99%)
text_code_colored.pngEPI662714A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI590731A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI590717A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI590690A/chicken/Washington/3490-18/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI585089A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI573269A/chicken/Washington/61-9/2014 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI590710A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 1 (PB2)4128.40.000000e+002266/2281 (99%)
text_code_colored.pngEPI590697A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI585557A/baikal teal/Korea/2417/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI585556A/baikal teal/Korea/2416/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI585553A/baikal teal/Korea/2403/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI585543A/baikal teal/Korea/1447/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI585541A/baikal teal/Korea/1445/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561702A/bean goose/Korea/H40/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561672A/bean goose/Korea/H328/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561631A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561624A/mallard/Korea/H207/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561568A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561540A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561527A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561506A/bean goose/Korea/H53/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561358A/broiler duck/Korea/H49/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI585554A/baikal teal/Korea/2406/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI585551A/baikal teal/Korea/2399/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI585550A/baikal teal/Korea/1458/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI585548A/baikal teal/Korea/1456/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI585546A/baikal teal/Korea/1452/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI585545A/baikal teal/Korea/1449/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI585544A/baikal teal/Korea/1448/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI585539A/baikal teal/Korea/1437/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI561610A/breeder duck/Korea/H158/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI561603A/broiler duck/Korea/H145/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI561575A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI561561A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI561513A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI561353A/broiler duck/Korea/H48/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI561339A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)
text_code_colored.pngEPI585555A/baikal teal/Korea/2414/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI585549A/baikal teal/Korea/1457/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI585542A/baikal teal/Korea/1446/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI585540A/baikal teal/Korea/1441/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561679A/tundra swan/Korea/H411/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561665A/mallard/Korea/H297/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561651A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561644A/breeder duck/Korea/H249/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561596A/broiler duck/Korea/H133/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561589A/breeder duck/Korea/H128/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561554A/Coot/Korea/H81/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561547A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561520A/broiler duck/Korea/H65/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561346A/broiler duck/Korea/H47/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561201A/broiler duck/Korea/H31/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561194A/broiler duck/Korea/H29/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
text_code_colored.pngEPI561185A/waterfowl/Korea/S005/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI573636A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 2 (PB1)4185.60.000000e+002272/2275 (99%)
text_code_colored.pngEPI553206A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 2 (PB1)4163.50.000000e+002268/2275 (99%)
text_code_colored.pngEPI587526A/American wigeon/BC/050-31/2015 (A/H5N8) segment 2 (PB1)4146.80.000000e+002265/2275 (99%)
text_code_colored.pngEPI569388A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 2 (PB1)4146.80.000000e+002265/2275 (99%)
text_code_colored.pngEPI585569A/baikal teal/Korea/1458/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI585565A/baikal teal/Korea/1452/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI585564A/baikal teal/Korea/1449/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI585561A/baikal teal/Korea/1446/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI585559A/baikal teal/Korea/1441/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561666A/mallard/Korea/H297/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561659A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561645A/breeder duck/Korea/H249/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561611A/breeder duck/Korea/H158/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561604A/broiler duck/Korea/H145/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561597A/broiler duck/Korea/H133/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561590A/breeder duck/Korea/H128/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561562A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561528A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561347A/broiler duck/Korea/H47/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561340A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561202A/broiler duck/Korea/H31/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI561195A/broiler duck/Korea/H29/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI542631A/mallard/Korea/W452/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)
text_code_colored.pngEPI585576A/baikal teal/Korea/2417/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI585575A/baikal teal/Korea/2416/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI585573A/baikal teal/Korea/2406/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI585572A/baikal teal/Korea/2403/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI585568A/baikal teal/Korea/1457/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI585566A/baikal teal/Korea/1454/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI585563A/baikal teal/Korea/1448/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI585562A/baikal teal/Korea/1447/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI585560A/baikal teal/Korea/1445/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI569375A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI569371A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI561703A/bean goose/Korea/H40/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI561689A/common teal/Korea/H455-30/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI561625A/mallard/Korea/H207/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI561618A/breeder duck/Korea/H200/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI561569A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI561555A/Coot/Korea/H81/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI561541A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI561514A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI509708A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)
text_code_colored.pngEPI561186A/waterfowl/Korea/S005/2014 (A/H5N8) segment 2 (PB1)4133.90.000000e+002262/2275 (99%)
text_code_colored.pngEPI585570A/baikal teal/Korea/2399/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)
text_code_colored.pngEPI585567A/baikal teal/Korea/1456/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)
text_code_colored.pngEPI561696A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)
text_code_colored.pngEPI561680A/tundra swan/Korea/H411/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)
text_code_colored.pngEPI561548A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)
text_code_colored.pngEPI561521A/broiler duck/Korea/H65/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)
text_code_colored.pngEPI561359A/broiler duck/Korea/H49/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)
text_code_colored.pngEPI585574A/baikal teal/Korea/2414/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)
text_code_colored.pngEPI585571A/baikal teal/Korea/2402/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)
text_code_colored.pngEPI585558A/baikal teal/Korea/1437/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)
text_code_colored.pngEPI561652A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)
text_code_colored.pngEPI561632A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)
text_code_colored.pngEPI561576A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)
text_code_colored.pngEPI561337A/broiler duck/Korea/H48/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)
text_code_colored.pngEPI509703A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)
text_code_colored.pngEPI585082A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 2 (PB1)4119.10.000000e+002260/2275 (99%)
text_code_colored.pngEPI561673A/bean goose/Korea/H328/2014 (A/H5N8) segment 2 (PB1)4119.10.000000e+002260/2275 (99%)
text_code_colored.pngEPI561507A/bean goose/Korea/H53/2014 (A/H5N8) segment 2 (PB1)4119.10.000000e+002260/2275 (99%)
text_code_colored.pngEPI517159A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 2 (PB1)4119.10.000000e+002260/2275 (99%)
text_code_colored.pngEPI552744A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 2 (PB1)4113.60.000000e+002259/2275 (99%)
text_code_colored.pngEPI548430A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 2 (PB1)4113.60.000000e+002259/2275 (99%)
text_code_colored.pngEPI543000A/duck/Beijing/FS01/2014 (A/H5N8) segment 2 (PB1)4113.60.000000e+002259/2275 (99%)
text_code_colored.pngEPI595073A/mallard/Korea/N15-99/2015 (A/H5N8) segment 2 (PB1)4108.10.000000e+002259/2276 (99%)
text_code_colored.pngEPI573177A/duck/Netherlands/14015898/2014 (A/H5N8) segment 2 (PB1)4108.10.000000e+002258/2275 (99%)
text_code_colored.pngEPI558009A/duck/England/36038/14 (A/H5N8) segment 2 (PB1)4108.10.000000e+002258/2275 (99%)
text_code_colored.pngEPI558002A/duck/England/36226/14 (A/H5N8) segment 2 (PB1)4108.10.000000e+002258/2275 (99%)
text_code_colored.pngEPI547671A/duck/England/36254/14 (A/H5N8) segment 2 (PB1)4108.10.000000e+002258/2275 (99%)
text_code_colored.pngEPI580263A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 2 (PB1)4102.50.000000e+002257/2275 (99%)
text_code_colored.pngEPI576389A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 2 (PB1)4102.50.000000e+002257/2275 (99%)
text_code_colored.pngEPI576386A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 2 (PB1)4102.50.000000e+002257/2275 (99%)
text_code_colored.pngEPI548621A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 2 (PB1)4102.50.000000e+002257/2275 (99%)
text_code_colored.pngEPI547680A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 2 (PB1)4102.50.000000e+002257/2275 (99%)
text_code_colored.pngEPI595126A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)
text_code_colored.pngEPI595118A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)
text_code_colored.pngEPI595110A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)
text_code_colored.pngEPI595101A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)
text_code_colored.pngEPI579005A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)
text_code_colored.pngEPI554600A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)
text_code_colored.pngEPI553360A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)
text_code_colored.pngEPI595140A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 2 (PB1)4093.30.000000e+002255/2275 (99%)
text_code_colored.pngEPI595092A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)
text_code_colored.pngEPI573670A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)
text_code_colored.pngEPI573644A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)
text_code_colored.pngEPI573161A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)
text_code_colored.pngEPI548491A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)
text_code_colored.pngEPI548483A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)
text_code_colored.pngEPI553185A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 2 (PB1)4089.60.000000e+002253/2275 (99%)
text_code_colored.pngEPI595057A/common teal/Korea/KU-12/2015 (A/H5N8) segment 2 (PB1)4085.90.000000e+002255/2276 (99%)
text_code_colored.pngEPI573652A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 2 (PB1)4085.90.000000e+002254/2275 (99%)
text_code_colored.pngEPI553341A/chicken/Miyazaki/7/2014 (A/H5N8) segment 2 (PB1)4085.90.000000e+002254/2275 (99%)
text_code_colored.pngEPI543008A/duck/Beijing/CT01/2014 (A/H5N8) segment 2 (PB1)4082.20.000000e+002252/2274 (99%)
text_code_colored.pngEPI595064A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 2 (PB1)4080.40.000000e+002253/2275 (99%)
text_code_colored.pngEPI573678A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 2 (PB1)4080.40.000000e+002253/2275 (99%)
text_code_colored.pngEPI573662A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 2 (PB1)4080.40.000000e+002253/2275 (99%)
text_code_colored.pngEPI542598A/duck/Beijing/FS01/2013 (A/H5N8) segment 2 (PB1)4054.50.000000e+002226/2241 (99%)
text_code_colored.pngEPI590678A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 2 (PB1)4045.30.000000e+002224/2241 (99%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588975A/duck/Taiwan/a068/2015 (A/H5N8) segment 3 (PA)3956.60.000000e+002146/2148 (99%)
text_code_colored.pngEPI588967A/chicken/Taiwan/a174/2015 (A/H5N3) segment 3 (PA)3956.60.000000e+002146/2148 (99%)
text_code_colored.pngEPI588951A/goose/Taiwan/a015/2015 (A/H5N8) segment 3 (PA)3951.10.000000e+002145/2148 (99%)
text_code_colored.pngEPI573637A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 3 (PA)3940.00.000000e+002145/2151 (99%)
text_code_colored.pngEPI553207A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA)3940.00.000000e+002145/2151 (99%)
text_code_colored.pngEPI587520A/American wigeon/BC/050-31/2015 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI586557A/chicken/BC/FAV25/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI586541A/chicken/BC/FAV23/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI586525A/chicken/BC/FAV21/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI586508A/poultry/BC/FAV19/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI569382A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI586533A/chicken/BC/FAV22/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI586517A/chicken/BC/FAV20/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI586500A/poultry/BC/FAV17/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI585103A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI584078A/turkey/BC/FAV14/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI576173A/chicken/BC/FAV8/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI590470A/chicken/Washington/3490-18/2015 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI586549A/chicken/BC/FAV24/2014 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI586492A/poultry/BC/FAV15/2014 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585536A/baikal teal/Korea/2414/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585535A/baikal teal/Korea/2406/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585531A/baikal teal/Korea/1458/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585530A/baikal teal/Korea/1457/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585528A/baikal teal/Korea/1454/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585525A/baikal teal/Korea/1448/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585524A/baikal teal/Korea/1447/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585523A/baikal teal/Korea/1446/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI573292A/turkey/BC/FAV10/2014 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI569389A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI569370A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI569368A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI569362A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 3 (PA)3895.70.000000e+002138/2152 (99%)
text_code_colored.pngEPI569360A/chicken/Washington/61-9/2014 (A/H5N2) segment 3 (PA)3895.70.000000e+002138/2152 (99%)
text_code_colored.pngEPI561712A/bean goose/Korea/H40/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561643A/tundra swan/Korea/H411/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561583A/broiler duck/Korea/H133/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561537A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561534A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561502A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561500A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561338A/broiler duck/Korea/H49/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561334A/broiler duck/Korea/H47/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI509694A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI590471A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 3 (PA)3890.20.000000e+002137/2152 (99%)
text_code_colored.pngEPI585538A/baikal teal/Korea/2417/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI585537A/baikal teal/Korea/2416/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI585533A/baikal teal/Korea/2402/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI585532A/baikal teal/Korea/2399/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI585529A/baikal teal/Korea/1456/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI576174A/chicken/BC/FAV9/2014 (A/H5N2) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI573280A/turkey/Washington/61-22/2014 (A/H5N2) segment 3 (PA)3890.20.000000e+002137/2152 (99%)
text_code_colored.pngEPI561687A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561686A/common teal/Korea/H455-30/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561642A/bean goose/Korea/H328/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561640A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561588A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561587A/mallard/Korea/H207/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561586A/breeder duck/Korea/H200/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561584A/broiler duck/Korea/H145/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561582A/breeder duck/Korea/H128/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561501A/broiler duck/Korea/H65/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561335A/broiler duck/Korea/H48/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561333A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561193A/broiler duck/Korea/H31/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561192A/broiler duck/Korea/H29/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI662660A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002136/2152 (99%)
text_code_colored.pngEPI590475A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002136/2152 (99%)
text_code_colored.pngEPI590472A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002136/2152 (99%)
text_code_colored.pngEPI590469A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002136/2152 (99%)
text_code_colored.pngEPI585534A/baikal teal/Korea/2403/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI585527A/baikal teal/Korea/1452/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI585526A/baikal teal/Korea/1449/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI585522A/baikal teal/Korea/1445/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI585521A/baikal teal/Korea/1441/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI585520A/baikal teal/Korea/1437/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI585107A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002136/2152 (99%)
text_code_colored.pngEPI561641A/mallard/Korea/H297/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI561639A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI561585A/breeder duck/Korea/H158/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI561539A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI561538A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI561536A/Coot/Korea/H81/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI561535A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI561499A/bean goose/Korea/H53/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI561184A/waterfowl/Korea/S005/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI509693A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI662675A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 3 (PA)3879.10.000000e+002135/2152 (99%)
text_code_colored.pngEPI662674A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 3 (PA)3879.10.000000e+002135/2152 (99%)
text_code_colored.pngEPI590473A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 3 (PA)3879.10.000000e+002135/2152 (99%)
text_code_colored.pngEPI573645A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 3 (PA)3879.10.000000e+002134/2151 (99%)
text_code_colored.pngEPI561638A/breeder duck/Korea/H249/2014 (A/H5N8) segment 3 (PA)3879.10.000000e+002134/2151 (99%)
text_code_colored.pngEPI542618A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA)3879.10.000000e+002134/2151 (99%)
text_code_colored.pngEPI595141A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 3 (PA)3875.40.000000e+002133/2151 (99%)
text_code_colored.pngEPI662673A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)
text_code_colored.pngEPI620404A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)
text_code_colored.pngEPI620403A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)
text_code_colored.pngEPI620402A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)
text_code_colored.pngEPI620401A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)
text_code_colored.pngEPI620400A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI573639A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 5 (NP)2745.20.000000e+001492/1495 (99%)
text_code_colored.pngEPI553209A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 5 (NP)2737.90.000000e+001492/1497 (99%)
text_code_colored.pngEPI585085A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 5 (NP)2732.30.000000e+001491/1497 (99%)
text_code_colored.pngEPI569391A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 5 (NP)2732.30.000000e+001491/1497 (99%)
text_code_colored.pngEPI569377A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 5 (NP)2732.30.000000e+001491/1497 (99%)
text_code_colored.pngEPI569373A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 5 (NP)2732.30.000000e+001491/1497 (99%)
text_code_colored.pngEPI587522A/American wigeon/BC/050-31/2015 (A/H5N8) segment 5 (NP)2721.20.000000e+001489/1497 (99%)
text_code_colored.pngEPI585605A/baikal teal/Korea/1456/2014 (A/H5N8) segment 5 (NP)2721.20.000000e+001489/1497 (99%)
text_code_colored.pngEPI573287A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 5 (NP)2721.20.000000e+001489/1497 (99%)
text_code_colored.pngEPI585614A/baikal teal/Korea/2417/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI585613A/baikal teal/Korea/2416/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI585612A/baikal teal/Korea/2414/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI585611A/baikal teal/Korea/2406/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI585609A/baikal teal/Korea/2402/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI585608A/baikal teal/Korea/2399/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI585606A/baikal teal/Korea/1457/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI585601A/baikal teal/Korea/1448/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI585596A/baikal teal/Korea/1437/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561706A/bean goose/Korea/H40/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561675A/bean goose/Korea/H328/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561654A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561647A/breeder duck/Korea/H249/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561606A/broiler duck/Korea/H145/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561578A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561571A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561564A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561543A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561530A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561523A/broiler duck/Korea/H65/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561509A/bean goose/Korea/H53/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561361A/broiler duck/Korea/H49/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561354A/broiler duck/Korea/H48/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI561342A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)
text_code_colored.pngEPI585610A/baikal teal/Korea/2403/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)
text_code_colored.pngEPI585600A/baikal teal/Korea/1447/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)
text_code_colored.pngEPI585598A/baikal teal/Korea/1445/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)
text_code_colored.pngEPI561668A/mallard/Korea/H297/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)
text_code_colored.pngEPI561634A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)
text_code_colored.pngEPI561613A/breeder duck/Korea/H158/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)
text_code_colored.pngEPI561592A/breeder duck/Korea/H128/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)
text_code_colored.pngEPI542629A/mallard/Korea/W452/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)
text_code_colored.pngEPI517162A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)
text_code_colored.pngEPI585607A/baikal teal/Korea/1458/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI585604A/baikal teal/Korea/1454/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI585603A/baikal teal/Korea/1452/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI585599A/baikal teal/Korea/1446/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI585597A/baikal teal/Korea/1441/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI561691A/common teal/Korea/H455-30/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI561682A/tundra swan/Korea/H411/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI561661A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI561627A/mallard/Korea/H207/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI561620A/breeder duck/Korea/H200/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI561557A/Coot/Korea/H81/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI561550A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI561349A/broiler duck/Korea/H47/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI561206A/broiler duck/Korea/H31/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI561197A/broiler duck/Korea/H29/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI509713A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)
text_code_colored.pngEPI585602A/baikal teal/Korea/1449/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)
text_code_colored.pngEPI561698A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)
text_code_colored.pngEPI561599A/broiler duck/Korea/H133/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)
text_code_colored.pngEPI561516A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)
text_code_colored.pngEPI561188A/waterfowl/Korea/S005/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)
text_code_colored.pngEPI542625A/duck/Beijing/FS01/2013 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)
text_code_colored.pngEPI509705A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)
text_code_colored.pngEPI573681A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 5 (NP)2693.50.000000e+001484/1497 (99%)
text_code_colored.pngEPI573673A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 5 (NP)2693.50.000000e+001484/1497 (99%)
text_code_colored.pngEPI573656A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 5 (NP)2693.50.000000e+001484/1497 (99%)
text_code_colored.pngEPI573665A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 5 (NP)2688.00.000000e+001483/1497 (99%)
text_code_colored.pngEPI573647A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 5 (NP)2688.00.000000e+001483/1497 (99%)
text_code_colored.pngEPI573188A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 5 (NP)2688.00.000000e+001483/1497 (99%)
text_code_colored.pngEPI548494A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 5 (NP)2688.00.000000e+001483/1497 (99%)
text_code_colored.pngEPI595142A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI595134A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI595129A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI595120A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI595112A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI595103A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI595095A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI595083A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI595075A/mallard/Korea/N15-99/2015 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI595067A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI573180A/duck/Netherlands/14015898/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI573165A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI553182A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI552747A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI548486A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI548427A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI553363A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 5 (NP)2676.90.000000e+001481/1497 (98%)
text_code_colored.pngEPI553344A/chicken/Miyazaki/7/2014 (A/H5N8) segment 5 (NP)2676.90.000000e+001481/1497 (98%)
text_code_colored.pngEPI595059A/common teal/Korea/KU-12/2015 (A/H5N8) segment 5 (NP)2671.40.000000e+001481/1498 (98%)
text_code_colored.pngEPI573172A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)
text_code_colored.pngEPI558011A/duck/England/36038/14 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)
text_code_colored.pngEPI558004A/duck/England/36226/14 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)
text_code_colored.pngEPI554602A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)
text_code_colored.pngEPI548624A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)
text_code_colored.pngEPI547674A/duck/England/36254/14 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)
text_code_colored.pngEPI576392A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 5 (NP)2665.80.000000e+001479/1497 (98%)
text_code_colored.pngEPI547682A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 5 (NP)2665.80.000000e+001479/1497 (98%)
text_code_colored.pngEPI576383A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 5 (NP)2660.30.000000e+001478/1497 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588956A/goose/Taiwan/a015/2015 (A/H5N8) segment 8 (NS)1548.60.000000e+00838/838 (100%)
text_code_colored.pngEPI573642A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 8 (NS)1548.60.000000e+00838/838 (100%)
text_code_colored.pngEPI588972A/chicken/Taiwan/a174/2015 (A/H5N3) segment 8 (NS)1543.10.000000e+00837/838 (99%)
text_code_colored.pngEPI586554A/chicken/BC/FAV24/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI586538A/chicken/BC/FAV22/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI586522A/chicken/BC/FAV20/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI586514A/poultry/BC/FAV19/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585671A/baikal teal/Korea/2417/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585670A/baikal teal/Korea/2416/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585669A/baikal teal/Korea/2414/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585667A/baikal teal/Korea/2403/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585666A/baikal teal/Korea/2402/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585664A/baikal teal/Korea/1458/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585663A/baikal teal/Korea/1457/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585660A/baikal teal/Korea/1452/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585657A/baikal teal/Korea/1447/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585656A/baikal teal/Korea/1446/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585655A/baikal teal/Korea/1445/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585653A/baikal teal/Korea/1437/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585096A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI576474A/chicken/BC/FAV8/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI569394A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI569387A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI568703A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI568700A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561713A/broiler duck/Korea/H31/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561701A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561694A/common teal/Korea/H455-30/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561685A/tundra swan/Korea/H411/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561678A/bean goose/Korea/H328/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561671A/mallard/Korea/H297/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561664A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561657A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561630A/mallard/Korea/H207/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561623A/breeder duck/Korea/H200/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561574A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561560A/Coot/Korea/H81/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561553A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561533A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561519A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561345A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561200A/broiler duck/Korea/H29/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI542634A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI509757A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI509712A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI662685A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI590737A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI590723A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI590716A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI587525A/American wigeon/BC/050-31/2015 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI586562A/chicken/BC/FAV25/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI586546A/chicken/BC/FAV23/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI586530A/chicken/BC/FAV21/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI586505A/poultry/BC/FAV17/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585668A/baikal teal/Korea/2406/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585665A/baikal teal/Korea/2399/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585661A/baikal teal/Korea/1454/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585659A/baikal teal/Korea/1449/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585658A/baikal teal/Korea/1448/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585654A/baikal teal/Korea/1441/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI584083A/turkey/BC/FAV14/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI573175A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI573166A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI569366A/turkey/Washington/61-22/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561650A/breeder duck/Korea/H249/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561609A/broiler duck/Korea/H145/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561602A/broiler duck/Korea/H133/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561595A/breeder duck/Korea/H128/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561581A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561546A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561364A/bean goose/Korea/H40/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561357A/broiler duck/Korea/H48/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561352A/broiler duck/Korea/H47/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561191A/waterfowl/Korea/S005/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI554604A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI553471A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI552750A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI548628A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI548428A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI662741A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI662720A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI662713A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI662706A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI662692A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620461A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620447A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620440A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620433A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620426A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620419A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620412A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI590696A/chicken/Washington/3490-18/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI590689A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI587637A/chicken/Iowa/04-20/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI586497A/poultry/BC/FAV15/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI585662A/baikal teal/Korea/1456/2014 (A/H5N8) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI576481A/chicken/BC/FAV9/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI573302A/turkey/BC/FAV10/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI573183A/duck/Netherlands/14015898/2014 (A/H5N8) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI569363A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.