Sign in to follow this  
Followers 0
niman

2015 H5N8 Sequences from Taiwan

18 posts in this topic

LOCUS       KT388524                1704 bp    cRNA    linear   VRL 17-DEC-2015
DEFINITION  Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) segment 4 cRNA
            sequence.
ACCESSION   KT388524
VERSION     KT388524.1  GI:923093518
KEYWORDS    .
SOURCE      Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8))
  ORGANISM  Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1704)
  AUTHORS   Huang,P.Y., Lee,C.C., Yip,C.H., Cheung,C.L., Yu,G., Lam,T.Y.,
            Smith,D.K., Zhu,H. and Guan,Y.
  TITLE     Genetic characterization of highly pathogenic H5 influenza viruses
            from poultry in Taiwan, 2015
  JOURNAL   Infect. Genet. Evol. (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 1704)
  AUTHORS   Huang,P.Y., Lee,C.C., Yip,C.H., Cheung,C.L., Yu,G., Lam,T.Y.,
            Smith,D.K., Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-AUG-2015) Centre of Influenza Research, School of
            Public Health, The University of Hong Kong, Laboratory Block, LKS
            Faculty of Medicine Building, 21 Sassoon Road, Pokfulam, Hong Kong
            SAR, China
COMMENT     GenBank Accession Numbers KT388521-KT388528 represent sequences
            from the 8 segments of Influenza A virus
            (A/goose/Taiwan/TNC11/2015(H5N8)).
            
            ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; 454; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1704
                     /organism="Influenza A virus
                     (A/goose/Taiwan/TNC11/2015(H5N8))"
                     /mol_type="viral cRNA"
                     /strain="A/goose/Taiwan/TNC11/2015"
                     /serotype="H5N8"
                     /isolation_source="cloacal"
                     /host="goose"
                     /db_xref="taxon:1701766"
                     /segment="4"
                     /country="Taiwan"
                     /collection_date="17-Jan-2015"
                     /note="passage details: E1"
     gene            1..1704
                     /gene="HA"
     CDS             1..1704
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="ALB07496.1"
                     /db_xref="GI:923093519"
                     /translation="MEKIVLLLAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
                     AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
                     NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF
                     RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
                     STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
                     DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
                     NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
                     VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
                     RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
                     EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
                     I"
     sig_peptide     1..48
                     /gene="HA"
     mat_peptide     49..1035
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1036..1701
                     /gene="HA"
                     /product="HA2"
ORIGIN      
        1 atggagaaaa tagtgcttct tcttgcagtg attagccttg ttaaaagtga tcagatttgc
       61 attggttacc atgcaaacaa ctcaacaaag caggttgaca cgataatgga gaaaaacgtc
      121 actgttacac atgcccaaga catactagaa aagacacaca acgggaagct ctgcgatctt
      181 aatggagtga agcccctgat tctaaaggat tgtagcgtag ctgggtggct ccttggaaat
      241 ccaatgtgcg acgagttcat cagggtgccg gaatggtctt acatcgtgga gagggctaac
      301 ccagccaacg acctctgtta cccagggacc ctcaatgact atgaggaact gaaacaccta
      361 ttgagccgaa taaatcattt tgaaaaaact ctgatcatcc ccaggagttc ttggcccaat
      421 catgaaacat cattaggggt gagcgcagca tgtccatacc agggagcatc ctcatttttc
      481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc cgacaataaa gataagctac
      541 aataatacca atcgggaaga tcttttgata ctgtggggga ttcatcattc caacaatgca
      601 gcagagcaga caaatctcta taaaaaccca gacacttatg tttccgtggg gacatcaaca
      661 ttaaaccaga gattggtgcc aaaaatagct actagatccc aagtaaacgg gcaaagtgga
      721 agaatggatt tcttctggac aattttaaaa ccgaatgatg caatccactt tgagagtaat
      781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt
      841 atgaaaagtg aaatggagta tggccactgc aacaccaaat gtcaaactcc aataggggcg
      901 ataaactcta gcatgccatt ccacaatata caccctctca ccatcgggga atgccctaaa
      961 tacgtgaagt caaacaaatt agtccttgcg actgggctca gaaatagtcc tctaagagaa
     1021 agaagaagaa aaagaggact ttttggagct atagcagggt ttatagaggg aggatggcag
     1081 ggaatggtag acggttggta tgggtatcat catagcaatg agcaggggag tgggtacgct
     1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcaatc
     1201 attgacaaaa tgaacactca atttgaggcc gttggaaggg aatttaataa cttagaaagg
     1261 agaatagaga atttaaacaa gaaaatggaa gacggattcc tagatgtctg gacttataat
     1321 gctgaacttt tagttctcat ggaaaatgag agaactctag atttccatga ctcaaatgtc
     1381 aagaaccttt acgacaaagt ccggctacag cttagggata atgcaaaaga gctgggtaat
     1441 ggttgtttcg agttctatca caaatgtgat aacgaatgta tggagagcgt aagaaatggg
     1501 acgtatgact accctaagta ttcagaagaa gcaatattaa aaagagaaga aataagcgga
     1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt
     1621 tccctagcac tggcaatcat agtggctggt ctatctttat ggatgtgctc taatgggtcg
     1681 ttacaatgca gaatttgcat ctaa

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588952A/goose/Taiwan/a015/2015 (A/H5N8) segment 4 (HA)3142.30.000000e+001703/1704 (99%)
text_code_colored.pngEPI588968A/chicken/Taiwan/a174/2015 (A/H5N3) segment 4 (HA)3120.10.000000e+001699/1704 (99%)
text_code_colored.pngEPI573638A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA)3120.10.000000e+001699/1704 (99%)
text_code_colored.pngEPI588976A/duck/Taiwan/a068/2015 (A/H5N8) segment 4 (HA)3103.50.000000e+001696/1704 (99%)
text_code_colored.pngEPI588960A/duck/Taiwan/a043/2015 (A/H5N2) segment 4 (HA)3103.50.000000e+001696/1704 (99%)
text_code_colored.pngEPI553208A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA)3094.30.000000e+001693/1702 (99%)
text_code_colored.pngEPI586534A/chicken/BC/FAV22/2014 (A/H5N2) segment 4 (HA)3077.60.000000e+001691/1704 (99%)
text_code_colored.pngEPI590712A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI586550A/chicken/BC/FAV24/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI586518A/chicken/BC/FAV20/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI586509A/poultry/BC/FAV19/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI584079A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI573298A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI569383A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001692/1705 (99%)
text_code_colored.pngEPI662744A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI662723A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI590740A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI590733A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI590719A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI586542A/chicken/BC/FAV23/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI586526A/chicken/BC/FAV21/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI586493A/poultry/BC/FAV15/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI585092A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI576470A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI569390A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI569376A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI569372A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI662737A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI662701A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI620408A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI590726A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI590699A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI590692A/chicken/Washington/3490-18/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI587633A/chicken/Iowa/04-20/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI587521A/American wigeon/BC/050-31/2015 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI586501A/poultry/BC/FAV17/2014 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI585084A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI576477A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI573281A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI662709A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI662688A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI590685A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI586558A/chicken/BC/FAV25/2014 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI573271A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI573208A/gadwall/Korea/H1351/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI561570A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI662730A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)
text_code_colored.pngEPI662716A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI662694A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)
text_code_colored.pngEPI620422A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)
text_code_colored.pngEPI585595A/baikal teal/Korea/2417/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI585589A/baikal teal/Korea/2399/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI585586A/baikal teal/Korea/1456/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI573276A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI573242A/Common Teal/Korea/H844/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561646A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561626A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561605A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561591A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561529A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561508A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561341A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI620436A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 4 (HA)3048.10.000000e+001687/1705 (98%)
text_code_colored.pngEPI585594A/baikal teal/Korea/2416/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585592A/baikal teal/Korea/2406/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585591A/baikal teal/Korea/2403/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585590A/baikal teal/Korea/2402/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585582A/baikal teal/Korea/1448/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585581A/baikal teal/Korea/1447/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585579A/baikal teal/Korea/1445/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585577A/baikal teal/Korea/1437/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI573286A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI573199A/breeder chicken/Korea/H1068/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI573197A/chicken/Korea/H881/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561674A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561612A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561577A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561563A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561542A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561522A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI620457A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 4 (HA)3042.60.000000e+001686/1705 (98%)
text_code_colored.pngEPI620450A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 4 (HA)3042.60.000000e+001686/1705 (98%)
text_code_colored.pngEPI620443A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 4 (HA)3042.60.000000e+001686/1705 (98%)
text_code_colored.pngEPI620415A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 4 (HA)3042.60.000000e+001686/1705 (98%)
text_code_colored.pngEPI585593A/baikal teal/Korea/2414/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI585587A/baikal teal/Korea/1457/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI585584A/baikal teal/Korea/1452/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI585583A/baikal teal/Korea/1449/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI561705A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI561667A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001686/1705 (98%)
text_code_colored.pngEPI561653A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI561633A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI509704A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI662681A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI620429A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 4 (HA)3037.00.000000e+001685/1705 (98%)
text_code_colored.pngEPI585580A/baikal teal/Korea/1446/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI573200A/Korean native chicken/Korea/H1139/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI573196A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI573194A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI561697A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588954A/goose/Taiwan/a015/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI588978A/duck/Taiwan/a068/2015 (A/H5N8) segment 6 (NA)2604.90.000000e+001412/1413 (99%)
text_code_colored.pngEPI573640A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 6 (NA)2560.60.000000e+001402/1410 (99%)
text_code_colored.pngEPI587523A/American wigeon/BC/050-31/2015 (A/H5N8) segment 6 (NA)2544.00.000000e+001401/1413 (99%)
text_code_colored.pngEPI569378A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 6 (NA)2538.40.000000e+001400/1413 (99%)
text_code_colored.pngEPI569374A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 6 (NA)2538.40.000000e+001400/1413 (99%)
text_code_colored.pngEPI553210A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 6 (NA)2538.40.000000e+001398/1410 (99%)
text_code_colored.pngEPI569392A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 6 (NA)2527.30.000000e+001398/1413 (98%)
text_code_colored.pngEPI585086A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 6 (NA)2516.30.000000e+001396/1413 (98%)
text_code_colored.pngEPI561669A/mallard/Korea/H297/2014 (A/H5N8) segment 6 (NA)2516.30.000000e+001396/1413 (98%)
text_code_colored.pngEPI561544A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 6 (NA)2516.30.000000e+001396/1413 (98%)
text_code_colored.pngEPI585633A/baikal teal/Korea/2417/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585632A/baikal teal/Korea/2416/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585630A/baikal teal/Korea/2406/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585629A/baikal teal/Korea/2403/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585628A/baikal teal/Korea/2402/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585626A/baikal teal/Korea/1458/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585624A/baikal teal/Korea/1456/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585623A/baikal teal/Korea/1454/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585620A/baikal teal/Korea/1448/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585619A/baikal teal/Korea/1447/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585617A/baikal teal/Korea/1445/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585616A/baikal teal/Korea/1441/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561676A/bean goose/Korea/H328/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561662A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561655A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561648A/breeder duck/Korea/H249/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561635A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561628A/mallard/Korea/H207/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561621A/breeder duck/Korea/H200/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561614A/breeder duck/Korea/H158/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561579A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561510A/bean goose/Korea/H53/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561362A/broiler duck/Korea/H49/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561355A/broiler duck/Korea/H48/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561350A/broiler duck/Korea/H47/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561343A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561209A/broiler duck/Korea/H31/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561198A/broiler duck/Korea/H29/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI509714A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI509706A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585627A/baikal teal/Korea/2399/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI585625A/baikal teal/Korea/1457/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI585622A/baikal teal/Korea/1452/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561707A/bean goose/Korea/H40/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561699A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561683A/tundra swan/Korea/H411/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561607A/broiler duck/Korea/H145/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561600A/broiler duck/Korea/H133/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001395/1414 (98%)
text_code_colored.pngEPI561593A/breeder duck/Korea/H128/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561572A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561565A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561558A/Coot/Korea/H81/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561551A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561531A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561524A/broiler duck/Korea/H65/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561517A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI553345A/chicken/Miyazaki/7/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI595143A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595135A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595130A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595121A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595113A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595104A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595096A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595084A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595068A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585631A/baikal teal/Korea/2414/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585621A/baikal teal/Korea/1449/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585618A/baikal teal/Korea/1446/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585615A/baikal teal/Korea/1437/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561692A/common teal/Korea/H455-30/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561189A/waterfowl/Korea/S005/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI542632A/mallard/Korea/W452/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI517163A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI573655A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI573648A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI552748A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI544759A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI543012A/duck/Beijing/CT01/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI573682A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 6 (NA)2483.00.000000e+001390/1413 (98%)
text_code_colored.pngEPI573674A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 6 (NA)2483.00.000000e+001390/1413 (98%)
text_code_colored.pngEPI558000A/duck/England/36226/14 (A/H5N8) segment 6 (NA)2483.00.000000e+001390/1413 (98%)
text_code_colored.pngEPI543004A/duck/Beijing/FS01/2014 (A/H5N8) segment 6 (NA)2483.00.000000e+001388/1410 (98%)
text_code_colored.pngEPI595060A/common teal/Korea/KU-12/2015 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI573666A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI573167A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI558007A/duck/England/36038/14 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI553364A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI553350A/wigeon/Sakha/1/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI548495A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI548487A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI547683A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI595076A/mallard/Korea/N15-99/2015 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI576393A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI576382A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI573181A/duck/Netherlands/14015898/2014 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI573173A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI548626A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI553152A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001388/1414 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588979A/duck/Taiwan/a068/2015 (A/H5N8) segment 7 (MP)1812.70.000000e+00981/981 (100%)
text_code_colored.pngEPI588955A/goose/Taiwan/a015/2015 (A/H5N8) segment 7 (MP)1812.70.000000e+00981/981 (100%)
text_code_colored.pngEPI586561A/chicken/BC/FAV25/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI586553A/chicken/BC/FAV24/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI586521A/chicken/BC/FAV20/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI586504A/poultry/BC/FAV17/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585651A/baikal teal/Korea/2416/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585650A/baikal teal/Korea/2414/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585649A/baikal teal/Korea/2406/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585647A/baikal teal/Korea/2402/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585646A/baikal teal/Korea/2399/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585645A/baikal teal/Korea/1458/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585644A/baikal teal/Korea/1457/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585643A/baikal teal/Korea/1456/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585642A/baikal teal/Korea/1454/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585641A/baikal teal/Korea/1452/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585639A/baikal teal/Korea/1448/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585638A/baikal teal/Korea/1447/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585637A/baikal teal/Korea/1446/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585635A/baikal teal/Korea/1441/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585634A/baikal teal/Korea/1437/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585087A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI584082A/turkey/BC/FAV14/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI576480A/chicken/BC/FAV9/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI576473A/chicken/BC/FAV8/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI573301A/turkey/BC/FAV10/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI569386A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561700A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561693A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561684A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561677A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561670A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561656A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561649A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561636A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561629A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561622A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561601A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561594A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561580A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561573A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561566A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561559A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561552A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561532A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561525A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561511A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561351A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561344A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561211A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561199A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561190A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI553211A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI542633A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI517164A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI509756A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI509711A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI588971A/chicken/Taiwan/a174/2015 (A/H5N3) segment 7 (MP)1807.10.000000e+00980/981 (99%)
text_code_colored.pngEPI588963A/duck/Taiwan/a043/2015 (A/H5N2) segment 7 (MP)1807.10.000000e+00980/981 (99%)
text_code_colored.pngEPI662740A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI662726A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI662719A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI662712A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI662705A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI662691A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI620411A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590743A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590736A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590729A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590722A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590708A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590695A/chicken/Washington/3490-18/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590688A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI587524A/American wigeon/BC/050-31/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI586545A/chicken/BC/FAV23/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI586537A/chicken/BC/FAV22/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI586529A/chicken/BC/FAV21/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI586513A/poultry/BC/FAV19/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI586496A/poultry/BC/FAV15/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI585652A/baikal teal/Korea/2417/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI585648A/baikal teal/Korea/2403/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI585640A/baikal teal/Korea/1449/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI585636A/baikal teal/Korea/1445/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI585095A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI573289A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI573164A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI569393A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568702A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568701A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568699A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568698A/turkey/Washington/61-22/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568697A/chicken/Washington/61-9/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561708A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561663A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561615A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561608A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561545A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561518A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561363A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561356A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588949A/goose/Taiwan/a015/2015 (A/H5N8) segment 1 (PB2)4200.40.000000e+002278/2280 (99%)
text_code_colored.pngEPI573635A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 1 (PB2)4183.80.000000e+002275/2280 (99%)
text_code_colored.pngEPI553205A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2)4178.20.000000e+002274/2280 (99%)
text_code_colored.pngEPI569380A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 1 (PB2)4167.20.000000e+002272/2280 (99%)
text_code_colored.pngEPI586531A/chicken/BC/FAV22/2014 (A/H5N2) segment 1 (PB2)4161.60.000000e+002271/2280 (99%)
text_code_colored.pngEPI586498A/poultry/BC/FAV17/2014 (A/H5N2) segment 1 (PB2)4161.60.000000e+002271/2280 (99%)
text_code_colored.pngEPI586490A/poultry/BC/FAV15/2014 (A/H5N2) segment 1 (PB2)4161.60.000000e+002271/2280 (99%)
text_code_colored.pngEPI585081A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 1 (PB2)4161.60.000000e+002271/2280 (99%)
text_code_colored.pngEPI573296A/turkey/BC/FAV10/2014 (A/H5N2) segment 1 (PB2)4161.60.000000e+002271/2280 (99%)
text_code_colored.pngEPI569369A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 1 (PB2)4161.60.000000e+002271/2280 (99%)
text_code_colored.pngEPI569367A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 1 (PB2)4161.60.000000e+002271/2280 (99%)
text_code_colored.pngEPI587519A/American wigeon/BC/050-31/2015 (A/H5N8) segment 1 (PB2)4156.10.000000e+002270/2280 (99%)
text_code_colored.pngEPI586555A/chicken/BC/FAV25/2014 (A/H5N2) segment 1 (PB2)4156.10.000000e+002270/2280 (99%)
text_code_colored.pngEPI586547A/chicken/BC/FAV24/2014 (A/H5N2) segment 1 (PB2)4156.10.000000e+002270/2280 (99%)
text_code_colored.pngEPI586539A/chicken/BC/FAV23/2014 (A/H5N2) segment 1 (PB2)4156.10.000000e+002270/2280 (99%)
text_code_colored.pngEPI586523A/chicken/BC/FAV21/2014 (A/H5N2) segment 1 (PB2)4156.10.000000e+002270/2280 (99%)
text_code_colored.pngEPI584076A/turkey/BC/FAV14/2014 (A/H5N2) segment 1 (PB2)4156.10.000000e+002270/2280 (99%)
text_code_colored.pngEPI576475A/chicken/BC/FAV9/2014 (A/H5N2) segment 1 (PB2)4156.10.000000e+002270/2280 (99%)
text_code_colored.pngEPI576468A/chicken/BC/FAV8/2014 (A/H5N2) segment 1 (PB2)4156.10.000000e+002270/2280 (99%)
text_code_colored.pngEPI569379A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 1 (PB2)4156.10.000000e+002270/2280 (99%)
text_code_colored.pngEPI662721A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI662699A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI662679A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI590738A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI586515A/chicken/BC/FAV20/2014 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI573283A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI573279A/turkey/Washington/61-22/2014 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI573274A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)
text_code_colored.pngEPI586506A/poultry/BC/FAV19/2014 (A/H5N2) segment 1 (PB2)4146.80.000000e+002268/2280 (99%)
text_code_colored.pngEPI662714A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI662704A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI662686A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI620455A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI620427A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI620420A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI620413A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI590690A/chicken/Washington/3490-18/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI587630A/chicken/Iowa/04-20/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI585089A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI573269A/chicken/Washington/61-9/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)
text_code_colored.pngEPI662742A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI662735A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI662728A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI662707A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI620448A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI620441A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI620434A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI620406A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI590724A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI590697A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI590683A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI585557A/baikal teal/Korea/2417/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI585556A/baikal teal/Korea/2416/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI585553A/baikal teal/Korea/2403/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI585543A/baikal teal/Korea/1447/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI585541A/baikal teal/Korea/1445/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI561702A/bean goose/Korea/H40/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI561672A/bean goose/Korea/H328/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI561631A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI561624A/mallard/Korea/H207/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI561568A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI561540A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI561527A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI561506A/bean goose/Korea/H53/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI561358A/broiler duck/Korea/H49/2014 (A/H5N8) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)
text_code_colored.pngEPI590731A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI590717A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI585554A/baikal teal/Korea/2406/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI585551A/baikal teal/Korea/2399/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI585550A/baikal teal/Korea/1458/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI585548A/baikal teal/Korea/1456/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI585546A/baikal teal/Korea/1452/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI585545A/baikal teal/Korea/1449/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI585544A/baikal teal/Korea/1448/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI585539A/baikal teal/Korea/1437/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI561610A/breeder duck/Korea/H158/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI561603A/broiler duck/Korea/H145/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI561575A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI561561A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI561513A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI561353A/broiler duck/Korea/H48/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI561339A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)
text_code_colored.pngEPI590710A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 1 (PB2)4128.40.000000e+002266/2281 (99%)
text_code_colored.pngEPI585555A/baikal teal/Korea/2414/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI585549A/baikal teal/Korea/1457/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI585542A/baikal teal/Korea/1446/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI585540A/baikal teal/Korea/1441/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561679A/tundra swan/Korea/H411/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561665A/mallard/Korea/H297/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561651A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561644A/breeder duck/Korea/H249/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561596A/broiler duck/Korea/H133/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561589A/breeder duck/Korea/H128/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561554A/Coot/Korea/H81/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561547A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561520A/broiler duck/Korea/H65/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561346A/broiler duck/Korea/H47/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561201A/broiler duck/Korea/H31/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561194A/broiler duck/Korea/H29/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)
text_code_colored.pngEPI561185A/waterfowl/Korea/S005/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588950A/goose/Taiwan/a015/2015 (A/H5N8) segment 2 (PB1)4185.60.000000e+002270/2272 (99%)
text_code_colored.pngEPI599822A/duck/Jiangxi/32213/2013 (A/H7N6) segment 2 (PB1)4058.20.000000e+002249/2275 (98%)
text_code_colored.pngEPI596632A/duck/Quang Ninh/14/2013 (A/H3N6) segment 2 (PB1)4058.20.000000e+002249/2275 (98%)
text_code_colored.pngEPI493022A/wild waterfowl/Dongting/C2383/2012 (A/H1N2) segment 2 (PB1)4036.00.000000e+002245/2275 (98%)
text_code_colored.pngEPI527602A/common teal/Mongolia/2273/2011 (A/H6N6) segment 2 (PB1)4019.40.000000e+002242/2275 (98%)
text_code_colored.pngEPI645331A/duck/Thailand/CU-13011C/2013 (A/H0) segment 2 (PB1)4001.00.000000e+002238/2274 (98%)
text_code_colored.pngEPI544772A/chicken/Shanghai/LPM2/2013 (A/H3N2) segment 2 (PB1)3973.30.000000e+002233/2274 (98%)
text_code_colored.pngEPI544765A/environment/Shanghai/LPM1/2013 (A/H3N2) segment 2 (PB1)3973.30.000000e+002233/2274 (98%)
text_code_colored.pngEPI601222A/environment/Jiangxi/36468/2013 (A/H0) segment 2 (PB1)3940.00.000000e+002177/2200 (98%)
text_code_colored.pngEPI469411A/common teal/Hong Kong/MPK630/2009 (A/H10N9) segment 2 (PB1)3886.50.000000e+002218/2275 (97%)
text_code_colored.pngEPI600872A/duck/Jiangxi/26141/2009 (A/H10N7) segment 2 (PB1)3875.40.000000e+002216/2275 (97%)
text_code_colored.pngEPI387896A/wild bird/Korea/A13/2010 (A/H10N1) segment 2 (PB1)3873.50.000000e+002215/2274 (97%)
text_code_colored.pngEPI387895A/wild bird/Korea/A12/2010 (A/H10N1) segment 2 (PB1)3873.50.000000e+002215/2274 (97%)
text_code_colored.pngEPI600879A/duck/Jiangxi/26182/2009 (A/H10N7) segment 2 (PB1)3869.90.000000e+002215/2275 (97%)
text_code_colored.pngEPI617881A/mallard/Republic of Georgia/13/2011 (A/H6N2) segment 2 (PB1)3864.30.000000e+002214/2275 (97%)
text_code_colored.pngEPI600893A/duck/Jiangxi/26331/2009 (A/H10N7) segment 2 (PB1)3864.30.000000e+002214/2275 (97%)
text_code_colored.pngEPI600886A/duck/Jiangxi/26281/2009 (A/H10N7) segment 2 (PB1)3864.30.000000e+002214/2275 (97%)
text_code_colored.pngEPI527635A/ruddy shelduck/Mongolia/1602/2010 (A/H10N8) segment 2 (PB1)3853.20.000000e+002212/2275 (97%)
text_code_colored.pngEPI476581A/duck/Thailand/CU-8319T/2010 (A/H9N7) segment 2 (PB1)3853.20.000000e+002212/2275 (97%)
text_code_colored.pngEPI469483A/chicken/Jiangxi/2369/2010 (A/H7N7) segment 2 (PB1)3853.20.000000e+002213/2276 (97%)
text_code_colored.pngEPI469333A/wild waterfowl/Hong Kong/MPJ1815/2010 (A/H11N9) segment 2 (PB1)3853.20.000000e+002212/2275 (97%)
text_code_colored.pngEPI372456A/shoveler/Egypt/01574-NAMRU3/2007 (A/H10N4) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI584390A/duck/Hunan/S1496/2011 (A/H10N8) segment 2 (PB1)3842.20.000000e+002209/2274 (97%)
text_code_colored.pngEPI446505A/wild goose/Dongting/C1037/2011 (A/H12N8) segment 2 (PB1)3836.60.000000e+002209/2275 (97%)
text_code_colored.pngEPI372273A/teal/Egypt/20431-NAMRU3/2003 (A/H1N2) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI285821A/avian/Egypt/920431/2006 (A/H9N2) segment 2 (PB1)3831.10.000000e+002208/2275 (97%)
text_code_colored.pngEPI461627A/duck/Hunan/S1256/2012 (A/H3N8) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI461569A/duck/Hunan/S11313/2012 (A/H4N2) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI533778A/Caspian seal/Russia/T1/2012 (A/H4N6) segment 2 (PB1)3808.90.000000e+002205/2276 (96%)
text_code_colored.pngEPI533772A/Caspian seal/Russia/1884/2002 (A/H4N6) segment 2 (PB1)3808.90.000000e+002205/2276 (96%)
text_code_colored.pngEPI469432A/wild waterfowl/Hong Kong/MPL1060/2011 (A/H11N9) segment 2 (PB1)3808.90.000000e+002204/2275 (96%)
text_code_colored.pngEPI469398A/common teal/Hong Kong/MPL1075/2011 (A/H11N9) segment 2 (PB1)3803.40.000000e+002203/2275 (96%)
text_code_colored.pngEPI461661A/duck/Hunan/S1824/2012 (A/H3N8) segment 2 (PB1)3801.50.000000e+002203/2275 (96%)
text_code_colored.pngEPI618509A/mallard/Sweden/4932/2004 (A/H9N2) segment 2 (PB1)3797.80.000000e+002202/2275 (96%)
text_code_colored.pngEPI618135A/mallard/Sweden/6039/2005 (A/H10N4) segment 2 (PB1)3797.80.000000e+002202/2275 (96%)
text_code_colored.pngEPI618848A/mallard/Sweden/8023/2005 (A/H10N4) segment 2 (PB1)3792.30.000000e+002202/2276 (96%)
text_code_colored.pngEPI618214A/mallard/Sweden/1689/2002 (A/H7N7) segment 2 (PB1)3792.30.000000e+002201/2275 (96%)
text_code_colored.pngEPI618201A/mallard/Sweden/1645/2002 (A/H7N7) segment 2 (PB1)3792.30.000000e+002201/2275 (96%)
text_code_colored.pngEPI618068A/mallard/Sweden/8004/2005 (A/H10N4) segment 2 (PB1)3792.30.000000e+002201/2275 (96%)
text_code_colored.pngEPI617059A/mallard/Sweden/1671/2002 (A/H7N7) segment 2 (PB1)3792.30.000000e+002201/2275 (96%)
text_code_colored.pngEPI222162A/mallard/Altai/1208/2007 (A/H3N6) segment 2 (PB1)3792.30.000000e+002201/2275 (96%)
text_code_colored.pngEPI222093A/garganey/Altai/1216/2007 (A/H3N6) segment 2 (PB1)3792.30.000000e+002201/2275 (96%)
text_code_colored.pngEPI372313A/shoveler/Egypt/09782-NAMRU3/2004 (A/H10N7) segment 2 (PB1)3784.90.000000e+002199/2274 (96%)
text_code_colored.pngEPI618139A/mallard/Sweden/1690/2002 (A/H7N7) segment 2 (PB1)3781.20.000000e+002199/2275 (96%)
text_code_colored.pngEPI527621A/northern shoveler/Mongolia/899V/2009 (A/H3N6) segment 2 (PB1)3781.20.000000e+002199/2275 (96%)
text_code_colored.pngEPI469402A/northern shoveler/Hong Kong/MPC657/2006 (A/H10N9) segment 2 (PB1)3781.20.000000e+002200/2276 (96%)
text_code_colored.pngEPI269009A/duck/Hunan/491/2005 (A/H6N2) segment 2 (PB1)3781.20.000000e+002199/2275 (96%)
text_code_colored.pngEPI181975A/common teal/Netherlands/1/2005 (A/H8N4) segment 2 (PB1)3781.20.000000e+002199/2275 (96%)
text_code_colored.pngEPI372353A/teal/Egypt/09888-NAMRU3/2005 (A/H4N6) segment 2 (PB1)3779.40.000000e+002198/2274 (96%)
text_code_colored.pngEPI229961A/duck/France/05057b/2005 (A/H5N2) segment 2 (PB1)3779.40.000000e+002198/2274 (96%)
text_code_colored.pngEPI169291A/duck/France/05057b/2005 (A/H5N2) segment 2 (PB1)3779.40.000000e+002198/2274 (96%)
text_code_colored.pngEPI619137A/mallard/Sweden/7996/2005 (A/H8N4) segment 2 (PB1)3775.70.000000e+002199/2276 (96%)
text_code_colored.pngEPI554980A/mallard/Italy/3342/2006 (A/H3N6) segment 2 (PB1)3775.70.000000e+002199/2276 (96%)
text_code_colored.pngEPI377678A/mallard/Sweden/99/2002 (A/H2N3) segment 2 (PB1)3775.70.000000e+002198/2275 (96%)
text_code_colored.pngEPI590767A/mandarin duck/Korea/K12-256/2012 (A/H9N2) segment 2 (PB1)3773.80.000000e+002181/2250 (96%)
text_code_colored.pngEPI461833A/environment/Hunan/S4484/2011 (A/H12N7) segment 2 (PB1)3773.80.000000e+002198/2275 (96%)
text_code_colored.pngEPI270060A/aquatic bird/India/NIV-17095/2007 (A/H11N1) segment 2 (PB1)3773.80.000000e+002197/2274 (96%)
text_code_colored.pngEPI619144A/mallard/Sweden/8005/2005 (A/H8N4) segment 2 (PB1)3770.10.000000e+002198/2276 (96%)
text_code_colored.pngEPI617973A/mallard/Republic of Georgia/1/2010 (A/H10N7) segment 2 (PB1)3770.10.000000e+002197/2275 (96%)
text_code_colored.pngEPI514657A/mallard/Sweden/6134/2005 (A/H4N6) segment 2 (PB1)3770.10.000000e+002197/2275 (96%)
text_code_colored.pngEPI511808A/mallard/Italy/4518/2007 (A/H10N1) segment 2 (PB1)3768.30.000000e+002196/2274 (96%)
text_code_colored.pngEPI372479A/teal/Egypt/12908-NAMRU3/2005 (A/H10N1) segment 2 (PB1)3768.30.000000e+002196/2274 (96%)
text_code_colored.pngEPI618644A/mallard/Sweden/366/2002 (A/H11N9) segment 2 (PB1)3764.60.000000e+002196/2275 (96%)
text_code_colored.pngEPI617767A/black-headed gull/Republic of Georgia/8/2012 (A/H2N7) segment 2 (PB1)3764.60.000000e+002196/2275 (96%)
text_code_colored.pngEPI596566A/muscovy duck/Vietnam/LBM721/2014 (A/H3N8) segment 2 (PB1)3764.60.000000e+002197/2276 (96%)
text_code_colored.pngEPI590057A/muscovy duck/Vietnam/LBM728/2014 (A/H3N2) segment 2 (PB1)3764.60.000000e+002197/2276 (96%)
text_code_colored.pngEPI514681A/mallard/Sweden/5714/2005 (A/H4N6) segment 2 (PB1)3764.60.000000e+002196/2275 (96%)
text_code_colored.pngEPI485608A/mallard/Sweden/16/2002 (A/H12N9) segment 2 (PB1)3764.60.000000e+002196/2275 (96%)
text_code_colored.pngEPI173879A/goose/Italy/296426/2003 (A/H1N1) segment 2 (PB1)3764.60.000000e+002197/2276 (96%)
text_code_colored.pngEPI167837A/goose/Italy/296426/2003 (A/H1N1) segment 2 (PB1)3764.60.000000e+002197/2276 (96%)
text_code_colored.pngEPI372384A/teal/Egypt/13203-NAMRU3/2006 (A/H6N2) segment 2 (PB1)3762.70.000000e+002196/2275 (96%)
text_code_colored.pngEPI372337A/shoveler/Egypt/09781-NAMRU3/2004 (A/H10N7) segment 2 (PB1)3762.70.000000e+002195/2274 (96%)
text_code_colored.pngEPI254405A/Egyptian goose/South Africa/AI1448/2007 (A/H1N8) segment 2 (PB1)3762.70.000000e+002189/2265 (96%)
text_code_colored.pngEPI618913A/mallard/Sweden/51726/2006 (A/H10N4) segment 2 (PB1)3759.10.000000e+002195/2275 (96%)
text_code_colored.pngEPI618885A/mallard/Sweden/51619/2006 (A/H10N4) segment 2 (PB1)3759.10.000000e+002195/2275 (96%)
text_code_colored.pngEPI618877A/mallard/Sweden/5824/2005 (A/H10N7) segment 2 (PB1)3759.10.000000e+002195/2275 (96%)
text_code_colored.pngEPI590078A/duck/Quang Ninh/90c112/2013 (A/H3N2) segment 2 (PB1)3759.10.000000e+002195/2275 (96%)
text_code_colored.pngEPI514709A/mallard/Sweden/5755/2005 (A/H4N6) segment 2 (PB1)3759.10.000000e+002195/2275 (96%)
text_code_colored.pngEPI417480A/duck/Guangxi/GXd-2/2010 (A/H6N2) segment 2 (PB1)3759.10.000000e+002195/2275 (96%)
text_code_colored.pngEPI377662A/mallard/Sweden/6/2002 (A/H2N3) segment 2 (PB1)3759.10.000000e+002195/2275 (96%)
text_code_colored.pngEPI251767A/mallard/Sweden/6/2002 (A/H2N3) segment 2 (PB1)3759.10.000000e+002195/2275 (96%)
text_code_colored.pngEPI469426A/wild duck/Jiangxi/10179/2005 (A/H7N3) segment 2 (PB1)3757.20.000000e+002194/2274 (96%)
text_code_colored.pngEPI469414A/duck/Yunnan/87/2007 (A/H7N6) segment 2 (PB1)3757.20.000000e+002192/2271 (96%)
text_code_colored.pngEPI372487A/garganey/Ukraine/05834-NAMRU3/2006 (A/H10N9) segment 2 (PB1)3757.20.000000e+002194/2274 (96%)
text_code_colored.pngEPI372265A/shoveler/Egypt/20313-NAMRU3/2003 (A/H5N2) segment 2 (PB1)3757.20.000000e+002194/2274 (96%)
text_code_colored.pngEPI619291A/mallard/Sweden/1985/2003 (A/H7N7) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI619286A/mallard/Sweden/1997/2003 (A/H7N7) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI619276A/mallard/Sweden/2003/2003 (A/H7N7) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI619269A/mallard/Sweden/2001/2003 (A/H7N7) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI619230A/mallard/Sweden/3331/2003 (A/H7N7) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI619223A/mallard/Sweden/3329/2003 (A/H7N7) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI619151A/mallard/Sweden/50055/2006 (A/H8N4) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI618668A/mallard/Sweden/2213/2003 (A/H12N5) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI618204A/mallard/Sweden/3269/2003 (A/H7N7) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI618163A/mallard/Sweden/1983/2003 (A/H7N7) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI618152A/mallard/Sweden/1978/2003 (A/H7N7) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI617838A/black-headed gull/Republic of Georgia/9/2012 (A/H2N5) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI617753A/mallard/Republic of Georgia/2/2012 (A/H2N3) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI617113A/mallard/Sweden/1962/2003 (A/H7N7) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)
text_code_colored.pngEPI617103A/mallard/Sweden/1981/2003 (A/H7N7) segment 2 (PB1)3753.50.000000e+002194/2275 (96%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588975A/duck/Taiwan/a068/2015 (A/H5N8) segment 3 (PA)3967.70.000000e+002148/2148 (100%)
text_code_colored.pngEPI588967A/chicken/Taiwan/a174/2015 (A/H5N3) segment 3 (PA)3967.70.000000e+002148/2148 (100%)
text_code_colored.pngEPI588951A/goose/Taiwan/a015/2015 (A/H5N8) segment 3 (PA)3962.20.000000e+002147/2148 (99%)
text_code_colored.pngEPI573637A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 3 (PA)3951.10.000000e+002147/2151 (99%)
text_code_colored.pngEPI553207A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA)3951.10.000000e+002147/2151 (99%)
text_code_colored.pngEPI587520A/American wigeon/BC/050-31/2015 (A/H5N8) segment 3 (PA)3917.90.000000e+002141/2151 (99%)
text_code_colored.pngEPI586557A/chicken/BC/FAV25/2014 (A/H5N2) segment 3 (PA)3917.90.000000e+002141/2151 (99%)
text_code_colored.pngEPI586541A/chicken/BC/FAV23/2014 (A/H5N2) segment 3 (PA)3917.90.000000e+002141/2151 (99%)
text_code_colored.pngEPI586525A/chicken/BC/FAV21/2014 (A/H5N2) segment 3 (PA)3917.90.000000e+002141/2151 (99%)
text_code_colored.pngEPI586508A/poultry/BC/FAV19/2014 (A/H5N2) segment 3 (PA)3917.90.000000e+002141/2151 (99%)
text_code_colored.pngEPI569382A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 3 (PA)3917.90.000000e+002141/2151 (99%)
text_code_colored.pngEPI586533A/chicken/BC/FAV22/2014 (A/H5N2) segment 3 (PA)3912.30.000000e+002140/2151 (99%)
text_code_colored.pngEPI586517A/chicken/BC/FAV20/2014 (A/H5N2) segment 3 (PA)3912.30.000000e+002140/2151 (99%)
text_code_colored.pngEPI586500A/poultry/BC/FAV17/2014 (A/H5N2) segment 3 (PA)3912.30.000000e+002140/2151 (99%)
text_code_colored.pngEPI585103A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 3 (PA)3912.30.000000e+002140/2151 (99%)
text_code_colored.pngEPI584078A/turkey/BC/FAV14/2014 (A/H5N2) segment 3 (PA)3912.30.000000e+002140/2151 (99%)
text_code_colored.pngEPI576173A/chicken/BC/FAV8/2014 (A/H5N2) segment 3 (PA)3912.30.000000e+002140/2151 (99%)
text_code_colored.pngEPI590470A/chicken/Washington/3490-18/2015 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI586549A/chicken/BC/FAV24/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI586492A/poultry/BC/FAV15/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI585536A/baikal teal/Korea/2414/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI585535A/baikal teal/Korea/2406/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI585531A/baikal teal/Korea/1458/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI585530A/baikal teal/Korea/1457/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI585528A/baikal teal/Korea/1454/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI585525A/baikal teal/Korea/1448/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI585524A/baikal teal/Korea/1447/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI585523A/baikal teal/Korea/1446/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI573292A/turkey/BC/FAV10/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI569389A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI569370A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI569368A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI569362A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI569360A/chicken/Washington/61-9/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI561712A/bean goose/Korea/H40/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI561643A/tundra swan/Korea/H411/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI561583A/broiler duck/Korea/H133/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI561537A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI561534A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI561502A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI561500A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI561338A/broiler duck/Korea/H49/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI561334A/broiler duck/Korea/H47/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI509694A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)
text_code_colored.pngEPI590471A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI585538A/baikal teal/Korea/2417/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI585537A/baikal teal/Korea/2416/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI585533A/baikal teal/Korea/2402/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI585532A/baikal teal/Korea/2399/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI585529A/baikal teal/Korea/1456/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI576174A/chicken/BC/FAV9/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI573280A/turkey/Washington/61-22/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561687A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561686A/common teal/Korea/H455-30/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561642A/bean goose/Korea/H328/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561640A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561588A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561587A/mallard/Korea/H207/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561586A/breeder duck/Korea/H200/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561584A/broiler duck/Korea/H145/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561582A/breeder duck/Korea/H128/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561501A/broiler duck/Korea/H65/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561335A/broiler duck/Korea/H48/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561333A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561193A/broiler duck/Korea/H31/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI561192A/broiler duck/Korea/H29/2014 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)
text_code_colored.pngEPI662660A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI590475A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI590472A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI590469A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585534A/baikal teal/Korea/2403/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585527A/baikal teal/Korea/1452/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585526A/baikal teal/Korea/1449/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585522A/baikal teal/Korea/1445/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585521A/baikal teal/Korea/1441/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585520A/baikal teal/Korea/1437/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI585107A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561641A/mallard/Korea/H297/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561639A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561585A/breeder duck/Korea/H158/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561539A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561538A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561536A/Coot/Korea/H81/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561535A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561499A/bean goose/Korea/H53/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI561184A/waterfowl/Korea/S005/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI509693A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)
text_code_colored.pngEPI662675A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI662674A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI590473A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI573645A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI561638A/breeder duck/Korea/H249/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI542618A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)
text_code_colored.pngEPI595141A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 3 (PA)3886.50.000000e+002135/2151 (99%)
text_code_colored.pngEPI662673A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI620404A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI620403A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI620402A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI620401A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI620400A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
 

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588953A/goose/Taiwan/a015/2015 (A/H5N8) segment 5 (NP)2760.00.000000e+001496/1497 (99%)
text_code_colored.pngEPI601705A/duck/Jiangxi/285/2013 (A/H0) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI438282A/duck/Vietnam/LBM300/2012 (A/H10N2) segment 5 (NP)2682.50.000000e+001482/1497 (98%)
text_code_colored.pngEPI601644A/duck/Jiangxi/5581/2013 (A/H0) segment 5 (NP)2676.90.000000e+001481/1497 (98%)
text_code_colored.pngEPI601635A/duck/Jiangxi/5576/2013 (A/H0) segment 5 (NP)2676.90.000000e+001481/1497 (98%)
text_code_colored.pngEPI596635A/duck/Quang Ninh/14/2013 (A/H3N6) segment 5 (NP)2671.40.000000e+001480/1497 (98%)
text_code_colored.pngEPI470398A/wild waterfowl/Hong Kong/MPP1311/2013 (A/H2N9) segment 5 (NP)2665.80.000000e+001479/1497 (98%)
text_code_colored.pngEPI617996A/mallard/Republic of Georgia/3/2010 (A/H7N3) segment 5 (NP)2649.20.000000e+001476/1497 (98%)
text_code_colored.pngEPI618038A/domestic duck/Republic of Georgia/2/2010 (A/H10N7) segment 5 (NP)2643.70.000000e+001475/1497 (98%)
text_code_colored.pngEPI618025A/domestic duck/Republic of Georgia/1/2010 (A/H10N7) segment 5 (NP)2643.70.000000e+001475/1497 (98%)
text_code_colored.pngEPI470437A/common teal/Hong Kong/MPM1670/2011 (A/H7N7) segment 5 (NP)2643.70.000000e+001475/1497 (98%)
text_code_colored.pngEPI601836A/duck/Jiangxi/17142/2013 (A/H0) segment 5 (NP)2638.10.000000e+001474/1497 (98%)
text_code_colored.pngEPI470442A/wild waterfowl/Hong Kong/MPL1006/2011 (A/H7N7) segment 5 (NP)2638.10.000000e+001474/1497 (98%)
text_code_colored.pngEPI470441A/wild waterfowl/Hong Kong/MPM2121/2011 (A/H7N7) segment 5 (NP)2638.10.000000e+001474/1497 (98%)
text_code_colored.pngEPI470440A/wild waterfowl/Hong Kong/MPL705/2011 (A/H7N7) segment 5 (NP)2638.10.000000e+001474/1497 (98%)
text_code_colored.pngEPI470438A/common teal/Hong Kong/MPL634/2011 (A/H7N7) segment 5 (NP)2638.10.000000e+001474/1497 (98%)
text_code_colored.pngEPI470436A/common teal/Hong Kong/MPM1645/2011 (A/H7N1) segment 5 (NP)2638.10.000000e+001474/1497 (98%)
text_code_colored.pngEPI470411A/northern shoveler/Hong Kong/MPK276/2009 (A/H11N9) segment 5 (NP)2638.10.000000e+001474/1497 (98%)
text_code_colored.pngEPI601684A/duck/Jiangxi/3961/2013 (A/H0) segment 5 (NP)2636.30.000000e+001459/1475 (98%)
text_code_colored.pngEPI599810A/duck/Jiangxi/15867/2013 (A/H10N3) segment 5 (NP)2632.60.000000e+001473/1497 (98%)
text_code_colored.pngEPI590035A/duck/Quang Ninh/220/2014 (A/H3N2) segment 5 (NP)2632.60.000000e+001473/1497 (98%)
text_code_colored.pngEPI493029A/wild waterfowl/Dongting/C2383/2012 (A/H1N2) segment 5 (NP)2632.60.000000e+001473/1497 (98%)
text_code_colored.pngEPI470439A/common teal/Hong Kong/MPM1740/2011 (A/H7N7) segment 5 (NP)2632.60.000000e+001473/1497 (98%)
text_code_colored.pngEPI446508A/wild goose/Dongting/C1037/2011 (A/H12N8) segment 5 (NP)2628.90.000000e+001472/1497 (98%)
text_code_colored.pngEPI596424A/duck/Vietnam/LBM439/2013 (A/H6N6) segment 5 (NP)2627.10.000000e+001472/1497 (98%)
text_code_colored.pngEPI591918A/wild bird/Jiangxi/34503/2013 (A/H7N7) segment 5 (NP)2627.10.000000e+001472/1497 (98%)
text_code_colored.pngEPI470431A/wild waterfowl/Hong Kong/MPL696/2011 (A/H2N9) segment 5 (NP)2627.10.000000e+001472/1497 (98%)
text_code_colored.pngEPI470377A/wild duck/Jiangxi/19831/2009 (A/H7N7) segment 5 (NP)2627.10.000000e+001472/1497 (98%)
text_code_colored.pngEPI591924A/wild bird/Jiangxi/35982/2013 (A/H7N7) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI591912A/wild bird/Jiangxi/34458/2013 (A/H7N7) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI510819A/duck/Taiwan/11213/2013 (A/H5N2) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI461630A/duck/Hunan/S1256/2012 (A/H3N8) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI392508A/pintail/Korea/1173/09 (A/H7N7) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI407865A/Khaki Campbell duck/Karachi/NARC-23963/2010 (A/H4N6) segment 5 (NP)2617.80.000000e+001470/1497 (98%)
text_code_colored.pngEPI617968A/mallard/Republic of Georgia/1/2010 (A/H10N7) segment 5 (NP)2616.00.000000e+001470/1497 (98%)
text_code_colored.pngEPI617869A/mallard/Republic of Georgia/4/2012 (A/H1N1) segment 5 (NP)2616.00.000000e+001470/1497 (98%)
text_code_colored.pngEPI617770A/mallard/Republic of Georgia/15/2011 (A/H10N7) segment 5 (NP)2616.00.000000e+001470/1497 (98%)
text_code_colored.pngEPI602410A/duck/Jiangxi/33763/2013 (A/H10N3) segment 5 (NP)2616.00.000000e+001470/1497 (98%)
text_code_colored.pngEPI602350A/duck/Jiangxi/33777/2013 (A/H10N3) segment 5 (NP)2616.00.000000e+001470/1497 (98%)
text_code_colored.pngEPI583947A/chicken/Jiangxi/10784/2014 (A/H7N7) segment 5 (NP)2616.00.000000e+001470/1497 (98%)
text_code_colored.pngEPI617758A/mallard/Republic of Georgia/14/2011 (A/H10N7) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602448A/duck/Jiangxi/33665/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602441A/duck/Jiangxi/33663/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602403A/duck/Jiangxi/33759/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602396A/duck/Jiangxi/33757/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602389A/duck/Jiangxi/33753/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602382A/duck/Jiangxi/33713/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602375A/duck/Jiangxi/33699/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602368A/duck/Jiangxi/33695/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602343A/duck/Jiangxi/33775/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602336A/duck/Jiangxi/33769/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602329A/duck/Jiangxi/33765/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI600185A/migratory duck/Jiangxi/33520/2013 (A/H10N7) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI600179A/migratory duck/Jiangxi/33238/2013 (A/H10N7) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI600173A/migratory duck/Jiangxi/33195/2013 (A/H10N7) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI600167A/migratory duck/Jiangxi/33158/2013 (A/H10N7) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI600159A/migratory duck/Jiangxi/33038/2013 (A/H10N7) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI599880A/duck/Jiangxi/33779/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI599873A/duck/Jiangxi/33778/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI599866A/duck/Jiangxi/33747/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI599859A/duck/Jiangxi/33744/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI599852A/duck/Jiangxi/33701/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI599845A/duck/Jiangxi/33653/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI599838A/duck/Jiangxi/33641/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI599831A/duck/Jiangxi/33629/2013 (A/H10N3) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI510826A/duck/Taiwan/11254/2013 (A/H5N2) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI470380A/duck/Jiangxi/23008/2009 (A/H7N7) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI602434A/duck/Jiangxi/33651/2013 (A/H10N3) segment 5 (NP)2608.60.000000e+001468/1497 (98%)
text_code_colored.pngEPI602427A/duck/Jiangxi/33637/2013 (A/H10N3) segment 5 (NP)2604.90.000000e+001468/1497 (98%)
text_code_colored.pngEPI584059A/environment/Kagoshima/KU-ngr-F/2012(H4N8) (A/H4N8) segment 5 (NP)2604.90.000000e+001468/1497 (98%)
text_code_colored.pngEPI470443A/wild waterfowl/Hong Kong/MPM3375/2011 (A/H7N6) segment 5 (NP)2604.90.000000e+001468/1497 (98%)
text_code_colored.pngEPI470378A/duck/Jiangxi/21669/2009 (A/H7N7) segment 5 (NP)2604.90.000000e+001468/1497 (98%)
text_code_colored.pngEPI590230A/duck/Hokkaido/W280/2014 (A/H5N3) segment 5 (NP)2599.40.000000e+001467/1497 (97%)
text_code_colored.pngEPI590216A/duck/Hokkaido/W240/2014 (A/H5N3) segment 5 (NP)2599.40.000000e+001467/1497 (97%)
text_code_colored.pngEPI584047A/environment/Kagoshima/KU-ngr-C/2012(H3N8) (A/H3N8) segment 5 (NP)2599.40.000000e+001467/1497 (97%)
text_code_colored.pngEPI387852A/wild bird/Korea/A02/2011 (A/H10N4) segment 5 (NP)2593.80.000000e+001467/1498 (97%)
text_code_colored.pngEPI441047A/duck/Vietnam/LBM185/2012 (A/H6N6) segment 5 (NP)2588.30.000000e+001465/1497 (97%)
text_code_colored.pngEPI387853A/wild bird/Korea/A01/2011 (A/H10N4) segment 5 (NP)2588.30.000000e+001466/1498 (97%)
text_code_colored.pngEPI315101A/mallard/PT/27972-B139/2007 (A/H9N2) segment 5 (NP)2588.30.000000e+001465/1497 (97%)
text_code_colored.pngEPI600153A/migratory duck/Jiangxi/31577/2013 (A/H10N5) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI588969A/chicken/Taiwan/a174/2015 (A/H5N3) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI363536A/duck/Guizhou/2773/2006 (A/H6N2) segment 5 (NP)2582.70.000000e+001465/1498 (97%)
text_code_colored.pngEPI588977A/duck/Taiwan/a068/2015 (A/H5N8) segment 5 (NP)2577.20.000000e+001463/1497 (97%)
text_code_colored.pngEPI470415A/duck/Yunnan/87/2007 (A/H7N6) segment 5 (NP)2577.20.000000e+001463/1497 (97%)
text_code_colored.pngEPI618599A/mallard/Sweden/107688/2009 (A/H10N1) segment 5 (NP)2571.70.000000e+001462/1497 (97%)
text_code_colored.pngEPI588961A/duck/Taiwan/a043/2015 (A/H5N2) segment 5 (NP)2571.70.000000e+001463/1498 (97%)
text_code_colored.pngEPI515143A/duck/Vietnam/LBM533/2013 (A/H3N6) segment 5 (NP)2571.70.000000e+001462/1497 (97%)
text_code_colored.pngEPI316769A/mallard/Czech Republic/13579-84K/2010 (A/H4N6) segment 5 (NP)2568.00.000000e+001461/1497 (97%)
text_code_colored.pngEPI617983A/mallard/Republic of Georgia/3/2011 (A/H3N8) segment 5 (NP)2566.10.000000e+001461/1497 (97%)
text_code_colored.pngEPI270063A/aquatic bird/India/NIV-17095/2007 (A/H11N1) segment 5 (NP)2566.10.000000e+001461/1497 (97%)
text_code_colored.pngEPI268706A/mallard/Jiangxi/7376/2003 (A/H6N2) segment 5 (NP)2566.10.000000e+001461/1497 (97%)
text_code_colored.pngEPI222088A/garganey/Altai/1213/2007 (A/H5N2) segment 5 (NP)2566.10.000000e+001461/1497 (97%)
text_code_colored.pngEPI222048A/gadwall/Altai/1202/2007 (A/H5N2) segment 5 (NP)2566.10.000000e+001461/1497 (97%)
text_code_colored.pngEPI585406A/environment/Vietnam/1423/2014 (A/H6N2) segment 5 (NP)2560.60.000000e+001459/1495 (97%)
text_code_colored.pngEPI168528A/mute swan/Aktau/1460/2006 (A/H5N1) segment 5 (NP)2560.60.000000e+001436/1461 (98%)
text_code_colored.pngEPI647719A/duck/Vietnam/HU1-151/2014 (A/H11N7) segment 5 (NP)2558.70.000000e+001456/1491 (97%)
text_code_colored.pngEPI590769A/mandarin duck/Korea/K12-256/2012 (A/H9N2) segment 5 (NP)2558.70.000000e+001441/1469 (98%)
text_code_colored.pngEPI647717A/duck/Vietnam/HU1-627/2014 (A/H6N6) segment 5 (NP)2556.90.000000e+001458/1495 (97%)
text_code_colored.pngEPI506050A/duck/Moscow/4182/2010 (A/H5N3) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI372497A/mallard/Ukraine/05842-NAMRU3/2006 (A/H3N8) segment 5 (NP)2555.00.000000e+001459/1497 (97%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI588956A/goose/Taiwan/a015/2015 (A/H5N8) segment 8 (NS)1548.60.000000e+00838/838 (100%)
text_code_colored.pngEPI573642A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 8 (NS)1548.60.000000e+00838/838 (100%)
text_code_colored.pngEPI588972A/chicken/Taiwan/a174/2015 (A/H5N3) segment 8 (NS)1543.10.000000e+00837/838 (99%)
text_code_colored.pngEPI586554A/chicken/BC/FAV24/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI586538A/chicken/BC/FAV22/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI586522A/chicken/BC/FAV20/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI586514A/poultry/BC/FAV19/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585671A/baikal teal/Korea/2417/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585670A/baikal teal/Korea/2416/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585669A/baikal teal/Korea/2414/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585667A/baikal teal/Korea/2403/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585666A/baikal teal/Korea/2402/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585664A/baikal teal/Korea/1458/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585663A/baikal teal/Korea/1457/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585660A/baikal teal/Korea/1452/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585657A/baikal teal/Korea/1447/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585656A/baikal teal/Korea/1446/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585655A/baikal teal/Korea/1445/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585653A/baikal teal/Korea/1437/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI585096A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI576474A/chicken/BC/FAV8/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI569394A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI569387A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI568703A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI568700A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561713A/broiler duck/Korea/H31/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561701A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561694A/common teal/Korea/H455-30/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561685A/tundra swan/Korea/H411/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561678A/bean goose/Korea/H328/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561671A/mallard/Korea/H297/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561664A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561657A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561630A/mallard/Korea/H207/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561623A/breeder duck/Korea/H200/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561574A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561560A/Coot/Korea/H81/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561553A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561533A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561519A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561345A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI561200A/broiler duck/Korea/H29/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI542634A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI509757A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI509712A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)
text_code_colored.pngEPI662685A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI590737A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI590723A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI590716A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI587525A/American wigeon/BC/050-31/2015 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI586562A/chicken/BC/FAV25/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI586546A/chicken/BC/FAV23/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI586530A/chicken/BC/FAV21/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI586505A/poultry/BC/FAV17/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585668A/baikal teal/Korea/2406/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585665A/baikal teal/Korea/2399/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585661A/baikal teal/Korea/1454/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585659A/baikal teal/Korea/1449/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585658A/baikal teal/Korea/1448/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI585654A/baikal teal/Korea/1441/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI584083A/turkey/BC/FAV14/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI573175A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI573166A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI569366A/turkey/Washington/61-22/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561650A/breeder duck/Korea/H249/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561609A/broiler duck/Korea/H145/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561602A/broiler duck/Korea/H133/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561595A/breeder duck/Korea/H128/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561581A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561546A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561364A/bean goose/Korea/H40/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561357A/broiler duck/Korea/H48/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561352A/broiler duck/Korea/H47/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI561191A/waterfowl/Korea/S005/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI554604A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI553471A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI552750A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI548628A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI548428A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)
text_code_colored.pngEPI662741A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI662720A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI662713A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI662706A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI662692A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620461A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620447A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620440A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620433A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620426A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620419A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI620412A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI590696A/chicken/Washington/3490-18/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI590689A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI587637A/chicken/Iowa/04-20/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI586497A/poultry/BC/FAV15/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI585662A/baikal teal/Korea/1456/2014 (A/H5N8) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI576481A/chicken/BC/FAV9/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI573302A/turkey/BC/FAV10/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI573183A/duck/Netherlands/14015898/2014 (A/H5N8) segment 8 (NS)1526.50.000000e+00834/838 (99%)
text_code_colored.pngEPI569363A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI690784A/goose/Taiwan/TNO20/2015 (A/H5N8) segment 4 (HA)3147.80.000000e+001704/1704 (100%)
text_code_colored.pngEPI690752A/goose/Taiwan/TNO16/2015 (A/H5N8) segment 4 (HA)3147.80.000000e+001704/1704 (100%)
text_code_colored.pngEPI690744A/goose/Taiwan/TNO15/2015 (A/H5N8) segment 4 (HA)3147.80.000000e+001704/1704 (100%)
text_code_colored.pngEPI690696A/goose/Taiwan/TNO9/2015 (A/H5N8) segment 4 (HA)3147.80.000000e+001704/1704 (100%)
text_code_colored.pngEPI690672A/goose/Taiwan/TNO6/2015 (A/H5N8) segment 4 (HA)3147.80.000000e+001704/1704 (100%)
text_code_colored.pngEPI690656A/goose/Taiwan/TNO4/2015 (A/H5N8) segment 4 (HA)3147.80.000000e+001704/1704 (100%)
text_code_colored.pngEPI690640A/goose/Taiwan/TNO2/2015 (A/H5N8) segment 4 (HA)3147.80.000000e+001704/1704 (100%)
text_code_colored.pngEPI690600A/goose/Taiwan/TNC11/2015 (A/H5N8) segment 4 (HA)3147.80.000000e+001704/1704 (100%)
text_code_colored.pngEPI690552A/goose/Taiwan/TNC5/2015 (A/H5N8) segment 4 (HA)3147.80.000000e+001704/1704 (100%)
text_code_colored.pngEPI690544A/goose/Taiwan/TNC4/2015 (A/H5N8) segment 4 (HA)3147.80.000000e+001704/1704 (100%)
text_code_colored.pngEPI588952A/goose/Taiwan/a015/2015 (A/H5N8) segment 4 (HA)3142.30.000000e+001703/1704 (99%)
text_code_colored.pngEPI588968A/chicken/Taiwan/a174/2015 (A/H5N3) segment 4 (HA)3120.10.000000e+001699/1704 (99%)
text_code_colored.pngEPI573638A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA)3120.10.000000e+001699/1704 (99%)
text_code_colored.pngEPI690648A/goose/Taiwan/TNO3/2015 (A/H5N8) segment 4 (HA)3114.60.000000e+001698/1704 (99%)
text_code_colored.pngEPI690776A/goose/Taiwan/TNO19/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690768A/goose/Taiwan/TNO18/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690760A/goose/Taiwan/TNO17/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690728A/goose/Taiwan/TNO13/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690720A/goose/Taiwan/TNO12/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690712A/goose/Taiwan/TNO11/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690688A/goose/Taiwan/TNO8/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690632A/goose/Taiwan/TNO1/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690624A/goose/Taiwan/TNC14/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690608A/goose/Taiwan/TNC12/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690592A/goose/Taiwan/TNC10/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690576A/goose/Taiwan/TNC8/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690568A/goose/Taiwan/TNC7/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690560A/goose/Taiwan/TNC6/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690528A/goose/Taiwan/TNC2/2015 (A/H5N8) segment 4 (HA)3109.00.000000e+001697/1704 (99%)
text_code_colored.pngEPI690736A/goose/Taiwan/TNO14/2015 (A/H5N8) segment 4 (HA)3103.50.000000e+001696/1704 (99%)
text_code_colored.pngEPI690704A/goose/Taiwan/TNO10/2015 (A/H5N8) segment 4 (HA)3103.50.000000e+001696/1704 (99%)
text_code_colored.pngEPI690680A/goose/Taiwan/TNO7/2015 (A/H5N8) segment 4 (HA)3103.50.000000e+001696/1704 (99%)
text_code_colored.pngEPI690616A/goose/Taiwan/TNC13/2015 (A/H5N8) segment 4 (HA)3103.50.000000e+001696/1704 (99%)
text_code_colored.pngEPI690584A/goose/Taiwan/TNC9/2015 (A/H5N8) segment 4 (HA)3103.50.000000e+001696/1704 (99%)
text_code_colored.pngEPI690536A/goose/Taiwan/TNC3/2015 (A/H5N8) segment 4 (HA)3103.50.000000e+001696/1704 (99%)
text_code_colored.pngEPI690520A/goose/Taiwan/TNC1/2015 (A/H5N8) segment 4 (HA)3103.50.000000e+001696/1704 (99%)
text_code_colored.pngEPI588976A/duck/Taiwan/a068/2015 (A/H5N8) segment 4 (HA)3103.50.000000e+001696/1704 (99%)
text_code_colored.pngEPI588960A/duck/Taiwan/a043/2015 (A/H5N2) segment 4 (HA)3103.50.000000e+001696/1704 (99%)
text_code_colored.pngEPI553208A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA)3094.30.000000e+001693/1702 (99%)
text_code_colored.pngEPI586534A/chicken/BC/FAV22/2014 (A/H5N2) segment 4 (HA)3077.60.000000e+001691/1704 (99%)
text_code_colored.pngEPI690461A/Cooper's hawk/Minnesota/198225/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI690363A/mallard/Washington/196262/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI690329A/mallard/Oregon/AH0003821/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI690255A/American green-winged teal/Oregon/AH0012403/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI690248A/American green-winged teal/Idaho/AH0011899/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI690159A/wood duck/Oregon/AH0007257/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI690152A/wood duck/Oregon/AH0007244/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI690145A/Northern pintail/Oregon/AH0003967/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI690124A/snow goose/Missouri/15-011246-1/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI590712A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI586550A/chicken/BC/FAV24/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI586518A/chicken/BC/FAV20/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI586509A/poultry/BC/FAV19/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI584079A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI573298A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)
text_code_colored.pngEPI569383A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001692/1705 (99%)
text_code_colored.pngEPI690420A/American wigeon/Washington/195205/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI690413A/American wigeon/Washington/195198/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI690385A/mallard/Washington/196865/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI690350A/mallard/Oregon/195547/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI690343A/Northern pintail/Washington/195365/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI690219A/Northern pintail/Oregon/AH0003871/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI690212A/mallard/Oregon/AH0008887/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI690166A/wood duck/Oregon/AH0007263/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI662744A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI662723A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI590740A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI590733A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI590719A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI586542A/chicken/BC/FAV23/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI586526A/chicken/BC/FAV21/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI586493A/poultry/BC/FAV15/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI585092A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI576470A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI569390A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI569376A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI569372A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)
text_code_colored.pngEPI690454A/Canada goose/Washington/197619/2014 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI690447A/mallard/Washington/195810/2014 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI690427A/mallard/Washington/195246/2014 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI690336A/bald eagle/Idaho/15-002892-2/2015 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI690322A/mallard/Idaho/AH0005955/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI690276A/mallard/Nevada/AH0006855/2015 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI690194A/mallard/Idaho/AH0008597/2015 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI690180A/Northern shoveler/Oregon/AH0007337/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI690131A/American wigeon/Utah/AH0007824/2015 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI662737A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI662701A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI620408A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI590726A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI590699A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI590692A/chicken/Washington/3490-18/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI587633A/chicken/Iowa/04-20/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI587521A/American wigeon/BC/050-31/2015 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI586501A/poultry/BC/FAV17/2014 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI585084A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI576477A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI573281A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)
text_code_colored.pngEPI690468A/snowy owl/Wisconsin/198399/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI690269A/American wigeon/Oregon/AH0012525/2015 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI690262A/Canada goose/Oregon/AH0012452/2015 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI690241A/mallard/Idaho/AH0007413/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI690234A/mallard/Idaho/AH0007412/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI690173A/Northern shoveler/Oregon/AH0007332/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI690121A/Northern shoveler/Oregon/AH0007339/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI662709A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI662688A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI590685A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI586558A/chicken/BC/FAV25/2014 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI573271A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI573208A/gadwall/Korea/H1351/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI561570A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)
text_code_colored.pngEPI690406A/mallard/Oregon/195536/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI690392A/American wigeon/Washington/196336/2015 (A/H5N1) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI690315A/mallard/Idaho/AH0005954/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI690286A/chicken/California/15-004912/2015 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI662730A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)
text_code_colored.pngEPI662716A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI662694A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)
text_code_colored.pngEPI620422A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)
text_code_colored.pngEPI585595A/baikal teal/Korea/2417/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI585589A/baikal teal/Korea/2399/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI585586A/baikal teal/Korea/1456/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI573276A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI573242A/Common Teal/Korea/H844/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561646A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561626A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561605A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561591A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561529A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561508A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI561341A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)
text_code_colored.pngEPI690474A/Canada goose/Kansas/197850/2015 (A/H5N2) segment 4 (HA)3048.10.000000e+001687/1705 (98%)
text_code_colored.pngEPI690399A/American wigeon/Washington/196340/2015 (A/H5N1) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI690378A/Northern pintail/Washington/196271/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI690138A/mallard/Oregon/AH0003952/2015 (A/H5N2) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI620436A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 4 (HA)3048.10.000000e+001687/1705 (98%)
text_code_colored.pngEPI585594A/baikal teal/Korea/2416/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585592A/baikal teal/Korea/2406/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585591A/baikal teal/Korea/2403/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585590A/baikal teal/Korea/2402/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585582A/baikal teal/Korea/1448/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585581A/baikal teal/Korea/1447/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585579A/baikal teal/Korea/1445/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI585577A/baikal teal/Korea/1437/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI573286A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI573199A/breeder chicken/Korea/H1068/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI573197A/chicken/Korea/H881/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561674A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561612A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561577A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561563A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561542A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI561522A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
text_code_colored.pngEPI690440A/peregrine falcon/Washington/196426/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI620457A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 4 (HA)3042.60.000000e+001686/1705 (98%)
text_code_colored.pngEPI620450A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 4 (HA)3042.60.000000e+001686/1705 (98%)
text_code_colored.pngEPI620443A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 4 (HA)3042.60.000000e+001686/1705 (98%)
text_code_colored.pngEPI620415A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 4 (HA)3042.60.000000e+001686/1705 (98%)
text_code_colored.pngEPI585593A/baikal teal/Korea/2414/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI585587A/baikal teal/Korea/1457/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI585584A/baikal teal/Korea/1452/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI585583A/baikal teal/Korea/1449/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI561705A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI561667A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001686/1705 (98%)
text_code_colored.pngEPI561653A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI561633A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI509704A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA)3042.60.000000e+001685/1704 (98%)
text_code_colored.pngEPI690356A/American wigeon/Washington/195968/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI662681A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI620429A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 4 (HA)3037.00.000000e+001685/1705 (98%)
text_code_colored.pngEPI585580A/baikal teal/Korea/1446/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI573200A/Korean native chicken/Korea/H1139/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI573196A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI573194A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI561697A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI561681A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI561660A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI561598A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI561360A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI561348A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI561336A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI561204A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI561196A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI561187A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI517161A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA)3037.00.000000e+001684/1704 (98%)
text_code_colored.pngEPI585588A/baikal teal/Korea/1458/2014 (A/H5N8) segment 4 (HA)3031.50.000000e+001683/1704 (98%)
text_code_colored.pngEPI585585A/baikal teal/Korea/1454/2014 (A/H5N8) segment 4 (HA)3031.50.000000e+001683/1704 (98%)
text_code_colored.pngEPI573192A/breeder chicken/Korea/H503/2014 (A/H5N8) segment 4 (HA)3031.50.000000e+001683/1704 (98%)
text_code_colored.pngEPI561690A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA)3031.50.000000e+001683/1704 (98%)
text_code_colored.pngEPI561556A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA)3031.50.000000e+001683/1704 (98%)
text_code_colored.pngEPI561549A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA)3031.50.000000e+001683/1704 (98%)
text_code_colored.pngEPI561515A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA)3031.50.000000e+001683/1704 (98%)
text_code_colored.pngEPI509709A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA)3031.50.000000e+001683/1704 (98%)
text_code_colored.pngEPI585578A/baikal teal/Korea/1441/2014 (A/H5N8) segment 4 (HA)3025.90.000000e+001682/1704 (98%)
text_code_colored.pngEPI573240A/breeder duck/Korea/H345/2014 (A/H5N8) segment 4 (HA)3025.90.000000e+001682/1704 (98%)
text_code_colored.pngEPI573203A/chicken/Korea/H1292/2014 (A/H5N8) segment 4 (HA)3025.90.000000e+001682/1704 (98%)
text_code_colored.pngEPI573195A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA)3025.90.000000e+001682/1704 (98%)
text_code_colored.pngEPI573207A/chicken/Korea/H1350/2014 (A/H5N8) segment 4 (HA)3020.40.000000e+001681/1704 (98%)
text_code_colored.pngEPI573205A/Korean native chicken/Korea/H1299/2014 (A/H5N8) segment 4 (HA)3020.40.000000e+001681/1704 (98%)
text_code_colored.pngEPI573201A/chicken/Korea/H1236/2014 (A/H5N8) segment 4 (HA)3020.40.000000e+001681/1704 (98%)
text_code_colored.pngEPI561619A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA)3020.40.000000e+001682/1705 (98%)
text_code_colored.pngEPI573241A/breeder duck/Korea/H566/2014 (A/H5N8) segment 4 (HA)3014.90.000000e+001681/1705 (98%)
text_code_colored.pngEPI573212A/Korean native chicken/Korea/H1554/2014 (A/H5N8) segment 4 (HA)3014.90.000000e+001680/1704 (98%)
text_code_colored.pngEPI573211A/goose/Korea/H1545/2014 (A/H5N8) segment 4 (HA)3014.90.000000e+001680/1704 (98%)
text_code_colored.pngEPI573204A/goose/Korea/H1296/2014 (A/H5N8) segment 4 (HA)3014.90.000000e+001681/1705 (98%)
text_code_colored.pngEPI573202A/chicken/Korea/H1268/2014 (A/H5N8) segment 4 (HA)3014.90.000000e+001680/1704 (98%)
text_code_colored.pngEPI542628A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA)3014.90.000000e+001680/1704 (98%)
text_code_colored.pngEPI573213A/broiler duck/Korea/H1556/2014 (A/H5N8) segment 4 (HA)3009.30.000000e+001679/1704 (98%)
text_code_colored.pngEPI573198A/broiler duck/Korea/H959/2014 (A/H5N8) segment 4 (HA)3009.30.000000e+001679/1704 (98%)
text_code_colored.pngEPI553349A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA)3009.30.000000e+001679/1704 (98%)
text_code_colored.pngEPI573209A/broiler duck/Korea/H1413/2014 (A/H5N8) segment 4 (HA)3003.80.000000e+001678/1704 (98%)
text_code_colored.pngEPI573206A/breeder duck/Korea/H1343/2014 (A/H5N8) segment 4 (HA)3003.80.000000e+001678/1704 (98%)
text_code_colored.pngEPI550849A/duck/England/36226/14 (A/H5N8) segment 4 (HA)3003.80.000000e+001678/1704 (98%)
text_code_colored.pngEPI550848A/duck/England/36038/14 (A/H5N8) segment 4 (HA)3003.80.000000e+001678/1704 (98%)
text_code_colored.pngEPI573218A/Korean native chicken/Korea/H1687/2014 (A/H5N8) segment 4 (HA)2992.70.000000e+001676/1704 (98%)
text_code_colored.pngEPI573217A/broiler duck/Korea/H1685/2014 (A/H5N8) segment 4 (HA)2992.70.000000e+001676/1704 (98%)
text_code_colored.pngEPI573216A/broiler duck/Korea/H1683/2014 (A/H5N8) segment 4 (HA)2992.70.000000e+001676/1704 (98%)
text_code_colored.pngEPI573210A/broiler duck/Korea/H1414/2014 (A/H5N8) segment 4 (HA)2992.70.000000e+001676/1704 (98%)
text_code_colored.pngEPI547673A/duck/England/36254/14 (A/H5N8) segment 4 (HA)2992.70.000000e+001676/1704 (98%)
text_code_colored.pngEPI576384A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 4 (HA)2989.00.000000e+001675/1704 (98%)
text_code_colored.pngEPI576391A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 4 (HA)2987.20.000000e+001675/1704 (98%)
text_code_colored.pngEPI573239A/mallard/Korea/H1924-6/2014 (A/H5N8) segment 4 (HA)2987.20.000000e+001675/1704 (98%)
text_code_colored.pngEPI573219A/goose/Korea/H1689/2014 (A/H5N8) segment 4 (HA)2987.20.000000e+001675/1704 (98%)
text_code_colored.pngEPI573228A/broiler duck/Korea/H1755/2014 (A/H5N8) segment 4 (HA)2981.60.000000e+001674/1704 (98%)
text_code_colored.pngEPI573227A/breeder duck/Korea/H1752/2014 (A/H5N8) segment 4 (HA)2981.60.000000e+001674/1704 (98%)
text_code_colored.pngEPI573222A/broiler duck/Korea/H1733/2014 (A/H5N8) segment 4 (HA)2981.60.000000e+001674/1704 (98%)
text_code_colored.pngEPI573220A/goose/Korea/H1698/2014 (A/H5N8) segment 4 (HA)2981.60.000000e+001674/1704 (98%)
text_code_colored.pngEPI573215A/breeder duck/Korea/H1596/2014 (A/H5N8) segment 4 (HA)2981.60.000000e+001674/1704 (98%)
text_code_colored.pngEPI573214A/broiler duck/Korea/H1582/2014 (A/H5N8) segment 4 (HA)2981.60.000000e+001674/1704 (98%)
text_code_colored.pngEPI573179A/duck/Netherlands/14015898/2014 (A/H5N8) segment 4 (HA)2981.60.000000e+001674/1704 (98%)
text_code_colored.pngEPI552746A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 4 (HA)2981.60.000000e+001674/1704 (98%)
text_code_colored.pngEPI548493A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA)2981.60.000000e+001674/1704 (98%)
text_code_colored.pngEPI548485A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA)2981.60.000000e+001674/1704 (98%)
text_code_colored.pngEPI547678A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA)2981.60.000000e+001674/1704 (98%)
text_code_colored.pngEPI595055A/common teal/Korea/KU-12/2015 (A/H5N8) segment 4 (HA)2976.10.000000e+001674/1705 (98%)
text_code_colored.pngEPI573229A/broiler duck/Korea/H1763/2014 (A/H5N8) segment 4 (HA)2976.10.000000e+001673/1704 (98%)
text_code_colored.pngEPI573224A/broiler duck/Korea/H1739/2014 (A/H5N8) segment 4 (HA)2976.10.000000e+001673/1704 (98%)
text_code_colored.pngEPI573187A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 4 (HA)2976.10.000000e+001674/1705 (98%)
text_code_colored.pngEPI573171A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 4 (HA)2976.10.000000e+001673/1704 (98%)
text_code_colored.pngEPI573163A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 4 (HA)2976.10.000000e+001674/1705 (98%)
text_code_colored.pngEPI548623A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA)2976.10.000000e+001673/1704 (98%)
text_code_colored.pngEPI573235A/Korean native chicken/Korea/H1903/2014 (A/H5N8) segment 4 (HA)2970.50.000000e+001672/1704 (98%)
text_code_colored.pngEPI573233A/Korean native chicken/Korea/H1847/2014 (A/H5N8) segment 4 (HA)2970.50.000000e+001672/1704 (98%)
text_code_colored.pngEPI573231A/broiler duck/Korea/H1839/2014 (A/H5N8) segment 4 (HA)2970.50.000000e+001672/1704 (98%)
text_code_colored.pngEPI573225A/broiler duck/Korea/H1745/2014 (A/H5N8) segment 4 (HA)2970.50.000000e+001672/1704 (98%)
text_code_colored.pngEPI573223A/broiler duck/Korea/H1734/2014 (A/H5N8) segment 4 (HA)2970.50.000000e+001672/1704 (98%)
text_code_colored.pngEPI573221A/broiler duck/Korea/H1731/2014 (A/H5N8) segment 4 (HA)2970.50.000000e+001672/1704 (98%)
text_code_colored.pngEPI553362A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA)2970.50.000000e+001672/1704 (98%)
text_code_colored.pngEPI553343A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA)2970.50.000000e+001673/1705 (98%)
text_code_colored.pngEPI573654A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 4 (HA)2965.00.000000e+001672/1705 (98%)
text_code_colored.pngEPI573646A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 4 (HA)2965.00.000000e+001672/1705 (98%)
text_code_colored.pngEPI573230A/broiler duck/Korea/H1803/2014 (A/H5N8) segment 4 (HA)2965.00.000000e+001671/1704 (98%)
text_code_colored.pngEPI573226A/Korean native chicken/Korea/H1747/2014 (A/H5N8) segment 4 (HA)2965.00.000000e+001671/1704 (98%)
text_code_colored.pngEPI595079A/mallard/Korea/N15-99/2015 (A/H5N8) segment 4 (HA)2959.50.000000e+001671/1705 (98%)
text_code_colored.pngEPI595066A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 4 (HA)2959.50.000000e+001672/1706 (98%)
text_code_colored.pngEPI573664A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 4 (HA)2959.50.000000e+001671/1705 (98%)
text_code_colored.pngEPI573234A/broiler duck/Korea/H1864/2014 (A/H5N8) segment 4 (HA)2959.50.000000e+001670/1704 (98%)
text_code_colored.pngEPI573232A/broiler duck/Korea/H1840/2014 (A/H5N8) segment 4 (HA)2959.50.000000e+001670/1704 (98%)
text_code_colored.pngEPI544756A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA)2959.50.000000e+001662/1692 (98%)
text_code_colored.pngEPI573680A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 4 (HA)2953.90.000000e+001670/1705 (97%)
text_code_colored.pngEPI573672A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 4 (HA)2953.90.000000e+001670/1705 (97%)
text_code_colored.pngEPI573238A/mallard/Korea/H2003/2014 (A/H5N8) segment 4 (HA)2953.90.000000e+001670/1705 (97%)
text_code_colored.pngEPI573237A/mallard/Korea/H1991/2014 (A/H5N8) segment 4 (HA)2953.90.000000e+001670/1705 (97%)
text_code_colored.pngEPI573236A/spot-billed duck/Korea/H1981/2014 (A/H5N8) segment 4 (HA)2953.90.000000e+001670/1705 (97%)
text_code_colored.pngEPI595138A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 4 (HA)2948.40.000000e+001669/1705 (97%)
text_code_colored.pngEPI595133A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 4 (HA)2948.40.000000e+001669/1705 (97%)
text_code_colored.pngEPI595124A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 4 (HA)2948.40.000000e+001669/1705 (97%)
text_code_colored.pngEPI595116A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 4 (HA)2948.40.000000e+001669/1705 (97%)
text_code_colored.pngEPI595107A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 4 (HA)2948.40.000000e+001669/1705 (97%)
text_code_colored.pngEPI595094A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 4 (HA)2948.40.000000e+001669/1705 (97%)
text_code_colored.pngEPI595146A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 4 (HA)2944.70.000000e+001668/1705 (97%)
text_code_colored.pngEPI595082A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 4 (HA)2944.70.000000e+001668/1705 (97%)
text_code_colored.pngEPI590679A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 4 (HA)2937.30.000000e+001658/1692 (97%)
text_code_colored.pngEPI585111A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 4 (HA)2937.30.000000e+001658/1692 (97%)
text_code_colored.pngEPI568474A/green-winged teal/Korea/KU-12/2015 (A/H5) segment 4 (HA)2937.30.000000e+001657/1690 (98%)
text_code_colored.pngEPI596301A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA)2935.40.000000e+001652/1683 (98%)
text_code_colored.pngEPI596295A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 4 (HA)2935.40.000000e+001658/1692 (97%)
text_code_colored.pngEPI552776A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA)2935.40.000000e+001652/1683 (98%)
text_code_colored.pngEPI552768A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA)2935.40.000000e+001658/1692 (97%)
text_code_colored.pngEPI596289A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 4 (HA)2898.50.000000e+001623/1650 (98%)
text_code_colored.pngEPI552760A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA)2898.50.000000e+001623/1650 (98%)
text_code_colored.pngEPI551149A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA)2889.30.000000e+001633/1667 (97%)
text_code_colored.pngEPI543010A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA)2832.00.000000e+001583/1608 (98%)
text_code_colored.pngEPI551143A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA)2826.50.000000e+001584/1611 (98%)
text_code_colored.pngEPI543002A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA)2821.00.000000e+001582/1609 (98%)
text_code_colored.pngEPI593747A/goose/Shandong/k1201/2009 (A/H5N1) segment 4 (HA)2815.40.000000e+001647/1707 (96%)
text_code_colored.pngEPI542617A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA)2815.40.000000e+001579/1608 (98%)
text_code_colored.pngEPI475579A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA)2815.40.000000e+001648/1708 (96%)
text_code_colored.pngEPI442017A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA)2815.40.000000e+001647/1707 (96%)
text_code_colored.pngEPI399960A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA)2776.60.000000e+001642/1709 (96%)
text_code_colored.pngEPI398966A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA)2771.10.000000e+001640/1708 (96%)
text_code_colored.pngEPI398965A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA)2765.60.000000e+001639/1708 (95%)
text_code_colored.pngEPI672795A/duck/Guangdong/s14044/2014 (A/H5N8) segment 4 (HA)2760.00.000000e+001639/1709 (95%)
text_code_colored.pngEPI672787A/goose/Guangdong/s13124/2013 (A/H5N8) segment 4 (HA)2760.00.000000e+001639/1709 (95%)
text_code_colored.pngEPI431456A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA)2760.00.000000e+001638/1708 (95%)
text_code_colored.pngEPI602419A/chicken/Dongguan/3363/2013 (A/H5N6) segment 4 (HA)2748.90.000000e+001635/1707 (95%)
text_code_colored.pngEPI602412A/chicken/Dongguan/2690/2013 (A/H5N6) segment 4 (HA)2748.90.000000e+001635/1707 (95%)
text_code_colored.pngEPI602045A/chicken/Dongguan/2818/2013 (A/H0) segment 4 (HA)2748.90.000000e+001635/1707 (95%)
text_code_colored.pngEPI602028A/chicken/Dongguan/4190/2013 (A/H0) segment 4 (HA)2745.20.000000e+001634/1707 (95%)
text_code_colored.pngEPI690800A/goose/Shandong/WFSG1/2014 (A/H5N8) segment 4 (HA)2743.40.000000e+001634/1707 (95%)
text_code_colored.pngEPI599662A/goose/Shantou/1806/2014 (A/H5N6) segment 4 (HA)2743.40.000000e+001635/1708 (95%)
text_code_colored.pngEPI599655A/goose/Shantou/1791/2014 (A/H5N6) segment 4 (HA)2743.40.000000e+001635/1708 (95%)
text_code_colored.pngEPI599648A/goose/Shantou/1763/2014 (A/H5N6) segment 4 (HA)2743.40.000000e+001635/1708 (95%)
text_code_colored.pngEPI599339A/duck/Dongguan/3069/2013 (A/H5N6) segment 4 (HA)2743.40.000000e+001634/1707 (95%)
text_code_colored.pngEPI599299A/chicken/Shenzhen/1395/2013 (A/H5N6) segment 4 (HA)2743.40.000000e+001634/1707 (95%)
text_code_colored.pngEPI530054A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA)2743.40.000000e+001634/1707 (95%)
text_code_colored.pngEPI509698A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA)2743.40.000000e+001635/1708 (95%)
text_code_colored.pngEPI681296A/chicken/Zhejiang/727155/2014 (A/H5N6) segment 4 (HA)2737.90.000000e+001633/1707 (95%)
text_code_colored.pngEPI681288A/goose/Zhejiang/925036/2014 (A/H5N6) segment 4 (HA)2737.90.000000e+001631/1705 (95%)
text_code_colored.pngEPI602484A/chicken/Shenzhen/1061/2013 (A/H5N6) segment 4 (HA)2737.90.000000e+001634/1708 (95%)
text_code_colored.pngEPI599346A/chicken/Dongguan/4259/2013 (A/H5N6) segment 4 (HA)2737.90.000000e+001633/1707 (95%)
text_code_colored.pngEPI599333A/silkie chicken/Dongguan/2809/2013 (A/H5N6) segment 4 (HA)2737.90.000000e+001633/1707 (95%)
text_code_colored.pngEPI599327A/duck/Dongguan/2685/2013 (A/H5N6) segment 4 (HA)2737.90.000000e+001633/1707 (95%)
text_code_colored.pngEPI599292A/chicken/Shenzhen/552/2013 (A/H5N6) segment 4 (HA)2737.90.000000e+001633/1707 (95%)
text_code_colored.pngEPI591879A/duck/Jiangxi/23970/2013 (A/H0) segment 4 (HA)2737.90.000000e+001634/1708 (95%)
text_code_colored.pngEPI590813A/duck/Jiangxi/NCDZT1126/2014 (A/H5N6) segment 4 (HA)2737.90.000000e+001633/1707 (95%)
text_code_colored.pngEPI544892A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA)2737.90.000000e+001636/1710 (95%)
text_code_colored.pngEPI531456A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA)2737.90.000000e+001633/1707 (95%)
text_code_colored.pngEPI690792A/goose/Jiangsu/QD5/2014 (A/H5N8) segment 4 (HA)2732.30.000000e+001634/1709 (95%)
text_code_colored.pngEPI681300A/goose/Zhejiang/925104/2014 (A/H5N8) segment 4 (HA)2732.30.000000e+001633/1708 (95%)
text_code_colored.pngEPI681299A/goose/Zhejiang/925037/2014 (A/H5N8) segment 4 (HA)2732.30.000000e+001633/1708 (95%)
text_code_colored.pngEPI681295A/chicken/Zhejiang/727026/2014 (A/H5N6) segment 4 (HA)2732.30.000000e+001632/1707 (95%)
text_code_colored.pngEPI681294A/chicken/Zhejiang/727022/2014 (A/H5N6) segment 4 (HA)2732.30.000000e+001632/1707 (95%)
text_code_colored.pngEPI681284A/chicken/Zhejiang/727159/2014 (A/H5N2) segment 4 (HA)2732.30.000000e+001632/1707 (95%)
text_code_colored.pngEPI681283A/chicken/Zhejiang/727079/2014 (A/H5N2) segment 4 (HA)2732.30.000000e+001632/1707 (95%)
text_code_colored.pngEPI602477A/chicken/Shenzhen/715/2013 (A/H5N6) segment 4 (HA)2732.30.000000e+001632/1707 (95%)
text_code_colored.pngEPI599320A/chicken/Shenzhen/2464/2013 (A/H5N6) segment 4 (HA)2732.30.000000e+001632/1707 (95%)
text_code_colored.pngEPI599313A/chicken/Shenzhen/2396/2013 (A/H5N6) segment 4 (HA)2732.30.000000e+001632/1707 (95%)
text_code_colored.pngEPI599285A/chicken/Shenzhen/433/2013 (A/H5N6) segment 4 (HA)2732.30.000000e+001632/1707 (95%)
text_code_colored.pngEPI590806A/duck/Jiangxi/NCDZT1123/2014 (A/H5N6) segment 4 (HA)2732.30.000000e+001632/1707 (95%)
text_code_colored.pngEPI561495A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 4 (HA)2732.30.000000e+001633/1708 (95%)
text_code_colored.pngEPI530985A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA)2732.30.000000e+001631/1706 (95%)
text_code_colored.pngEPI645049A/swine/Guangdong/1/2014 (A/H5N6) segment 4 (HA)2730.50.000000e+001629/1703 (95%)
text_code_colored.pngEPI690808A/goose/Yangzhou/0420/2014 (A/H5N8) segment 4 (HA)2726.80.000000e+001633/1709 (95%)
text_code_colored.pngEPI682917A/duck/Taizhou/TZYG12/2015 (A/H5N6) segment 4 (HA)2726.80.000000e+001631/1707 (95%)
text_code_colored.pngEPI682915A/duck/Wenzhou/YHQL22/2014 (A/H5N6) segment 4 (HA)2726.80.000000e+001632/1708 (95%)
text_code_colored.pngEPI681287A/goose/Zhejiang/727110/2014 (A/H5N6) segment 4 (HA)2726.80.000000e+001631/1707 (95%)
text_code_colored.pngEPI681286A/goose/Zhejiang/727092/2014 (A/H5N6) segment 4 (HA)2726.80.000000e+001631/1707 (95%)
text_code_colored.pngEPI602491A/chicken/Shenzhen/2269/2013 (A/H5N6) segment 4 (HA)2726.80.000000e+001631/1707 (95%)
text_code_colored.pngEPI602103A/chicken/Shenzhen/2072/2013 (A/H0) segment 4 (HA)2726.80.000000e+001631/1707 (95%)
text_code_colored.pngEPI601941A/chicken/Dongguan/1100/2014 (A/H0) segment 4 (HA)2726.80.000000e+001632/1708 (95%)
text_code_colored.pngEPI507673A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA)2726.80.000000e+001631/1707 (95%)
text_code_colored.pngEPI645042A/swine/Guangdong/2/2014 (A/H5N6) segment 4 (HA)2724.90.000000e+001628/1703 (95%)
text_code_colored.pngEPI681285A/duck/Zhejiang/727158/2014 (A/H5N6) segment 4 (HA)2721.20.000000e+001630/1707 (95%)
text_code_colored.pngEPI602037A/duck/Ningbo/3262/2013 (A/H0) segment 4 (HA)2721.20.000000e+001631/1708 (95%)
text_code_colored.pngEPI583870A/duck/Shaoxing/5240/2013 (A/H0) segment 4 (HA)2721.20.000000e+001631/1708 (95%)
text_code_colored.pngEPI593896A/duck/Guangzhou/41227/2014 (A/H5N6) segment 4 (HA)2715.70.000000e+001627/1705 (95%)
text_code_colored.pngEPI593889A/Guangzhou/39715/2014 (A/H5N6) segment 4 (HA)2715.70.000000e+001629/1707 (95%)
text_code_colored.pngEPI530986A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA)2715.70.000000e+001630/1708 (95%)
text_code_colored.pngEPI530063A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA)2715.70.000000e+001629/1707 (95%)
text_code_colored.pngEPI553144A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA)2712.00.000000e+001519/1545 (98%)
text_code_colored.pngEPI682939A/turtledove/Wuhan/HKBJ07/2015 (A/H5N6) segment 4 (HA)2710.20.000000e+001631/1710 (95%)
text_code_colored.pngEPI682938A/turtledove/Wuhan/WHBJ26/2014 (A/H5N6) segment 4 (HA)2710.20.000000e+001631/1710 (95%)
text_code_colored.pngEPI682937A/turtledove/Wuhan/HKBJ43/2015 (A/H5N6) segment 4 (HA)2710.20.000000e+001631/1710 (95%)
text_code_colored.pngEPI682936A/turtledove/Wuhan/HKBJ27/2015 (A/H5N6) segment 4 (HA)2710.20.000000e+001631/1710 (95%)
text_code_colored.pngEPI682935A/turtledove/Wuhan/WHBJ28/2014 (A/H5N6) segment 4 (HA)2710.20.000000e+001631/1710 (95%)
text_code_colored.pngEPI681290A/goose/Zhejiang/925106/2014 (A/H5N6) segment 4 (HA)2710.20.000000e+001629/1708 (95%)
text_code_colored.pngEPI681280A/goose/Zhejiang/77166/2014 (A/H5N2) segment 4 (HA)2708.30.000000e+001627/1705 (95%)
text_code_colored.pngEPI687144A/peregrine_falcon/Hong_Kong/04955/2015 (A/H5N6) segment 4 (HA)2704.60.000000e+001627/1707 (95%)
text_code_colored.pngEPI682934A/turtledove/Wuhan/WHBJ12/2014 (A/H5N6) segment 4 (HA)2704.60.000000e+001630/1710 (95%)
text_code_colored.pngEPI682912A/duck/Wuhan/WHYF03/2015 (A/H5N6) segment 4 (HA)2704.60.000000e+001630/1710 (95%)
text_code_colored.pngEPI682911A/duck/Wuhan/WHYF02/2015 (A/H5N6) segment 4 (HA)2704.60.000000e+001630/1710 (95%)
text_code_colored.pngEPI681279A/duck/Zhejiang/727041/2014 (A/H5N2) segment 4 (HA)2704.60.000000e+001627/1707 (95%)
text_code_colored.pngEPI550768A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA)2704.60.000000e+001628/1708 (95%)
text_code_colored.pngEPI550763A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA)2704.60.000000e+001628/1708 (95%)
text_code_colored.pngEPI550759A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA)2704.60.000000e+001628/1708 (95%)
text_code_colored.pngEPI550757A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA)2704.60.000000e+001628/1708 (95%)
text_code_colored.pngEPI493825A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA)2704.60.000000e+001629/1709 (95%)
text_code_colored.pngEPI550752A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA)2699.10.000000e+001627/1708 (95%)
text_code_colored.pngEPI596610A/duck/Vietnam/LBM758/2014 (A/H5N6) segment 4 (HA)2695.40.000000e+001626/1708 (95%)
text_code_colored.pngEPI682916A/duck/Wuhan/JXYFB22/2015 (A/H5N6) segment 4 (HA)2693.50.000000e+001625/1707 (95%)
text_code_colored.pngEPI682914A/chicken/Wuhan/WHYJ02/2015 (A/H5N6) segment 4 (HA)2693.50.000000e+001628/1710 (95%)
text_code_colored.pngEPI682913A/chicken/Wuhan/WHYJ01/2015 (A/H5N6) segment 4 (HA)2693.50.000000e+001628/1710 (95%)
text_code_colored.pngEPI681298A/duck/Zhejiang/925169/2014 (A/H5N8) segment 4 (HA)2693.50.000000e+001626/1708 (95%)
text_code_colored.pngEPI676398A/environment/GZ/76/2014 (A/H5N2) segment 4 (HA)2693.50.000000e+001624/1706 (95%)
text_code_colored.pngEPI596598A/muscovy duck/Vietnam/LBM756/2014 (A/H5N6) segment 4 (HA)2693.50.000000e+001626/1708 (95%)
text_code_colored.pngEPI596592A/muscovy duck/Vietnam/LBM755/2014 (A/H5N6) segment 4 (HA)2693.50.000000e+001626/1708 (95%)
text_code_colored.pngEPI596586A/muscovy duck/Vietnam/LBM754/2014 (A/H5N6) segment 4 (HA)2693.50.000000e+001626/1708 (95%)
text_code_colored.pngEPI596580A/duck/Vietnam/LBM752/2014 (A/H5N6) segment 4 (HA)2693.50.000000e+001626/1708 (95%)
text_code_colored.pngEPI596574A/duck/Vietnam/LBM751/2014 (A/H5N6) segment 4 (HA)2693.50.000000e+001626/1708 (95%)
text_code_colored.pngEPI590116A/chicken/Tonghai/802/2014 (A/H5N1) segment 4 (HA)2693.50.000000e+001625/1707 (95%)
text_code_colored.pngEPI590115A/chicken/Tonghai/5/2014 (A/H5N1) segment 4 (HA)2693.50.000000e+001625/1707 (95%)
text_code_colored.pngEPI590114A/chicken/Tonghai/3/2014 (A/H5N1) segment 4 (HA)2693.50.000000e+001625/1707 (95%)
text_code_colored.pngEPI590109A/chicken/AnNing/1/2014 (A/H5N1) segment 4 (HA)2693.50.000000e+001625/1707 (95%)
text_code_colored.pngEPI585951A/chicken/TongHai/302/2014 (A/H5N1) segment 4 (HA)2693.50.000000e+001625/1707 (95%)
text_code_colored.pngEPI499478A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA)2693.50.000000e+001625/1707 (95%)
text_code_colored.pngEPI431448A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA)2689.80.000000e+001626/1709 (95%)
text_code_colored.pngEPI596622A/duck/Vietnam/LBM760/2014 (A/H5N6) segment 4 (HA)2688.00.000000e+001625/1708 (95%)
text_code_colored.pngEPI596616A/duck/Vietnam/LBM759/2014 (A/H5N6) segment 4 (HA)2688.00.000000e+001625/1708 (95%)
text_code_colored.pngEPI596604A/muscovy duck/Vietnam/LBM757/2014 (A/H5N6) segment 4 (HA)2688.00.000000e+001625/1708 (95%)
text_code_colored.pngEPI590898A/pigeon/Sichuan/NCXN29/2014 (A/H5N1) segment 4 (HA)2688.00.000000e+001625/1708 (95%)
text_code_colored.pngEPI590897A/duck/Sichuan/NCXN11/2014 (A/H5N1) segment 4 (HA)2688.00.000000e+001625/1708 (95%)
text_code_colored.pngEPI586257A/Common moorhen/Vietnam/WBT226/2014 (A/H5N6) segment 4 (HA)2688.00.000000e+001625/1708 (95%)
text_code_colored.pngEPI586256A/Little egret/Vietnam/WBT210/2014 (A/H5N6) segment 4 (HA)2688.00.000000e+001625/1708 (95%)
text_code_colored.pngEPI586255A/Black-crowned night heron/Vietnam/WBT198/2014 (A/H5N6) segment 4 (HA)2688.00.000000e+001625/1708 (95%)
text_code_colored.pngEPI586254A/Spotted dove/Vietnam/WBT191/2014 (A/H5N6) segment 4 (HA)2688.00.000000e+001625/1708 (95%)
text_code_colored.pngEPI681297A/duck/Zhejiang/925019/2014 (A/H5N8) segment 4 (HA)2682.50.000000e+001624/1708 (95%)
text_code_colored.pngEPI590111A/chicken/AnNing/6/2014 (A/H5N1) segment 4 (HA)2682.50.000000e+001624/1708 (95%)
text_code_colored.pngEPI586258A/Chinese pond heron/Vietnam/WBT231/2014 (A/H5N6) segment 4 (HA)2682.50.000000e+001624/1708 (95%)
text_code_colored.pngEPI493817A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA)2682.50.000000e+001626/1710 (95%)
text_code_colored.pngEPI676397A/environment/GZ/75/2014 (A/H5N6) segment 4 (HA)2676.90.000000e+001622/1707 (95%)
text_code_colored.pngEPI590110A/chicken/AnNing/4/2014 (A/H5N1) segment 4 (HA)2676.90.000000e+001622/1707 (95%)
text_code_colored.pngEPI643147A/Environment/Guangdong/GZ55/2013(H5N8) (A/H5N8) segment 4 (HA)2667.70.000000e+001617/1709 (94%)
text_code_colored.pngEPI590896A/duck/Sichuan/NCXN10/2014 (A/H5N1) segment 4 (HA)2665.80.000000e+001622/1709 (94%)
text_code_colored.pngEPI590113A/chicken/DaLi/502/2014 (A/H5N1) segment 4 (HA)2665.80.000000e+001619/1706 (94%)
text_code_colored.pngEPI590112A/chicken/DaLi/302/2014 (A/H5N1) segment 4 (HA)2665.80.000000e+001619/1706 (94%)
text_code_colored.pngEPI687311A/chicken/Yunnan/1/2014 (A/H5N1) segment 4 (HA)2660.30.000000e+001620/1708 (94%)
text_code_colored.pngEPI687152A/Oriental_magpie_robin/Hong_Kong/06154/2015 (A/H5N6) segment 4 (HA)2656.60.000000e+001619/1707 (94%)
text_code_colored.pngEPI687156A/great_egret/Hong_Kong/00032/2016 (A/H5N6) segment 4 (HA)2651.10.000000e+001618/1707 (94%)
text_code_colored.pngEPI641396A/chicken/Yunnan/25A/2015 (A/H5N6) segment 4 (HA)2651.10.000000e+001620/1709 (94%)
text_code_colored.pngEPI328878A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA)2649.20.000000e+001618/1708 (94%)
text_code_colored.pngEPI641398A/Yunnan/0127/2015 (A/H5N6) segment 4 (HA)2645.50.000000e+001618/1708 (94%)
text_code_colored.pngEPI590895A/environment/Sichuan/NCLL1/2014 (A/H5N6) segment 4 (HA)2621.50.000000e+001615/1710 (94%)
text_code_colored.pngEPI328870A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA)2621.50.000000e+001615/1710 (94%)
text_code_colored.pngEPI687154A/Oriental_magpie_robin/Hong_Kong/16759/2015 (A/H5N6) segment 4 (HA)2617.80.000000e+001614/1709 (94%)
text_code_colored.pngEPI602094A/chicken/Shenzhen/712/2013 (A/H0) segment 4 (HA)2616.00.000000e+001614/1710 (94%)
text_code_colored.pngEPI593753A/goose/Yangzhou/ZG62/2011 (A/H5N5) segment 4 (HA)2616.00.000000e+001614/1710 (94%)
text_code_colored.pngEPI590891A/duck/Sichuan/NCJPL7/2014 (A/H5N6) segment 4 (HA)2616.00.000000e+001614/1710 (94%)
text_code_colored.pngEPI328886A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA)2616.00.000000e+001614/1710 (94%)
text_code_colored.pngEPI641394A/chicken/Yunnan/22/2015 (A/H5N6) segment 4 (HA)2612.30.000000e+001615/1711 (94%)
text_code_colored.pngEPI602113A/environment/Jiangxi/10170/2014 (A/H5N6) segment 4 (HA)2610.40.000000e+001613/1710 (94%)
text_code_colored.pngEPI601997A/black chicken/Jiangxi/10139/2014 (A/H0) segment 4 (HA)2610.40.000000e+001613/1710 (94%)
text_code_colored.pngEPI599369A/environment/Jiangxi/10171/2014 (A/H5N6) segment 4 (HA)2610.40.000000e+001613/1710 (94%)
text_code_colored.pngEPI599360A/environment/Jiangxi/10164/2014 (A/H5N6) segment 4 (HA)2610.40.000000e+001613/1710 (94%)
text_code_colored.pngEPI599353A/duck/Jiangxi/10160/2014 (A/H5N6) segment 4 (HA)2610.40.000000e+001613/1710 (94%)
text_code_colored.pngEPI590889A/Anas_crecca/Hubei/Chenhu1623-5/2014 (A/H5N6) segment 4 (HA)2610.40.000000e+001613/1710 (94%)
text_code_colored.pngEPI585724A/cat/Sichuan/SC18/2014 (A/H5N6) segment 4 (HA)2610.40.000000e+001613/1710 (94%)
text_code_colored.pngEPI569711A/duck/Zhejiang/6D2/2013 (A/H5N6) segment 4 (HA)2610.40.000000e+001613/1710 (94%)
text_code_colored.pngEPI569710A/chicken/Zhejiang/6C2/2013 (A/H5N6) segment 4 (HA)2610.40.000000e+001613/1710 (94%)
text_code_colored.pngEPI533583A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA)2610.40.000000e+001613/1710 (94%)
text_code_colored.pngEPI493833A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA)2606.70.000000e+001614/1712 (94%)
text_code_colored.pngEPI442025A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA)2606.70.000000e+001615/1713 (94%)
text_code_colored.pngEPI681281A/goose/Zhejiang/77167/2014 (A/H5N2) segment 4 (HA)2604.90.000000e+001611/1709 (94%)
text_code_colored.pngEPI602107A/black chicken/Jiangxi/10129/2014 (A/H5N6) segment 4 (HA)2604.90.000000e+001612/1710 (94%)
text_code_colored.pngEPI601986A/black chicken/Jiangxi/10136/2014 (A/H0) segment 4 (HA)2604.90.000000e+001612/1710 (94%)
text_code_colored.pngEPI601977A/black chicken/Jiangxi/10131/2014 (A/H0) segment 4 (HA)2604.90.000000e+001612/1710 (94%)
text_code_colored.pngEPI599306A/chicken/Shenzhen/1845/2013 (A/H5N6) segment 4 (HA)2604.90.000000e+001612/1710 (94%)
text_code_colored.pngEPI590894A/duck/Sichuan/NCXJ24/2014 (A/H5N6) segment 4 (HA)2604.90.000000e+001612/1710 (94%)
text_code_colored.pngEPI590893A/duck/Sichuan/NCXJ16/2014 (A/H5N6) segment 4 (HA)2604.90.000000e+001612/1710 (94%)
text_code_colored.pngEPI590890A/chicken/Sichuan/NCJPL1/2014 (A/H5N6) segment 4 (HA)2604.90.000000e+001612/1710 (94%)
text_code_colored.pngEPI585731A/swan goose/Jilin/JL01/2014 (A/H5N6) segment 4 (HA)2604.90.000000e+001613/1711 (94%)
text_code_colored.pngEPI547402A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA)2604.90.000000e+001613/1711 (94%)
text_code_colored.pngEPI641392A/chicken/Yunnan/19/2015 (A/H5N6) segment 4 (HA)2601.20.000000e+001613/1711 (94%)
text_code_colored.pngEPI602056A/chicken/Jiangxi/10122/2014 (A/H0) segment 4 (HA)2601.20.000000e+001611/1710 (94%)
text_code_colored.pngEPI681282A/goose/Zhejiang/77168/2014 (A/H5N2) segment 4 (HA)2599.40.000000e+001610/1709 (94%)
text_code_colored.pngEPI681278A/duck/Zhejiang/77138/2014 (A/H5N2) segment 4 (HA)2599.40.000000e+001610/1709 (94%)
text_code_colored.pngEPI676399A/environment/GZ/77/2014 (A/H5N6) segment 4 (HA)2599.40.000000e+001612/1711 (94%)
text_code_colored.pngEPI590892A/duck/Sichuan/NCXJ15/2014 (A/H5N6) segment 4 (HA)2593.80.000000e+001610/1710 (94%)
text_code_colored.pngEPI589841A/duck/Nha Trang/75c131/2014 (A/H5N6) segment 4 (HA)2588.30.000000e+001610/1711 (94%)
text_code_colored.pngEPI589366A/muscovy duck/Quang Ninh/4c111/2013 (A/H5N6) segment 4 (HA)2588.30.000000e+001610/1711 (94%)
text_code_colored.pngEPI585379A/duck/Vietnam/1144/2014 (A/H5N6) segment 4 (HA)2588.30.000000e+001610/1711 (94%)
text_code_colored.pngEPI585378A/duck/Vietnam/1434/2014 (A/H5N6) segment 4 (HA)2588.30.000000e+001610/1711 (94%)
text_code_colored.pngEPI585376A/duck/Vietnam/1507/2014 (A/H5N6) segment 4 (HA)2588.30.000000e+001610/1711 (94%)
text_code_colored.pngEPI585374A/duck/Vietnam/1152/2014 (A/H5N6) segment 4 (HA)2588.30.000000e+001610/1711 (94%)
text_code_colored.pngEPI681293A/goose/Zhejiang/1120132/2014 (A/H5N6) segment 4 (HA)2582.70.000000e+001609/1711 (94%)
text_code_colored.pngEPI589373A/muscovy duck/Quang Ninh/5c112/2013 (A/H5N6) segment 4 (HA)2582.70.000000e+001609/1711 (94%)
text_code_colored.pngEPI585377A/duck/Vietnam/1511/2014 (A/H5N6) segment 4 (HA)2582.70.000000e+001609/1711 (94%)
text_code_colored.pngEPI585389A/duck/Vietnam/1151/2014 (A/H5N6) segment 4 (HA)2579.00.000000e+001603/1703 (94%)
text_code_colored.pngEPI676400A/environment/GZ/NIOSH-187/2014 (A/H5N6) segment 4 (HA)2577.20.000000e+001607/1710 (93%)
text_code_colored.pngEPI602181A/duck/Jiangxi/13484/2014 (A/H5N6) segment 4 (HA)2577.20.000000e+001608/1711 (93%)
text_code_colored.pngEPI602167A/duck/Jiangxi/13469/2014 (A/H5N6) segment 4 (HA)2577.20.000000e+001608/1711 (93%)
text_code_colored.pngEPI681292A/goose/Zhejiang/112080/2014 (A/H5N6) segment 4 (HA)2571.70.000000e+001608/1712 (93%)
text_code_colored.pngEPI681289A/goose/Zhejiang/925105/2014 (A/H5N6) segment 4 (HA)2571.70.000000e+001608/1712 (93%)
text_code_colored.pngEPI602174A/duck/Jiangxi/13475/2014 (A/H5N6) segment 4 (HA)2571.70.000000e+001607/1711 (93%)
text_code_colored.pngEPI681291A/goose/Zhejiang/925108/2014 (A/H5N6) segment 4 (HA)2560.60.000000e+001606/1712 (93%)
text_code_colored.pngEPI442001A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA)2560.60.000000e+001603/1709 (93%)
text_code_colored.pngEPI442009A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA)2551.30.000000e+001604/1712 (93%)
text_code_colored.pngEPI593754A/goose/Yangzhou/ZG60/2009 (A/H5N5) segment 4 (HA)2532.90.000000e+001598/1709 (93%)
text_code_colored.pngEPI597677A/duck/Hunan/316/2005 (A/H5N1) segment 4 (HA)2499.60.000000e+001592/1709 (93%)
text_code_colored.pngEPI127384A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA)2499.60.000000e+001592/1709 (93%)
text_code_colored.pngEPI227309A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA)2494.10.000000e+001590/1708 (93%)
text_code_colored.pngEPI127406A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA)2494.10.000000e+001591/1709 (93%)
text_code_colored.pngEPI439897A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA)2492.30.000000e+001591/1709 (93%)
text_code_colored.pngEPI399886A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA)2488.60.000000e+001591/1710 (93%)
text_code_colored.pngEPI279949A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA)2488.60.000000e+001590/1709 (93%)
text_code_colored.pngEPI276046A/goose/Hubei/65/2005 (A/H5N1) segment 4 (HA)2488.60.000000e+001590/1709 (93%)
text_code_colored.pngEPI224777A/Shanghai/1/2006 (A/H5N1) segment 4 (HA)2488.60.000000e+001590/1709 (93%)
text_code_colored.pngEPI181297A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA)2488.60.000000e+001590/1709 (93%)
text_code_colored.pngEPI337107A/Shanghai/1/2006 (A/H5N1) segment 4 (HA)2483.00.000000e+001589/1709 (92%)
text_code_colored.pngEPI280112A/Shanghai/1/2006 (A/H5N1) segment 4 (HA)2483.00.000000e+001589/1709 (92%)
text_code_colored.pngEPI275982A/duck/Hubei/49/2005 (A/H5N1) segment 4 (HA)2483.00.000000e+001590/1710 (92%)
text_code_colored.pngEPI107769A/duck/Guangxi/288/2006 (A/H5N1) segment 4 (HA)2483.00.000000e+001583/1700 (93%)
text_code_colored.pngEPI337076A/Sichuan/2/2006 (A/H5N1) segment 4 (HA)2477.50.000000e+001588/1709 (92%)
text_code_colored.pngEPI280104A/Guangdong/1/2006 (A/H5N1) segment 4 (HA)2477.50.000000e+001588/1709 (92%)
text_code_colored.pngEPI275966A/duck/Anhui/56/2005 (A/H5N1) segment 4 (HA)2477.50.000000e+001588/1709 (92%)
text_code_colored.pngEPI275774A/chicken/Hunan/21/2005 (A/H5N1) segment 4 (HA)2477.50.000000e+001589/1710 (92%)
text_code_colored.pngEPI181301A/Guangdong/1/2006 (A/H5N1) segment 4 (HA)2477.50.000000e+001588/1709 (92%)
text_code_colored.pngEPI181298A/Sichuan/1/2006 (A/H5N1) segment 4 (HA)2477.50.000000e+001588/1709 (92%)
text_code_colored.pngEPI164232A/Sichuan/2/2006 (A/H5N1) segment 4 (HA)2477.50.000000e+001588/1709 (92%)
text_code_colored.pngEPI164224A/Sichuan/1/2006 (A/H5N1) segment 4 (HA)2477.50.000000e+001588/1709 (92%)
text_code_colored.pngEPI107913A/goose/Yunnan/1144/2006 (A/H5N1) segment 4 (HA)2477.50.000000e+001582/1700 (93%)
text_code_colored.pngEPI107829A/goose/Guiyang/1304/2006 (A/H5N1) segment 4 (HA)2477.50.000000e+001582/1700 (93%)
text_code_colored.pngEPI107771A/chicken/Guangxi/463/2006 (A/H5N1) segment 4 (HA)2477.50.000000e+001582/1700 (93%)
text_code_colored.pngEPI406406A/Muscovy duck/Ca Mau/22/2007 (A/H5N1) segment 4 (HA)2471.90.000000e+001588/1710 (92%)
text_code_colored.pngEPI275386A/Anhui/2/2005 (A/H5N1) segment 4 (HA)2471.90.000000e+001588/1710 (92%)
text_code_colored.pngEPI181299A/Fujian/1/2005 (A/H5N1) segment 4 (HA)2471.90.000000e+001588/1710 (92%)
text_code_colored.pngEPI170615A/chicken/Vietnam/216/2005 (A/H5N1) segment 4 (HA)2471.90.000000e+001587/1709 (92%)
text_code_colored.pngEPI170607A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 4 (HA)2471.90.000000e+001587/1709 (92%)
text_code_colored.pngEPI170599A/duck/Vietnam/218/2005 (A/H5N1) segment 4 (HA)2471.90.000000e+001587/1709 (92%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI690786A/goose/Taiwan/TNO20/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI690754A/goose/Taiwan/TNO16/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI690746A/goose/Taiwan/TNO15/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI690698A/goose/Taiwan/TNO9/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI690674A/goose/Taiwan/TNO6/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI690658A/goose/Taiwan/TNO4/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI690642A/goose/Taiwan/TNO2/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI690602A/goose/Taiwan/TNC11/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI690554A/goose/Taiwan/TNC5/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI690546A/goose/Taiwan/TNC4/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI588954A/goose/Taiwan/a015/2015 (A/H5N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI690738A/goose/Taiwan/TNO14/2015 (A/H5N8) segment 6 (NA)2604.90.000000e+001412/1413 (99%)
text_code_colored.pngEPI690706A/goose/Taiwan/TNO10/2015 (A/H5N8) segment 6 (NA)2604.90.000000e+001412/1413 (99%)
text_code_colored.pngEPI690682A/goose/Taiwan/TNO7/2015 (A/H5N8) segment 6 (NA)2604.90.000000e+001412/1413 (99%)
text_code_colored.pngEPI690650A/goose/Taiwan/TNO3/2015 (A/H5N8) segment 6 (NA)2604.90.000000e+001412/1413 (99%)
text_code_colored.pngEPI690618A/goose/Taiwan/TNC13/2015 (A/H5N8) segment 6 (NA)2604.90.000000e+001412/1413 (99%)
text_code_colored.pngEPI690586A/goose/Taiwan/TNC9/2015 (A/H5N8) segment 6 (NA)2604.90.000000e+001412/1413 (99%)
text_code_colored.pngEPI690538A/goose/Taiwan/TNC3/2015 (A/H5N8) segment 6 (NA)2604.90.000000e+001412/1413 (99%)
text_code_colored.pngEPI588978A/duck/Taiwan/a068/2015 (A/H5N8) segment 6 (NA)2604.90.000000e+001412/1413 (99%)
text_code_colored.pngEPI690778A/goose/Taiwan/TNO19/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690762A/goose/Taiwan/TNO17/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690730A/goose/Taiwan/TNO13/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690722A/goose/Taiwan/TNO12/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690714A/goose/Taiwan/TNO11/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690690A/goose/Taiwan/TNO8/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690634A/goose/Taiwan/TNO1/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690610A/goose/Taiwan/TNC12/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690594A/goose/Taiwan/TNC10/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690578A/goose/Taiwan/TNC8/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690570A/goose/Taiwan/TNC7/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690562A/goose/Taiwan/TNC6/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690530A/goose/Taiwan/TNC2/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690522A/goose/Taiwan/TNC1/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)
text_code_colored.pngEPI690770A/goose/Taiwan/TNO18/2015 (A/H5N8) segment 6 (NA)2593.80.000000e+001410/1413 (99%)
text_code_colored.pngEPI690626A/goose/Taiwan/TNC14/2015 (A/H5N8) segment 6 (NA)2593.80.000000e+001410/1413 (99%)
text_code_colored.pngEPI573640A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 6 (NA)2560.60.000000e+001402/1410 (99%)
text_code_colored.pngEPI587523A/American wigeon/BC/050-31/2015 (A/H5N8) segment 6 (NA)2544.00.000000e+001401/1413 (99%)
text_code_colored.pngEPI569378A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 6 (NA)2538.40.000000e+001400/1413 (99%)
text_code_colored.pngEPI569374A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 6 (NA)2538.40.000000e+001400/1413 (99%)
text_code_colored.pngEPI553210A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 6 (NA)2538.40.000000e+001398/1410 (99%)
text_code_colored.pngEPI690442A/peregrine falcon/Washington/196426/2014 (A/H5N8) segment 6 (NA)2532.90.000000e+001399/1413 (99%)
text_code_colored.pngEPI690422A/American wigeon/Washington/195205/2014 (A/H5N8) segment 6 (NA)2532.90.000000e+001399/1413 (99%)
text_code_colored.pngEPI690324A/mallard/Idaho/AH0005955/2014 (A/H5N8) segment 6 (NA)2532.90.000000e+001399/1413 (99%)
text_code_colored.pngEPI690317A/mallard/Idaho/AH0005954/2014 (A/H5N8) segment 6 (NA)2532.90.000000e+001399/1413 (99%)
text_code_colored.pngEPI690133A/American wigeon/Utah/AH0007824/2015 (A/H5N8) segment 6 (NA)2532.90.000000e+001399/1413 (99%)
text_code_colored.pngEPI690415A/American wigeon/Washington/195198/2014 (A/H5N8) segment 6 (NA)2527.30.000000e+001399/1414 (98%)
text_code_colored.pngEPI690408A/mallard/Oregon/195536/2014 (A/H5N8) segment 6 (NA)2527.30.000000e+001398/1413 (98%)
text_code_colored.pngEPI690380A/Northern pintail/Washington/196271/2014 (A/H5N8) segment 6 (NA)2527.30.000000e+001398/1413 (98%)
text_code_colored.pngEPI690280A/mallard/Nevada/AH0006855/2015 (A/H5N8) segment 6 (NA)2527.30.000000e+001398/1413 (98%)
text_code_colored.pngEPI690196A/mallard/Idaho/AH0008597/2015 (A/H5N8) segment 6 (NA)2527.30.000000e+001398/1413 (98%)
text_code_colored.pngEPI569392A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 6 (NA)2527.30.000000e+001398/1413 (98%)
text_code_colored.pngEPI690358A/American wigeon/Washington/195968/2014 (A/H5N8) segment 6 (NA)2521.80.000000e+001397/1413 (98%)
text_code_colored.pngEPI690338A/bald eagle/Idaho/15-002892-2/2015 (A/H5N8) segment 6 (NA)2516.30.000000e+001396/1413 (98%)
text_code_colored.pngEPI690288A/chicken/California/15-004912/2015 (A/H5N8) segment 6 (NA)2516.30.000000e+001396/1413 (98%)
text_code_colored.pngEPI585086A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 6 (NA)2516.30.000000e+001396/1413 (98%)
text_code_colored.pngEPI561669A/mallard/Korea/H297/2014 (A/H5N8) segment 6 (NA)2516.30.000000e+001396/1413 (98%)
text_code_colored.pngEPI561544A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 6 (NA)2516.30.000000e+001396/1413 (98%)
text_code_colored.pngEPI690271A/American wigeon/Oregon/AH0012525/2015 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI690264A/Canada goose/Oregon/AH0012452/2015 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585633A/baikal teal/Korea/2417/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585632A/baikal teal/Korea/2416/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585630A/baikal teal/Korea/2406/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585629A/baikal teal/Korea/2403/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585628A/baikal teal/Korea/2402/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585626A/baikal teal/Korea/1458/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585624A/baikal teal/Korea/1456/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585623A/baikal teal/Korea/1454/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585620A/baikal teal/Korea/1448/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585619A/baikal teal/Korea/1447/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585617A/baikal teal/Korea/1445/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585616A/baikal teal/Korea/1441/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561676A/bean goose/Korea/H328/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561662A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561655A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561648A/breeder duck/Korea/H249/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561635A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561628A/mallard/Korea/H207/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561621A/breeder duck/Korea/H200/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561614A/breeder duck/Korea/H158/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561579A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561510A/bean goose/Korea/H53/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561362A/broiler duck/Korea/H49/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561355A/broiler duck/Korea/H48/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561350A/broiler duck/Korea/H47/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561343A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561209A/broiler duck/Korea/H31/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI561198A/broiler duck/Korea/H29/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI509714A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI509706A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 6 (NA)2510.70.000000e+001395/1413 (98%)
text_code_colored.pngEPI585627A/baikal teal/Korea/2399/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI585625A/baikal teal/Korea/1457/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI585622A/baikal teal/Korea/1452/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561707A/bean goose/Korea/H40/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561699A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561683A/tundra swan/Korea/H411/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561607A/broiler duck/Korea/H145/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561600A/broiler duck/Korea/H133/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001395/1414 (98%)
text_code_colored.pngEPI561593A/breeder duck/Korea/H128/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561572A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561565A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561558A/Coot/Korea/H81/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561551A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561531A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561524A/broiler duck/Korea/H65/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI561517A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI553345A/chicken/Miyazaki/7/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI595143A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595135A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595130A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595121A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595113A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595104A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595096A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595084A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI595068A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585631A/baikal teal/Korea/2414/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585621A/baikal teal/Korea/1449/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585618A/baikal teal/Korea/1446/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI585615A/baikal teal/Korea/1437/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561692A/common teal/Korea/H455-30/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI561189A/waterfowl/Korea/S005/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI542632A/mallard/Korea/W452/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI517163A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)
text_code_colored.pngEPI573655A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI573648A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI552748A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI544759A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)
text_code_colored.pngEPI543012A/duck/Beijing/CT01/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001389/1410 (98%)
text_code_colored.pngEPI573682A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 6 (NA)2483.00.000000e+001390/1413 (98%)
text_code_colored.pngEPI573674A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 6 (NA)2483.00.000000e+001390/1413 (98%)
text_code_colored.pngEPI558000A/duck/England/36226/14 (A/H5N8) segment 6 (NA)2483.00.000000e+001390/1413 (98%)
text_code_colored.pngEPI543004A/duck/Beijing/FS01/2014 (A/H5N8) segment 6 (NA)2483.00.000000e+001388/1410 (98%)
text_code_colored.pngEPI595060A/common teal/Korea/KU-12/2015 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI573666A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI573167A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI558007A/duck/England/36038/14 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI553364A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI553350A/wigeon/Sakha/1/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI548495A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI548487A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI547683A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)
text_code_colored.pngEPI595076A/mallard/Korea/N15-99/2015 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI576393A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI576382A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI573181A/duck/Netherlands/14015898/2014 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI573173A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI548626A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)
text_code_colored.pngEPI553152A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001388/1414 (98%)
text_code_colored.pngEPI547675A/duck/England/36254/14 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)
text_code_colored.pngEPI555122A/mallard/Germany-ST/R23/2015 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)
text_code_colored.pngEPI554606A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 6 (NA)2460.90.000000e+001387/1414 (98%)
text_code_colored.pngEPI555068A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 6 (NA)2446.10.000000e+001382/1412 (97%)
text_code_colored.pngEPI573189A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 6 (NA)2444.20.000000e+001383/1413 (97%)
text_code_colored.pngEPI551150A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 6 (NA)2431.30.000000e+001362/1385 (98%)
text_code_colored.pngEPI596303A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 6 (NA)2423.90.000000e+001358/1381 (98%)
text_code_colored.pngEPI552778A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 6 (NA)2423.90.000000e+001358/1381 (98%)
text_code_colored.pngEPI596297A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 6 (NA)2422.10.000000e+001357/1380 (98%)
text_code_colored.pngEPI552770A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 6 (NA)2422.10.000000e+001357/1380 (98%)
text_code_colored.pngEPI596291A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 6 (NA)2416.50.000000e+001354/1377 (98%)
text_code_colored.pngEPI552762A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 6 (NA)2416.50.000000e+001354/1377 (98%)
text_code_colored.pngEPI551144A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 6 (NA)2416.50.000000e+001354/1377 (98%)
text_code_colored.pngEPI590681A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 6 (NA)2409.20.000000e+001352/1376 (98%)
text_code_colored.pngEPI585113A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 6 (NA)2409.20.000000e+001352/1376 (98%)
text_code_colored.pngEPI542627A/duck/Beijing/FS01/2013 (A/H5N8) segment 6 (NA)2405.50.000000e+001356/1385 (97%)
text_code_colored.pngEPI583873A/duck/Shaoxing/5240/2013 (A/H0) segment 6 (NA)2361.10.000000e+001369/1414 (96%)
text_code_colored.pngEPI530990A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 6 (NA)2361.10.000000e+001369/1414 (96%)
text_code_colored.pngEPI591884A/duck/Jiangxi/23970/2013 (A/H0) segment 6 (NA)2355.60.000000e+001368/1414 (96%)
text_code_colored.pngEPI530989A/duck/Zhejiang/W24/2013 (A/H5N8) segment 6 (NA)2355.60.000000e+001368/1414 (96%)
text_code_colored.pngEPI690794A/goose/Jiangsu/QD5/2014 (A/H5N8) segment 6 (NA)2350.10.000000e+001367/1414 (96%)
text_code_colored.pngEPI561493A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 6 (NA)2350.10.000000e+001367/1414 (96%)
text_code_colored.pngEPI544894A/duck/Shandong/Q1/2013 (A/H5N8) segment 6 (NA)2350.10.000000e+001367/1414 (96%)
text_code_colored.pngEPI509700A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 6 (NA)2350.10.000000e+001367/1414 (96%)
text_code_colored.pngEPI507675A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 6 (NA)2350.10.000000e+001367/1414 (96%)
text_code_colored.pngEPI690802A/goose/Shandong/WFSG1/2014 (A/H5N8) segment 6 (NA)2344.50.000000e+001366/1414 (96%)
text_code_colored.pngEPI690810A/goose/Yangzhou/0420/2014 (A/H5N8) segment 6 (NA)2339.00.000000e+001366/1415 (96%)
text_code_colored.pngEPI442019A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 6 (NA)2331.60.000000e+001351/1395 (96%)
text_code_colored.pngEPI681357A/goose/Zhejiang/925037/2014 (A/H5N8) segment 6 (NA)2327.90.000000e+001363/1414 (96%)
text_code_colored.pngEPI681355A/duck/Zhejiang/925019/2014 (A/H5N8) segment 6 (NA)2327.90.000000e+001363/1414 (96%)
text_code_colored.pngEPI602039A/duck/Ningbo/3262/2013 (A/H0) segment 6 (NA)2326.10.000000e+001344/1386 (96%)
text_code_colored.pngEPI681356A/duck/Zhejiang/925169/2014 (A/H5N8) segment 6 (NA)2322.40.000000e+001363/1415 (96%)
text_code_colored.pngEPI681358A/goose/Zhejiang/925104/2014 (A/H5N8) segment 6 (NA)2316.80.000000e+001361/1414 (96%)
text_code_colored.pngEPI672797A/duck/Guangdong/s14044/2014 (A/H5N8) segment 6 (NA)2278.00.000000e+001355/1415 (95%)
text_code_colored.pngEPI672789A/goose/Guangdong/s13124/2013 (A/H5N8) segment 6 (NA)2272.50.000000e+001354/1415 (95%)
text_code_colored.pngEPI485330A/common shelduck/Mongolia/2185/2011 (A/H3N8) segment 6 (NA)2089.70.000000e+001321/1415 (93%)
text_code_colored.pngEPI132266A/duck/Eastern China/90/2004 (A/H3N8) segment 6 (NA)2078.60.000000e+001319/1415 (93%)
text_code_colored.pngEPI132262A/duck/Eastern China/19/2004 (A/H3N8) segment 6 (NA)2067.50.000000e+001317/1415 (93%)
text_code_colored.pngEPI326921A/environment/Korea/SH12-6/2008 (A/H3N8) segment 6 (NA)2056.40.000000e+001315/1415 (92%)
text_code_colored.pngEPI416940A/duck/Vietnam/OIE-2577/2011 (A/H3N8) segment 6 (NA)2023.20.000000e+001309/1415 (92%)
text_code_colored.pngEPI438257A/duck/Vietnam/G18-1/2011 (A/H3N8) segment 6 (NA)2006.60.000000e+001306/1415 (92%)
text_code_colored.pngEPI387415A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 6 (NA)1993.70.000000e+001272/1367 (93%)
text_code_colored.pngEPI387510A/ruddy shelduck/Mongolia/2-79/2007 (A/H3N8) segment 6 (NA)1971.50.000000e+001269/1368 (92%)
text_code_colored.pngEPI363489A/duck/Guangxi/2736/2006 (A/H6N8) segment 6 (NA)1967.80.000000e+001299/1415 (91%)
text_code_colored.pngEPI387494A/pintail/Mongolia/2-65/2007 (A/H3N8) segment 6 (NA)1966.00.000000e+001268/1368 (92%)
text_code_colored.pngEPI326920A/environment/Korea/SH12-8/2008 (A/H3N8) segment 6 (NA)1964.10.000000e+001265/1365 (92%)
text_code_colored.pngEPI485320A/ruddy shelduck/Mongolia/1787/2011 (A/H3N8) segment 6 (NA)1905.00.000000e+001278/1398 (91%)
text_code_colored.pngEPI485328A/common shelduck/Mongolia/2076/2011 (A/H3N8) segment 6 (NA)1807.10.000000e+001252/1386 (90%)
text_code_colored.pngEPI407886A/duck/Ukraine/1963 (A/H3N8) segment 6 (NA)1696.30.000000e+001256/1421 (88%)
text_code_colored.pngEPI128912A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA)1696.30.000000e+001255/1420 (88%)
text_code_colored.pngEPI42182A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA)1696.30.000000e+001256/1421 (88%)
text_code_colored.pngEPI3107A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA)1690.80.000000e+001255/1421 (88%)
text_code_colored.pngEPI618125A/mallard/Sweden/2823/2003 (A/H10N8) segment 6 (NA)1689.00.000000e+001252/1418 (88%)
text_code_colored.pngEPI132460A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA)1685.30.000000e+001254/1421 (88%)
text_code_colored.pngEPI251642A/mallard/Netherlands/10/1999 (A/H1N8) segment 6 (NA)1652.00.000000e+001200/1351 (88%)
text_code_colored.pngEPI618048A/common Teal/Republic of Georgia/1/2011 (A/H3N8) segment 6 (NA)1635.40.000000e+001246/1422 (87%)
text_code_colored.pngEPI2999A/duck/Hong Kong/438/1977 (A/H4N8) segment 6 (NA)1629.90.000000e+001246/1423 (87%)
text_code_colored.pngEPI128904A/duck/Burjatia/652/1988 (A/H3N8) segment 6 (NA)1618.80.000000e+001247/1426 (87%)
text_code_colored.pngEPI251715A/mallard/Sweden/45/2002 (A/H11N8) segment 6 (NA)1615.10.000000e+001240/1419 (87%)
text_code_colored.pngEPI182043A/common eider/Netherlands/1/2006 (A/H3N8) segment 6 (NA)1613.20.000000e+001242/1422 (87%)
text_code_colored.pngEPI336006A/teal/Chany/444/2009 (A/H8N8) segment 6 (NA)1609.60.000000e+001239/1419 (87%)
text_code_colored.pngEPI316502A/duck/Hubei/126/1985 (A/H7N8) segment 6 (NA)1607.70.000000e+001244/1425 (87%)
text_code_colored.pngEPI314410A/mallard/Czech Republic/14516/2007 (A/H3N8) segment 6 (NA)1607.70.000000e+001238/1419 (87%)
text_code_colored.pngEPI182051A/turnstone/Netherlands/1/2007 (A/H3N8) segment 6 (NA)1607.70.000000e+001241/1422 (87%)
text_code_colored.pngEPI310343A/duck/Zambia/04/2008 (A/H3N8) segment 6 (NA)1604.00.000000e+001237/1418 (87%)
text_code_colored.pngEPI618086A/mallard/Sweden/233/2002 (A/H10N8) segment 6 (NA)1602.20.000000e+001243/1425 (87%)
text_code_colored.pngEPI339172A/mallard/Germany-BE/R663/08 (A/H3N8) segment 6 (NA)1602.20.000000e+001238/1420 (87%)
text_code_colored.pngEPI268303A/duck/Hunan/3748/2004 (A/H6N8) segment 6 (NA)1602.20.000000e+001239/1421 (87%)
text_code_colored.pngEPI2277A/Duck/Hokkaido/8/80 (A/H3N8) segment 6 (NA)1602.20.000000e+001240/1422 (87%)
text_code_colored.pngEPI574227A/mule duck/Bulgaria/365/2010 (A/H6N8) segment 6 (NA)1600.30.000000e+001237/1419 (87%)
text_code_colored.pngEPI397605A/duck/Germany-NW/R2185/2006 (A/H6N8) segment 6 (NA)1598.50.000000e+001239/1421 (87%)
text_code_colored.pngEPI617140A/mallard/Sweden/1636/2002 (A/H3N8) segment 6 (NA)1596.60.000000e+001239/1422 (87%)
text_code_colored.pngEPI398948A/mallard/Norway/10_779/2009 (A/H3N8) segment 6 (NA)1596.60.000000e+001239/1422 (87%)
text_code_colored.pngEPI398924A/common gull/Norway/10_1602/2009 (A/H6N8) segment 6 (NA)1596.60.000000e+001238/1421 (87%)
text_code_colored.pngEPI372503A/mallard/Ukraine/05842-NAMRU3/2006 (A/H3N8) segment 6 (NA)1596.60.000000e+001237/1420 (87%)
text_code_colored.pngEPI339175A/mallard/Germany-BY/R1353/2010 (A/H6N8) segment 6 (NA)1596.60.000000e+001236/1419 (87%)
text_code_colored.pngEPI339174A/goose/Germany/R1767/2007 (A/H6N8) segment 6 (NA)1596.60.000000e+001235/1417 (87%)
text_code_colored.pngEPI316762A/mallard/Czech Republic/13577-24K/2010 (A/H3N8) segment 6 (NA)1596.60.000000e+001236/1419 (87%)
text_code_colored.pngEPI235185A/Mallard/65112/03 (A/H3N8) segment 6 (NA)1596.60.000000e+001239/1422 (87%)
text_code_colored.pngEPI182115A/mallard/Netherlands/33/2006 (A/H7N8) segment 6 (NA)1596.60.000000e+001239/1422 (87%)
text_code_colored.pngEPI128908A/Duck/Hokkaido/8/80 (A/H3N8) segment 6 (NA)1596.60.000000e+001240/1423 (87%)
text_code_colored.pngEPI14499A/duck/Spain/543/2006 (A/H6N8) segment 6 (NA)1596.60.000000e+001238/1421 (87%)
text_code_colored.pngEPI169324A/Anas platyrhynchos/Belgium/12827/2007 (A/H3N8) segment 6 (NA)1594.80.000000e+001237/1420 (87%)
text_code_colored.pngEPI408014A/duck/Chabarovsk/1610/1972 (A/H3N8) segment 6 (NA)1591.10.000000e+001237/1421 (87%)
text_code_colored.pngEPI296491A/common eider/Netherlands2/2006 (A/H4N8) segment 6 (NA)1591.10.000000e+001237/1421 (87%)
text_code_colored.pngEPI268302A/mallard/Jiangxi/6285/2004 (A/H6N8) segment 6 (NA)1591.10.000000e+001237/1421 (87%)
text_code_colored.pngEPI42316A/duck/Chabarovsk/1610/1972 (A/H3N8) segment 6 (NA)1591.10.000000e+001237/1421 (87%)
text_code_colored.pngEPI268301A/mallard/Jiangxi/4408/2005 (A/H6N8) segment 6 (NA)1589.20.000000e+001236/1420 (87%)
text_code_colored.pngEPI182083A/black-headed gull/Netherlands/1/2005 (A/H6N8) segment 6 (NA)1589.20.000000e+001236/1420 (87%)
text_code_colored.pngEPI182075A/common teal/Netherlands/2/2005 (A/H6N8) segment 6 (NA)1589.20.000000e+001236/1420 (87%)
text_code_colored.pngEPI356301A/Greater white-fronted goose/Germany-NW/R02/2009 (A/H6N8) segment 6 (NA)1583.70.000000e+001234/1419 (86%)
text_code_colored.pngEPI302179A/Greater White-Fronted Goose/Germany-NW/R02/2009 (A/H6N8) segment 6 (NA)1583.70.000000e+001234/1419 (86%)
text_code_colored.pngEPI617981A/mallard/Republic of Georgia/3/2011 (A/H3N8) segment 6 (NA)1580.00.000000e+001235/1421 (86%)
text_code_colored.pngEPI296538A/mallard/Netherlands/20/2005 (A/H12N8) segment 6 (NA)1580.00.000000e+001236/1422 (86%)
text_code_colored.pngEPI222081A/gadwall/Altai/1328/2007 (A/H3N8) segment 6 (NA)1580.00.000000e+001234/1420 (86%)
text_code_colored.pngEPI222073A/gadwall/Altai/1326/2007 (A/H3N8) segment 6 (NA)1580.00.000000e+001234/1420 (86%)
text_code_colored.pngEPI222065A/gadwall/Altai/1325/2007 (A/H3N8) segment 6 (NA)1580.00.000000e+001234/1420 (86%)
text_code_colored.pngEPI181955A/mallard/Netherlands/3/2005 (A/H3N8) segment 6 (NA)1580.00.000000e+001233/1419 (86%)
text_code_colored.pngEPI14495A/duck/Spain/539/2006 (A/H6N8) segment 6 (NA)1580.00.000000e+001235/1421 (86%)
text_code_colored.pngEPI2443A/duck/Hokkaido/10/1985 (A/H3N8) segment 6 (NA)1580.00.000000e+001237/1423 (86%)
text_code_colored.pngEPI367575A/mallard/Czech Republic/14333-1K/2011 (A/H3N8) segment 6 (NA)1578.20.000000e+001234/1420 (86%)
text_code_colored.pngEPI221959A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 6 (NA)1578.20.000000e+001237/1423 (86%)
text_code_colored.pngEPI190374A/mallard/Netherlands/17/2007 (A/H11N8) segment 6 (NA)1578.20.000000e+001233/1419 (86%)
text_code_colored.pngEPI13715A/duck/Norway/1/03 (A/H3N8) segment 6 (NA)1578.20.000000e+001233/1420 (86%)
text_code_colored.pngEPI600840A/duck/Jiangxi/2039/2005 (A/H10N8) segment 6 (NA)1574.50.000000e+001236/1423 (86%)
text_code_colored.pngEPI234646A/duck/Beijing/40/04 (A/H3N8) segment 6 (NA)1574.50.000000e+001236/1423 (86%)
text_code_colored.pngEPI222057A/gadwall/Altai/1324/2007 (A/H3N8) segment 6 (NA)1574.50.000000e+001233/1420 (86%)
text_code_colored.pngEPI184026A/mallard/Hungary/19616/2007 (A/H3N8) segment 6 (NA)1574.50.000000e+001235/1422 (86%)
text_code_colored.pngEPI600847A/migratory duck/Jiangxi/593/2005 (A/H10N8) segment 6 (NA)1568.90.000000e+001235/1423 (86%)
text_code_colored.pngEPI128906A/duck/Chabarovsk/1610/1972 (A/H3N8) segment 6 (NA)1568.90.000000e+001233/1421 (86%)
text_code_colored.pngEPI105959A/Bewick's swan/Netherlands/2/2005 (A/H6N8) segment 6 (NA)1568.90.000000e+001234/1422 (86%)
text_code_colored.pngEPI251736A/mallard/Sweden/50/2002 (A/H3N8) segment 6 (NA)1567.10.000000e+001210/1387 (87%)
text_code_colored.pngEPI221967A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 6 (NA)1567.10.000000e+001235/1423 (86%)
text_code_colored.pngEPI221951A/water/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 6 (NA)1567.10.000000e+001235/1423 (86%)
text_code_colored.pngEPI574271A/mule duck/Bulgaria/328/2011 (A/H5N8) segment 6 (NA)1563.40.000000e+001230/1419 (86%)
text_code_colored.pngEPI515116A/muscovy duck/Vietnam/LBM529/2013 (A/H3N8) segment 6 (NA)1563.40.000000e+001236/1425 (86%)
text_code_colored.pngEPI345774A/duck/Eastern China/50/2002 (A/H6N8) segment 6 (NA)1563.40.000000e+001233/1422 (86%)
text_code_colored.pngEPI232400A/duck/Beijing/61/05 (A/H3N8) segment 6 (NA)1563.40.000000e+001234/1423 (86%)
text_code_colored.pngEPI132442A/duck/Eastern China/119/2005 (A/H3N8) segment 6 (NA)1563.40.000000e+001235/1424 (86%)
text_code_colored.pngEPI132438A/duck/Eastern China/163/2002 (A/H6N8) segment 6 (NA)1563.40.000000e+001232/1421 (86%)
text_code_colored.pngEPI251795A/mallard/Sweden/7/2003 (A/H10N8) segment 6 (NA)1561.50.000000e+001162/1318 (88%)
text_code_colored.pngEPI185345A/mute swan/Germany/R2927/2007 (A/H6N8) segment 6 (NA)1561.50.000000e+001213/1393 (87%)
text_code_colored.pngEPI272796A/mallard/PT/29497-11/2006 (A/H3N8) segment 6 (NA)1557.80.000000e+001231/1421 (86%)
text_code_colored.pngEPI132440A/duck/Eastern China/18/2005 (A/H3N8) segment 6 (NA)1557.80.000000e+001234/1424 (86%)
text_code_colored.pngEPI224540A/Anas plathyrhynchos/Spain/0454/2006 (A/H3N8) segment 6 (NA)1556.00.000000e+001230/1420 (86%)
text_code_colored.pngEPI221975A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 6 (NA)1556.00.000000e+001233/1423 (86%)
text_code_colored.pngEPI185337A/mallard/Germany/R529/2008 (A/H3N8) segment 6 (NA)1556.00.000000e+001212/1393 (87%)
text_code_colored.pngEPI534864A/duck/Zhejiang/D1-6/2013 (A/H3N8) segment 6 (NA)1552.30.000000e+001232/1423 (86%)
text_code_colored.pngEPI476105A/greylag goose/Iceland/0976/2011 (A/H6N8) segment 6 (NA)1552.30.000000e+001231/1422 (86%)
text_code_colored.pngEPI476068A/greylag goose/Iceland/0926/2011 (A/H6N8) segment 6 (NA)1552.30.000000e+001230/1421 (86%)
text_code_colored.pngEPI476052A/greylag goose/Iceland/0921/2011 (A/H6N8) segment 6 (NA)1552.30.000000e+001230/1421 (86%)
text_code_colored.pngEPI470301A/wild duck/Jiangxi/9157/2005 (A/H7N8) segment 6 (NA)1552.30.000000e+001233/1424 (86%)
text_code_colored.pngEPI236671A/duck/Siberia/100/2001 (A/H3N8) segment 6 (NA)1552.30.000000e+001232/1423 (86%)
text_code_colored.pngEPI174847A/duck/Denmark/75-65472-P34/2003 (A/H3N8) segment 6 (NA)1552.30.000000e+001230/1421 (86%)
text_code_colored.pngEPI106660A/wild bird feces/Korea/ES1-9/03 (A/H10N8) segment 6 (NA)1552.30.000000e+001222/1407 (86%)
text_code_colored.pngEPI574270A/mule duck/Bulgaria/181/2010 (A/H0) segment 6 (NA)1550.50.000000e+001226/1417 (86%)
text_code_colored.pngEPI254539A/Teal/Norway/10_1575/2007 (A/H3N8) segment 6 (NA)1550.50.000000e+001213/1396 (86%)
text_code_colored.pngEPI106656A/wild bird feces/Korea/ES1-17/03 (A/H10N8) segment 6 (NA)1548.60.000000e+001220/1405 (86%)
text_code_colored.pngEPI476118A/pink-footed goose/Iceland/0987/2011 (A/H6N8) segment 6 (NA)1546.80.000000e+001230/1422 (86%)
text_code_colored.pngEPI476098A/greylag goose/Iceland/0961/2011 (A/H6N8) segment 6 (NA)1546.80.000000e+001230/1422 (86%)
text_code_colored.pngEPI476045A/greylag goose/Iceland/0911/2011 (A/H6N8) segment 6 (NA)1546.80.000000e+001230/1422 (86%)
text_code_colored.pngEPI476038A/greylag goose/Iceland/1482/2011 (A/H6N8) segment 6 (NA)1546.80.000000e+001230/1422 (86%)
text_code_colored.pngEPI190185A/mallard/Switzerland/WV4060057/2006 (A/H2N8) segment 6 (NA)1546.80.000000e+001230/1422 (86%)
text_code_colored.pngEPI439277A/common teal/Georgia/1/2011 (A/H3N8) segment 6 (NA)1544.90.000000e+001195/1370 (87%)
text_code_colored.pngEPI601008A/duck/Jiangxi/3008/2009 (A/H0) segment 6 (NA)1541.20.000000e+001231/1424 (86%)
text_code_colored.pngEPI600869A/migratory duck/Jiangxi/21248/2009 (A/H10N8) segment 6 (NA)1541.20.000000e+001232/1425 (86%)
text_code_colored.pngEPI485337A/ruddy shelduck/Mongolia/881V/2009 (A/H3N8) segment 6 (NA)1541.20.000000e+001232/1425 (86%)
text_code_colored.pngEPI476112A/greylag goose/Iceland/0980/2011 (A/H6N8) segment 6 (NA)1541.20.000000e+001229/1422 (86%)
text_code_colored.pngEPI476032A/greylag goose/Iceland/1474/2011 (A/H6N8) segment 6 (NA)1541.20.000000e+001229/1422 (86%)
text_code_colored.pngEPI470299A/wild duck/Jiangxi/19615/2009 (A/H7N8) segment 6 (NA)1541.20.000000e+001231/1424 (86%)
text_code_colored.pngEPI43243A/turkey/Ireland/1378/1983 (A/H5N8) segment 6 (NA)1541.20.000000e+001230/1423 (86%)
text_code_colored.pngEPI600977A/duck/Jiangxi/24570/2009 (A/H0) segment 6 (NA)1539.40.000000e+001227/1420 (86%)
text_code_colored.pngEPI584394A/duck/Hunan/S3137/2009 (A/H10N8) segment 6 (NA)1537.50.000000e+001226/1419 (86%)
text_code_colored.pngEPI600862A/duck/Jiangxi/4759/2009 (A/H10N8) segment 6 (NA)1535.70.000000e+001231/1425 (86%)
text_code_colored.pngEPI314146A/shearwater/Australia/2/1972 (A/H10N8) segment 6 (NA)1535.70.000000e+001231/1425 (86%)
text_code_colored.pngEPI167464A/red-necked stint/Western Australia/4094/1984 (A/H4N8) segment 6 (NA)1535.70.000000e+001232/1426 (86%)
text_code_colored.pngEPI89852A/quail/Italy/1117/1965 (A/H10N8) segment 6 (NA)1535.70.000000e+001231/1425 (86%)
text_code_colored.pngEPI42145A/red-necked stint/Australia/4189/1980 (A/H4N8) segment 6 (NA)1535.70.000000e+001232/1426 (86%)
text_code_colored.pngEPI584401A/duck/Hunan/S4280/2009 (A/H10N8) segment 6 (NA)1533.80.000000e+001225/1419 (86%)
text_code_colored.pngEPI461631A/duck/Hunan/S1256/2012 (A/H3N8) segment 6 (NA)1533.80.000000e+001225/1419 (86%)
text_code_colored.pngEPI314137A/quail/Italy/1117/1965 (A/H10N8) segment 6 (NA)1530.10.000000e+001230/1425 (86%)
text_code_colored.pngEPI76497A/red-necked stint/Western Australia/4923/1983 (A/H3N8) segment 6 (NA)1530.10.000000e+001231/1426 (86%)
text_code_colored.pngEPI76478A/red-necked stint/Bunbury/4500/1980 (A/H3N8) segment 6 (NA)1530.10.000000e+001231/1426 (86%)
text_code_colored.pngEPI42151A/red-necked stint/Australia/4500/1980 (A/H3N8) segment 6 (NA)1530.10.000000e+001231/1426 (86%)
text_code_colored.pngEPI600853A/duck/Jiangxi/22960/2008 (A/H10N8) segment 6 (NA)1528.30.000000e+001225/1420 (86%)
text_code_colored.pngEPI503993A/wild duck/SH38-26/2010 (A/H2N8) segment 6 (NA)1528.30.000000e+001223/1418 (86%)
text_code_colored.pngEPI446509A/wild goose/Dongting/C1037/2011 (A/H12N8) segment 6 (NA)1528.30.000000e+001224/1419 (86%)
text_code_colored.pngEPI417769A/duck/Mongolia/OIE-241/2012 (A/H4N8) segment 6 (NA)1528.30.000000e+001224/1419 (86%)
text_code_colored.pngEPI339173A/mallard/Germany-RP/R2322/2007 (A/H3N8) segment 6 (NA)1528.30.000000e+001204/1389 (86%)
text_code_colored.pngEPI669030A/shellduck/South Africa/DLH/2012 (A/H7N8) segment 6 (NA)1526.50.000000e+001226/1421 (86%)
text_code_colored.pngEPI240185A/red-necked stint/Western Australia/4126/1980 (A/H4N8) segment 6 (NA)1526.50.000000e+001230/1425 (86%)
text_code_colored.pngEPI234639A/duck/Beijing/33/04 (A/H3N8) segment 6 (NA)1526.50.000000e+001210/1397 (86%)
text_code_colored.pngEPI136907A/mallard/Finland/12072/06 (A/H3N8) segment 6 (NA)1526.50.000000e+001225/1420 (86%)
text_code_colored.pngEPI131906A/red-necked stint/Western Australia/4915/1984 (A/H3N8) segment 6 (NA)1524.60.000000e+001230/1426 (86%)
text_code_colored.pngEPI128934A/quail/Italy/1117/1965 (A/H10N8) segment 6 (NA)1524.60.000000e+001229/1425 (86%)
text_code_colored.pngEPI128918A/equine/Jilin/1/1989 (A/H3N8) segment 6 (NA)1524.60.000000e+001232/1428 (86%)
text_code_colored.pngEPI504031A/wild duck/SH38-64/2010 (A/H2N8) segment 6 (NA)1522.80.000000e+001222/1418 (86%)
text_code_colored.pngEPI504027A/wild duck/SH38-28/2010 (A/H2N8) segment 6 (NA)1522.80.000000e+001222/1418 (86%)
text_code_colored.pngEPI384027A/duck/Thailand/CU-7519C/2010 (A/H3N8) segment 6 (NA)1519.10.000000e+001228/1425 (86%)
text_code_colored.pngEPI326944A/duck/Korea/U2-5/2007 (A/H3N8) segment 6 (NA)1519.10.000000e+001212/1404 (86%)
text_code_colored.pngEPI232414A/duck/Beijing/59/05 (A/H3N8) segment 6 (NA)1519.10.000000e+001208/1396 (86%)
text_code_colored.pngEPI76440A/red-necked stint/Australia/2/2004 (A/H4N8) segment 6 (NA)1519.10.000000e+001227/1424 (86%)
text_code_colored.pngEPI383927A/duck/Thailand/CU-7518C/2010 (A/H3N8) segment 6 (NA)1515.40.000000e+001227/1425 (86%)
text_code_colored.pngEPI619984A/red-necked stint/Australia/1/2004 (A/H4N8) segment 6 (NA)1513.50.000000e+001226/1424 (86%)
text_code_colored.pngEPI300176A/slaty-backed gull/Japan/6KS0191/2006 (A/H4N8) segment 6 (NA)1513.50.000000e+001225/1423 (86%)
text_code_colored.pngEPI268305A/duck/Hunan/1469/2002 (A/H6N8) segment 6 (NA)1513.50.000000e+001225/1423 (86%)
text_code_colored.pngEPI234653A/duck/Beijing/44/04 (A/H3N8) segment 6 (NA)1513.50.000000e+001207/1396 (86%)
text_code_colored.pngEPI177129A/red-necked stint/Australia/4/2004 (A/H4N8) segment 6 (NA)1513.50.000000e+001226/1424 (86%)
text_code_colored.pngEPI164804A/red-necked stint/Australia/3/2004 (A/H4N8) segment 6 (NA)1513.50.000000e+001226/1424 (86%)
text_code_colored.pngEPI504030A/wild duck/SH38-60/2010 (A/H2N8) segment 6 (NA)1511.70.000000e+001220/1418 (86%)
text_code_colored.pngEPI310359A/goose/Zambia/06/2008 (A/H3N8) segment 6 (NA)1509.80.000000e+001224/1422 (86%)
text_code_colored.pngEPI310351A/goose/Zambia/05/2008 (A/H3N8) segment 6 (NA)1509.80.000000e+001224/1422 (86%)
text_code_colored.pngEPI584387A/duck/Hunan/S1496/2011 (A/H10N8) segment 6 (NA)1508.00.000000e+001226/1425 (86%)
text_code_colored.pngEPI326941A/duck/Korea/U8-1/2007 (A/H3N8) segment 6 (NA)1508.00.000000e+001210/1404 (86%)
text_code_colored.pngEPI315975A/rufous-necked stint/Japan/6KS0279/2006 (A/H4N8) segment 6 (NA)1508.00.000000e+001225/1424 (86%)
text_code_colored.pngEPI300168A/rufous-necked stint/Japan/6KS0242/2006 (A/H4N8) segment 6 (NA)1508.00.000000e+001225/1424 (86%)
text_code_colored.pngEPI299332A/slaty-backed gull/Japan/6KS0185/2006 (A/H4N8) segment 6 (NA)1508.00.000000e+001225/1424 (86%)
text_code_colored.pngEPI299324A/rufous-necked stint/Japan/6KS0279/2006 (A/H0) segment 6 (NA)1508.00.000000e+001225/1424 (86%)
text_code_colored.pngEPI504029A/wild duck/SH38-56/2010 (A/H2N8) segment 6 (NA)1506.10.000000e+001219/1418 (85%)
text_code_colored.pngEPI504028A/wild duck/SH38-51/2010 (A/H2N8) segment 6 (NA)1506.10.000000e+001219/1418 (85%)
text_code_colored.pngEPI363917A/duck/Guizhou/1073/2007 (A/H6N8) segment 6 (NA)1502.40.000000e+001224/1424 (85%)
text_code_colored.pngEPI178545A/Quail/Italy/1966 (A/H10N8) segment 6 (NA)1502.40.000000e+001227/1427 (85%)
text_code_colored.pngEPI132122A/red-necked stint/Australia/5/2004 (A/H4N8) segment 6 (NA)1502.40.000000e+001220/1418 (86%)
text_code_colored.pngEPI641816A/duck/Thailand/CU-11686T/2011 (A/H3N8) segment 6 (NA)1500.60.000000e+001206/1399 (86%)
text_code_colored.pngEPI641812A/duck/Thailand/CU-11679T/2011 (A/H3N8) segment 6 (NA)1500.60.000000e+001206/1399 (86%)
text_code_colored.pngEPI669111A/cape shoveller/South Africa/STR0982/2013 (A/H4N8) segment 6 (NA)1496.90.000000e+001221/1422 (85%)
text_code_colored.pngEPI669101A/yellow-billed duck/South Africa/STR0963/2013 (A/H4N8) segment 6 (NA)1496.90.000000e+001221/1422 (85%)
text_code_colored.pngEPI485348A/ruddy shelduck/Mongolia/882V/2009 (A/H3N8) segment 6 (NA)1496.90.000000e+001202/1392 (86%)
text_code_colored.pngEPI641814A/duck/Thailand/CU-11682C/2011 (A/H3N8) segment 6 (NA)1495.10.000000e+001203/1396 (86%)
text_code_colored.pngEPI641808A/duck/Thailand/CU-11676C/2011 (A/H3N8) segment 6 (NA)1495.10.000000e+001203/1396 (86%)
text_code_colored.pngEPI485356A/velvet scoter/Mongolia/879V/2009 (A/H10N8) segment 6 (NA)1491.40.000000e+001196/1387 (86%)
text_code_colored.pngEPI485338A/surf scooter/Mongolia/878V/2009 (A/H10N8) segment 6 (NA)1491.40.000000e+001195/1386 (86%)
text_code_colored.pngEPI485319A/common shelduck/Mongolia/2106/2011 (A/H3N8) segment 6 (NA)1491.40.000000e+001195/1386 (86%)
text_code_colored.pngEPI363553A/duck/Hunan/4056/2006 (A/H6N8) segment 6 (NA)1491.40.000000e+001221/1423 (85%)
text_code_colored.pngEPI439278A/mallard/Georgia/3/2011 (A/H3N8) segment 6 (NA)1489.50.000000e+001184/1369 (86%)
text_code_colored.pngEPI232407A/duck/Beijing/56/05 (A/H3N8) segment 6 (NA)1489.50.000000e+001203/1396 (86%)
text_code_colored.pngEPI485352A/northern shoveler/Mongolia/992V/2009 (A/H3N8) segment 6 (NA)1485.80.000000e+001200/1392 (86%)
text_code_colored.pngEPI485325A/northern shoveler/ Mongolia/973/2009 (A/H3N8) segment 6 (NA)1485.80.000000e+001199/1391 (86%)
text_code_colored.pngEPI485310A/mallard/Mongolia/1581/2010 (A/H3N8) segment 6 (NA)1485.80.000000e+001198/1390 (86%)
text_code_colored.pngEPI485309A/northern shoveler/Mongolia/907V/2009 (A/H10N8) segment 6 (NA)1485.80.000000e+001194/1386 (86%)
text_code_colored.pngEPI387402A/whooper swan/Mongolia/1-23/2007 (A/H3N8) segment 6 (NA)1484.00.000000e+001191/1378 (86%)
text_code_colored.pngEPI485342A/ruddy shelduck/Mongolia/961V/2009 (A/H3N8) segment 6 (NA)1480.30.000000e+001201/1394 (86%)
text_code_colored.pngEPI485336A/northern shoveler/Mongolia/977V/2009 (A/H3N8) segment 6 (NA)1480.30.000000e+001201/1394 (86%)
text_code_colored.pngEPI485334A/common teal/Mongolia/1906/2011 (A/H3N8) segment 6 (NA)1480.30.000000e+001221/1425 (85%)
text_code_colored.pngEPI485311A/ruddy shelduck/Mongolia/963V/2009 (A/H3N8) segment 6 (NA)1480.30.000000e+001200/1393 (86%)
text_code_colored.pngEPI387409A/whooper swan/Mongolia/1-25/2007 (A/H3N8) segment 6 (NA)1478.40.000000e+001188/1376 (86%)
text_code_colored.pngEPI254544A/Teal/Norway/10_1745/2007 (A/H4N8) segment 6 (NA)1478.40.000000e+001155/1329 (86%)
text_code_colored.pngEPI345371A/Arenaria interpres/Belgium/17044-27/2008 (A/H3N8) segment 6 (NA)1474.70.000000e+001178/1364 (86%)
text_code_colored.pngEPI485329A/wild bird/Mongolia/1782/2011 (A/H3N8) segment 6 (NA)1471.10.000000e+001199/1397 (85%)
text_code_colored.pngEPI387546A/white-fronted goose/Mongolia/1-125/2008 (A/H3N8) segment 6 (NA)1469.20.000000e+001181/1370 (86%)
text_code_colored.pngEPI643152A/Environment/Guangdong/GZ55/2013(H5N8) (A/H5N8) segment 6 (NA)1467.40.000000e+00847/873 (97%)
text_code_colored.pngEPI641801A/duck/Thailand/CU-11671C/2011 (A/H3N8) segment 6 (NA)1467.40.000000e+001190/1384 (85%)
text_code_colored.pngEPI534767A/mallard/Finland/11237/2007 (A/H3N8) segment 6 (NA)1467.40.000000e+001188/1381 (86%)
text_code_colored.pngEPI387539A/snow goose/Mongolia/1-44/2008 (A/H3N8) segment 6 (NA)1467.40.000000e+001183/1373 (86%)
text_code_colored.pngEPI387532A/snow goose/Mongolia/1-29/2008 (A/H3N8) segment 6 (NA)1467.40.000000e+001183/1373 (86%)
text_code_colored.pngEPI334412A/Teal/Norway/10_644/2010 (A/H0N8) segment 6 (NA)1465.50.000000e+001159/1339 (86%)
text_code_colored.pngEPI485344A/velvet scoter/Mongolia/969V/2009 (A/H3N8) segment 6 (NA)1463.70.000000e+001197/1393 (85%)
text_code_colored.pngEPI393350A/wild bird/Korea/5-77/2005 (A/H7N8) segment 6 (NA)1447.00.000000e+001166/1353 (86%)
text_code_colored.pngEPI393276A/mallard/Korea/21-9/2008 (A/H7N8) segment 6 (NA)1447.00.000000e+001166/1353 (86%)
text_code_colored.pngEPI326929A/duck/Korea/GJ79/2007 (A/H3N8) segment 6 (NA)1447.00.000000e+001175/1368 (85%)
text_code_colored.pngEPI393358A/mallard/Korea/5-80/2005 (A/H7N8) segment 6 (NA)1441.50.000000e+001165/1353 (86%)
text_code_colored.pngEPI326927A/duck/Korea/GJ82/2007 (A/H3N8) segment 6 (NA)1439.70.000000e+001171/1364 (85%)
text_code_colored.pngEPI387422A/whooper swan/Mongolia/1-27/2007 (A/H3N8) segment 6 (NA)1434.10.000000e+001181/1377 (85%)
text_code_colored.pngEPI387388A/whooper swan/Mongolia/1-17/2007 (A/H3N8) segment 6 (NA)1434.10.000000e+001181/1377 (85%)
text_code_colored.pngEPI485331A/ruddy shelduck/Mongolia/1602/2010 (A/H10N8) segment 6 (NA)1430.40.000000e+001189/1391 (85%)
text_code_colored.pngEPI326928A/duck/Korea/GJ80/2007 (A/H3N8) segment 6 (NA)1419.30.000000e+001155/1345 (85%)
text_code_colored.pngEPI228910A/duck/South Africa/1108/2004 (A/H3N8) segment 6 (NA)1417.50.000000e+001132/1311 (86%)
text_code_colored.pngEPI618580A/mallard/Sweden/2321/2004 (A/H0) segment 6 (NA)1415.70.000000e+001211/1426 (84%)
text_code_colored.pngEPI618532A/mallard/Sweden/101754/2009 (A/H0) segment 6 (NA)1415.70.000000e+001211/1426 (84%)
text_code_colored.pngEPI618508A/mallard/Sweden/101558/2009 (A/H0) segment 6 (NA)1415.70.000000e+001211/1426 (84%)
text_code_colored.pngEPI618311A/black-headed gull/Sweden/74331/2008 (A/H0) segment 6 (NA)1415.70.000000e+001211/1426 (84%)
text_code_colored.pngEPI600939A/duck/Jiangxi/3078/2009 (A/H0) segment 6 (NA)1415.70.000000e+001163/1355 (85%)
text_code_colored.pngEPI159231A/black-headed gull/Norway/10_1459/2006 (A/H13N8) segment 6 (NA)1415.70.000000e+001211/1426 (84%)
text_code_colored.pngEPI296618A/black-headed gull/Sweden/1/2005 (A/H13N8) segment 6 (NA)1413.80.000000e+001213/1429 (84%)
text_code_colored.pngEPI618150A/black-headed gull/Sweden/74342/2008 (A/H13N8) segment 6 (NA)1410.10.000000e+001210/1426 (84%)
text_code_colored.pngEPI109536A/duck/South Africa/1233A/2004 (A/H4N8) segment 6 (NA)1410.10.000000e+001137/1319 (86%)
text_code_colored.pngEPI316536A/herring gull/Mongolia/454/2008 (A/H13N8) segment 6 (NA)1408.30.000000e+001209/1426 (84%)
text_code_colored.pngEPI24753A/black-headed gull/Netherlands/1/00 (A/H13N8) segment 6 (NA)1406.40.000000e+001199/1411 (84%)
text_code_colored.pngEPI372346A/teal/Egypt/11974-NAMRU3/2005 (A/H13N8) segment 6 (NA)1397.20.000000e+001211/1430 (84%)
text_code_colored.pngEPI326926A/duck/Korea/GJ87/2007 (A/H3N8) segment 6 (NA)1389.80.000000e+001137/1326 (85%)
text_code_colored.pngEPI254401A/Egyptian goose/South Africa/AI1448/2007 (A/H1N8) segment 6 (NA)1367.60.000000e+001123/1310 (85%)
text_code_colored.pngEPI102729A/ostrich/South Africa/KK98/98 (A/H6N8) segment 6 (NA)1358.40.000000e+001125/1316 (85%)
text_code_colored.pngEPI254393A/ostrich/South Africa/AI1447/2007 (A/H6N8) segment 6 (NA)1351.00.000000e+001122/1312 (85%)
text_code_colored.pngEPI617850A/yellow-legged gull/Republic of Georgia/2/2013 (A/H13N8) segment 6 (NA)1288.20.000000e+001192/1430 (83%)
text_code_colored.pngEPI617843A/yellow-legged gull/Republic of Georgia/1/2013 (A/H13N8) segment 6 (NA)1288.20.000000e+001192/1430 (83%)
text_code_colored.pngEPI617909A/black-headed gull/Republic of Georgia/4/2011 (A/H13N8) segment 6 (NA)1280.80.000000e+001193/1433 (83%)
text_code_colored.pngEPI617929A/black-headed gull/Republic of Georgia/1/2011 (A/H13N8) segment 6 (NA)1275.30.000000e+001193/1434 (83%)
text_code_colored.pngEPI617902A/black-headed gull/Republic of Georgia/3/2011 (A/H13N8) segment 6 (NA)1275.30.000000e+001193/1434 (83%)
text_code_colored.pngEPI617934A/black-headed gull/Republic of Georgia/6/2011 (A/H13N8) segment 6 (NA)1269.80.000000e+001192/1434 (83%)
text_code_colored.pngEPI617800A/black-headed gull/Republic of Georgia/9/2011 (A/H13N8) segment 6 (NA)1264.20.000000e+001190/1433 (83%)
text_code_colored.pngEPI345411A/Larus argentatus/Belgium/14469-20/2008 (A/H13N8) segment 6 (NA)1256.80.000000e+001142/1364 (83%)
text_code_colored.pngEPI487949A/teal/Tunka/7/2010 (A/H3N8) segment 6 (NA)1251.30.000000e+001046/1225 (85%)
text_code_colored.pngEPI242245A/cockatoo/England/1972 (A/H4N8) segment 6 (NA)1249.50.000000e+001109/1319 (84%)
text_code_colored.pngEPI439266A/black-headed gull/Georgia/3/2011 (A/H13N8) segment 6 (NA)1190.40.000000e+001143/1382 (82%)
text_code_colored.pngEPI439350A/black-headed gull/Georgia/6/2011 (A/H13N8) segment 6 (NA)1188.50.000000e+001144/1384 (82%)
text_code_colored.pngEPI439355A/black-headed gull/Georgia/4/2011 (A/H13N8) segment 6 (NA)1184.80.000000e+001143/1383 (82%)
text_code_colored.pngEPI242334A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA)1149.70.000000e+00847/957 (88%)
text_code_colored.pngEPI237968A/Duck/Newjersey/2000 (A/H3N8) segment 6 (NA)1118.30.000000e+001167/1436 (81%)
text_code_colored.pngEPI439270A/black-headed gull/Georgia/1/2011 (A/H13N8) segment 6 (NA)1072.20.000000e+00957/1139 (84%)
text_code_colored.pngEPI88027A/pintail duck/ALB/169/1980 (A/H3N8) segment 6 (NA)946.60.000000e+001148/1448 (79%)
text_code_colored.pngEPI42361A/domestic duck/Minnesota/1086/1980 (A/H4N8) segment 6 (NA)931.80.000000e+001145/1448 (79%)
text_code_colored.pngEPI298338A/red-necked stint/Australia/1/2004 (A/H4N8) segment 6 (NA)913.40.000000e+00731/848 (86%)
text_code_colored.pngEPI328364A/environment/California/7650/2008 (A/H11N8) segment 6 (NA)909.70.000000e+001137/1444 (78%)
text_code_colored.pngEPI86218A/mallard duck/ALB/31/1976 (A/H3N8) segment 6 (NA)909.70.000000e+001141/1448 (78%)
text_code_colored.pngEPI344800A/mallard/Alberta/32/1991 (A/H3N8) segment 6 (NA)904.10.000000e+001139/1447 (78%)
text_code_colored.pngEPI343781A/mallard/Alberta/160/2001 (A/H3N8) segment 6 (NA)904.10.000000e+001138/1446 (78%)
text_code_colored.pngEPI87200A/mallard/Alberta/156/2001 (A/H3N8) segment 6 (NA)904.10.000000e+001138/1446 (78%)
text_code_colored.pngEPI60895A/mallard/Ohio/421/1987 (A/H7N8) segment 6 (NA)904.10.000000e+001139/1447 (78%)
text_code_colored.pngEPI690666A/goose/Taiwan/TNO5/2015 (A/H5N8) segment 6 (NA)900.40.000000e+00487/487 (100%)
text_code_colored.pngEPI345045A/pintail/Alberta/128/1987 (A/H3N8) segment 6 (NA)900.40.000000e+001135/1443 (78%)
text_code_colored.pngEPI344320A/mallard/Alberta/85/1994 (A/H3N8) segment 6 (NA)900.40.000000e+001135/1443 (78%)
text_code_colored.pngEPI344088A/shorebird/Delaware Bay/110/1999 (A/H3N8) segment 6 (NA)898.60.000000e+001134/1443 (78%)
text_code_colored.pngEPI344072A/shorebird/Delaware Bay/122/1999 (A/H3N8) segment 6 (NA)898.60.000000e+001134/1443 (78%)
text_code_colored.pngEPI344048A/ruddy turnstone/Delaware Bay/147/1999 (A/H0) segment 6 (NA)898.60.000000e+001134/1443 (78%)
text_code_colored.pngEPI344037A/ruddy turnstone/Delaware Bay/150/1999 (A/H3N8) segment 6 (NA)898.60.000000e+001134/1443 (78%)
text_code_colored.pngEPI344029A/shorebird/Delaware Bay/159/1999 (A/H3N8) segment 6 (NA)898.60.000000e+001134/1443 (78%)
text_code_colored.pngEPI343936A/ruddy turnstone/Delaware Bay/244/1999 (A/H3N8) segment 6 (NA)898.60.000000e+001134/1443 (78%)
text_code_colored.pngEPI343920A/shorebird/Delaware Bay/267/1999 (A/H0) segment 6 (NA)898.60.000000e+001134/1443 (78%)
text_code_colored.pngEPI343911A/shorebird/Delaware Bay/268/1999 (A/H3N8) segment 6 (NA)898.60.000000e+001134/1443 (78%)
text_code_colored.pngEPI343902A/shorebird/Delaware Bay/270/1999 (A/H3N8) segment 6 (NA)898.60.000000e+001134/1443 (78%)
text_code_colored.pngEPI343894A/shorebird/Delaware Bay/272/1999 (A/H3N8) segment 6 (NA)898.60.000000e+001134/1443 (78%)
text_code_colored.pngEPI343878A/shorebird/Delaware Bay/282/1999 (A/H3N8) segment 6 (NA)898.60.000000e+001135/1444 (78%)
text_code_colored.pngEPI227251A/mallard/British Columbia/07569/2005 (A/H3N8) segment 6 (NA)898.60.000000e+001139/1448 (78%)
text_code_colored.pngEPI44060A/mallard/Ohio/338/1986 (A/H4N8) segment 6 (NA)898.60.000000e+001139/1448 (78%)
text_code_colored.pngEPI471875A/duck/Guangxi/GXd-6/2010 (A/H6N8) segment 6 (NA)893.10.000000e+001134/1444 (78%)
text_code_colored.pngEPI344694A/mallard/Alberta/196/1992 (A/H0) segment 6 (NA)893.10.000000e+001138/1448 (78%)
text_code_colored.pngEPI344288A/pintail/Alberta/114/1995 (A/H3N8) segment 6 (NA)893.10.000000e+001140/1450 (78%)
text_code_colored.pngEPI290767A/teal/Oregon/44336-122/2007 (A/H3N8) segment 6 (NA)893.10.000000e+001134/1444 (78%)
text_code_colored.pngEPI268304A/duck/Shantou/2954/2003 (A/H6N8) segment 6 (NA)893.10.000000e+001133/1443 (78%)
text_code_colored.pngEPI169605A/mallard/Ohio/338/1986 (A/H4N8) segment 6 (NA)893.10.000000e+001138/1448 (78%)
text_code_colored.pngEPI87123A/blue-winged teal/ALB/569/1985 (A/H3N8) segment 6 (NA)893.10.000000e+001137/1447 (78%)
text_code_colored.pngEPI86138A/mallard/ALB/206/1996 (A/H6N8) segment 6 (NA)893.10.000000e+001140/1450 (78%)
text_code_colored.pngEPI344880A/mallard/Alberta/20/1989 (A/H3N8) segment 6 (NA)887.50.000000e+001136/1447 (78%)
text_code_colored.pngEPI344651A/mallard/Alberta/72/1993 (A/H3N8) segment 6 (NA)887.50.000000e+001139/1450 (78%)
text_code_colored.pngEPI344160A/ruddy turnstone/Delaware Bay/250/1998 (A/H3N8) segment 6 (NA)887.50.000000e+001134/1445 (78%)
text_code_colored.pngEPI315125A/chicken/Vietnam/G14/2008 (A/H3N8) segment 6 (NA)887.50.000000e+001131/1442 (78%)
text_code_colored.pngEPI21995A/mallard/Alberta/117/97 (A/H3N8) segment 6 (NA)885.70.000000e+001135/1445 (78%)
text_code_colored.pngEPI344677A/pintail/Alberta/232/1992 (A/H3N8) segment 6 (NA)882.00.000000e+001136/1448 (78%)
text_code_colored.pngEPI328340A/environment/California/7862/2008 (A/H3N8) segment 6 (NA)882.00.000000e+001131/1443 (78%)
text_code_colored.pngEPI238541A/mallard/Minnesota/231/1999 (A/H3N8) segment 6 (NA)882.00.000000e+001138/1450 (78%)
text_code_colored.pngEPI227243A/mallard/Alberta/11527/2005 (A/H3N8) segment 6 (NA)882.00.000000e+001135/1447 (78%)
text_code_colored.pngEPI87378A/pintail duck/ALB/220/1977 (A/H4N8) segment 6 (NA)882.00.000000e+001135/1447 (78%)
text_code_colored.pngEPI85776A/pintail duck/ALB/628/1979 (A/H6N8) segment 6 (NA)882.00.000000e+001133/1445 (78%)
text_code_colored.pngEPI44105A/mallard/Alaska/256/2005 (A/H3N8) segment 6 (NA)882.00.000000e+001134/1446 (78%)
text_code_colored.pngEPI22235A/mallard/Alberta/279/98 (A/H3N8) segment 6 (NA)882.00.000000e+001133/1445 (78%)
text_code_colored.pngEPI345037A/blue-winged teal/Alberta/130/1987 (A/H3N8) segment 6 (NA)878.30.000000e+001132/1444 (78%)
text_code_colored.pngEPI614875A/blue winged-teal/Wisconsin/12OS4304/2012 (A/H4N8) segment 6 (NA)876.40.000000e+001134/1447 (78%)
text_code_colored.pngEPI614602A/blue winged-teal/Wisconsin/12OS4306/2012 (A/H4N8) segment 6 (NA)876.40.000000e+001134/1447 (78%)
text_code_colored.pngEPI595747A/environment/Maryland/09OS1072/2009 (A/H6N8) segment 6 (NA)876.40.000000e+001137/1450 (78%)
text_code_colored.pngEPI448466A/mallard/Minnesota/355780/2000 (A/H0) segment 6 (NA)876.40.000000e+001134/1447 (78%)
text_code_colored.pngEPI402393A/pintail/Alberta/87/1993 (A/H6N8) segment 6 (NA)876.40.000000e+001136/1449 (78%)
text_code_colored.pngEPI344888A/mallard/Alberta/782/1986 (A/H3N8) segment 6 (NA)876.40.000000e+001136/1449 (78%)
text_code_colored.pngEPI344685A/American wigeon/Alberta/215/1992 (A/H3N8) segment 6 (NA)876.40.000000e+001135/1448 (78%)
text_code_colored.pngEPI344328A/mallard/Alberta/31/1994 (A/H3N8) segment 6 (NA)876.40.000000e+001140/1453 (78%)
text_code_colored.pngEPI344144A/mallard/Alberta/167/1998 (A/H3N8) segment 6 (NA)876.40.000000e+001134/1447 (78%)
text_code_colored.pngEPI344136A/mallard/Alberta/169/1998 (A/H3N8) segment 6 (NA)876.40.000000e+001134/1447 (78%)
text_code_colored.pngEPI343518A/blue-winged teal/Alberta/222/2005 (A/H3N8) segment 6 (NA)876.40.000000e+001133/1446 (78%)
text_code_colored.pngEPI227457A/ring-necked duck/California/K90/2005 (A/H6N8) segment 6 (NA)876.40.000000e+001132/1445 (78%)
text_code_colored.pngEPI226898A/blue-winged teal/Alberta/11646/2005 (A/H3N8) segment 6 (NA)876.40.000000e+001133/1446 (78%)
text_code_colored.pngEPI645418A/American green-winged teal/Ohio/13OS1840/2013 (A/H6N8) segment 6 (NA)870.90.000000e+001133/1447 (78%)
text_code_colored.pngEPI616442A/blue-winged teal/Illinois/12OS4763/2012 (A/H0) segment 6 (NA)870.90.000000e+001131/1445 (78%)
text_code_colored.pngEPI526391A/American green-winged teal/Ohio/13OS1781/2013 (A/H6N8) segment 6 (NA)870.90.000000e+001133/1447 (78%)
text_code_colored.pngEPI526333A/American green-winged teal/Ohio/13OS2060/2013 (A/H6N8) segment 6 (NA)870.90.000000e+001133/1447 (78%)
text_code_colored.pngEPI449486A/mallard/Minnesota/Sg-00831/2008 (A/H3N8) segment 6 (NA)870.90.000000e+001132/1446 (78%)
text_code_colored.pngEPI449269A/mallard/Minnesota/Sg-00591/2008 (A/H3N8) segment 6 (NA)870.90.000000e+001132/1446 (78%)
text_code_colored.pngEPI449262A/mallard/Minnesota/Sg-00590/2008 (A/H3N8) segment 6 (NA)870.90.000000e+001132/1446 (78%)
text_code_colored.pngEPI449255A/mallard/Minnesota/Sg-00589/2008 (A/H3N8) segment 6 (NA)870.90.000000e+001132/1446 (78%)
text_code_colored.pngEPI449248A/gadwall duck/Minnesota/Sg-00575/2008 (A/H3N8) segment 6 (NA)870.90.000000e+001132/1446 (78%)
text_code_colored.pngEPI345126A/redhead/Alberta/337/2007 (A/H0) segment 6 (NA)870.90.000000e+001132/1446 (78%)
text_code_colored.pngEPI345108A/bufflehead/Alberta/399/2007 (A/H0) segment 6 (NA)870.90.000000e+001131/1445 (78%)
text_code_colored.pngEPI345053A/mallard/Alberta/16/1987 (A/H3N8) segment 6 (NA)870.90.000000e+001135/1449 (78%)
text_code_colored.pngEPI343117A/mallard/Alberta/312/2007 (A/H3N8) segment 6 (NA)870.90.000000e+001131/1445 (78%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI690787A/goose/Taiwan/TNO20/2015 (A/H5N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI690755A/goose/Taiwan/TNO16/2015 (A/H5N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI690747A/goose/Taiwan/TNO15/2015 (A/H5N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI690699A/goose/Taiwan/TNO9/2015 (A/H5N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI690675A/goose/Taiwan/TNO6/2015 (A/H5N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI690659A/goose/Taiwan/TNO4/2015 (A/H5N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI690651A/goose/Taiwan/TNO3/2015 (A/H5N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI690643A/goose/Taiwan/TNO2/2015 (A/H5N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI690603A/goose/Taiwan/TNC11/2015 (A/H5N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI690555A/goose/Taiwan/TNC5/2015 (A/H5N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI690547A/goose/Taiwan/TNC4/2015 (A/H5N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI588979A/duck/Taiwan/a068/2015 (A/H5N8) segment 7 (MP)1812.70.000000e+00981/981 (100%)
text_code_colored.pngEPI588955A/goose/Taiwan/a015/2015 (A/H5N8) segment 7 (MP)1812.70.000000e+00981/981 (100%)
text_code_colored.pngEPI690739A/goose/Taiwan/TNO14/2015 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690707A/goose/Taiwan/TNO10/2015 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690683A/goose/Taiwan/TNO7/2015 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690619A/goose/Taiwan/TNC13/2015 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690587A/goose/Taiwan/TNC9/2015 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690539A/goose/Taiwan/TNC3/2015 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690457A/Canada goose/Washington/197619/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690430A/mallard/Washington/195246/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690353A/mallard/Oregon/195547/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690346A/Northern pintail/Washington/195365/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690272A/American wigeon/Oregon/AH0012525/2015 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690222A/Northern pintail/Oregon/AH0003871/2015 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690162A/wood duck/Oregon/AH0007257/2015 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690155A/wood duck/Oregon/AH0007244/2015 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI690141A/mallard/Oregon/AH0003952/2015 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI586561A/chicken/BC/FAV25/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI586553A/chicken/BC/FAV24/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI586521A/chicken/BC/FAV20/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI586504A/poultry/BC/FAV17/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585651A/baikal teal/Korea/2416/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585650A/baikal teal/Korea/2414/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585649A/baikal teal/Korea/2406/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585647A/baikal teal/Korea/2402/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585646A/baikal teal/Korea/2399/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585645A/baikal teal/Korea/1458/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585644A/baikal teal/Korea/1457/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585643A/baikal teal/Korea/1456/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585642A/baikal teal/Korea/1454/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585641A/baikal teal/Korea/1452/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585639A/baikal teal/Korea/1448/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585638A/baikal teal/Korea/1447/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585637A/baikal teal/Korea/1446/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585635A/baikal teal/Korea/1441/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585634A/baikal teal/Korea/1437/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI585087A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI584082A/turkey/BC/FAV14/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI576480A/chicken/BC/FAV9/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI576473A/chicken/BC/FAV8/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI573301A/turkey/BC/FAV10/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI569386A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561700A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561693A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561684A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561677A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561670A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561656A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561649A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561636A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561629A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561622A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561601A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561594A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561580A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561573A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561566A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561559A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561552A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561532A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561525A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561511A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561351A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561344A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561211A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561199A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI561190A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI553211A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI542633A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI517164A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI509756A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI509711A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP)1809.00.000000e+00981/982 (99%)
text_code_colored.pngEPI588971A/chicken/Taiwan/a174/2015 (A/H5N3) segment 7 (MP)1807.10.000000e+00980/981 (99%)
text_code_colored.pngEPI588963A/duck/Taiwan/a043/2015 (A/H5N2) segment 7 (MP)1807.10.000000e+00980/981 (99%)
text_code_colored.pngEPI690779A/goose/Taiwan/TNO19/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690771A/goose/Taiwan/TNO18/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690763A/goose/Taiwan/TNO17/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690731A/goose/Taiwan/TNO13/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690723A/goose/Taiwan/TNO12/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690715A/goose/Taiwan/TNO11/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690691A/goose/Taiwan/TNO8/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690635A/goose/Taiwan/TNO1/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690627A/goose/Taiwan/TNC14/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690611A/goose/Taiwan/TNC12/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690595A/goose/Taiwan/TNC10/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690579A/goose/Taiwan/TNC8/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690571A/goose/Taiwan/TNC7/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690563A/goose/Taiwan/TNC6/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690531A/goose/Taiwan/TNC2/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690523A/goose/Taiwan/TNC1/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690450A/mallard/Washington/195810/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690443A/peregrine falcon/Washington/196426/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690423A/American wigeon/Washington/195205/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690416A/American wigeon/Washington/195198/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690402A/American wigeon/Washington/196340/2015 (A/H5N1) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690395A/American wigeon/Washington/196336/2015 (A/H5N1) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690388A/mallard/Washington/196865/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690332A/mallard/Oregon/AH0003821/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690289A/chicken/California/15-004912/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690281A/mallard/Nevada/AH0006855/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690265A/Canada goose/Oregon/AH0012452/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690251A/American green-winged teal/Idaho/AH0011899/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690215A/mallard/Oregon/AH0008887/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690190A/Northern shoveler/Oregon/AH0007339/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690183A/Northern shoveler/Oregon/AH0007337/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690176A/Northern shoveler/Oregon/AH0007332/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690169A/wood duck/Oregon/AH0007263/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690148A/Northern pintail/Oregon/AH0003967/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690134A/American wigeon/Utah/AH0007824/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI662740A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI662726A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI662719A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI662712A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI662705A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI662691A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI620411A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590743A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590736A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590729A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590722A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590708A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590695A/chicken/Washington/3490-18/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI590688A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI587524A/American wigeon/BC/050-31/2015 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI586545A/chicken/BC/FAV23/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI586537A/chicken/BC/FAV22/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI586529A/chicken/BC/FAV21/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI586513A/poultry/BC/FAV19/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI586496A/poultry/BC/FAV15/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI585652A/baikal teal/Korea/2417/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI585648A/baikal teal/Korea/2403/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI585640A/baikal teal/Korea/1449/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI585636A/baikal teal/Korea/1445/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI585095A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI573289A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI573164A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI569393A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568702A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568701A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568699A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568698A/turkey/Washington/61-22/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI568697A/chicken/Washington/61-9/2014 (A/H5N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561708A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561663A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561615A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561608A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561545A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561518A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561363A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI561356A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI554603A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI553346A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI552749A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI548627A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI547684A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI690471A/snowy owl/Wisconsin/198399/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI690464A/Cooper's hawk/Minnesota/198225/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI690409A/mallard/Oregon/195536/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI690381A/Northern pintail/Washington/196271/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI690366A/mallard/Washington/196262/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI690339A/bald eagle/Idaho/15-002892-2/2015 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI690325A/mallard/Idaho/AH0005955/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI690318A/mallard/Idaho/AH0005954/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI690244A/mallard/Idaho/AH0007413/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI690237A/mallard/Idaho/AH0007412/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI690197A/mallard/Idaho/AH0008597/2015 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI690127A/snow goose/Missouri/15-011246-1/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI662747A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI662733A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI662697A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI620460A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI620453A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI620446A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI620439A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI620432A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI620425A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI620418A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI595144A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI595136A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI595131A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI595122A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI595114A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI595105A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI595097A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI595085A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI595077A/mallard/Korea/N15-99/2015 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI590715A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI587636A/chicken/Iowa/04-20/2015 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI573641A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI573190A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI558012A/duck/England/36038/14 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI558005A/duck/England/36226/14 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI553365A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI548496A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI548488A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI547676A/duck/England/36254/14 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI555124A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP)1796.10.000000e+00976/978 (99%)
text_code_colored.pngEPI553181A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP)1796.10.000000e+00976/978 (99%)
text_code_colored.pngEPI548426A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP)1796.10.000000e+00976/978 (99%)
text_code_colored.pngEPI690477A/Canada goose/Kansas/197850/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI690359A/American wigeon/Washington/195968/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI690258A/American green-winged teal/Oregon/AH0012403/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI662684A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI595069A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI576394A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI576381A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI573683A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI573675A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI573667A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI573657A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI573649A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI573182A/duck/Netherlands/14015898/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI573174A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI542997A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP)1792.40.000000e+00976/979 (99%)
text_code_colored.pngEPI595061A/common teal/Korea/KU-12/2015 (A/H5N8) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI543005A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP)1786.80.000000e+00975/979 (99%)
text_code_colored.pngEPI431451A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI414241A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI398977A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI596292A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 7 (MP)1722.20.000000e+00948/955 (99%)
text_code_colored.pngEPI552763A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 7 (MP)1716.70.000000e+00947/955 (99%)
text_code_colored.pngEPI475582A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI399963A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI328891A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI328875A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI328867A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI328883A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI590682A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 7 (MP)1698.20.000000e+00929/934 (99%)
text_code_colored.pngEPI585114A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 7 (MP)1698.20.000000e+00929/934 (99%)
text_code_colored.pngEPI442028A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP)1698.20.000000e+00961/982 (97%)
text_code_colored.pngEPI398978A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP)1698.20.000000e+00961/982 (97%)
text_code_colored.pngEPI442004A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP)1687.10.000000e+00960/983 (97%)
text_code_colored.pngEPI431459A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP)1681.60.000000e+00958/982 (97%)
text_code_colored.pngEPI596304A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP)1677.90.000000e+00912/914 (99%)
text_code_colored.pngEPI552779A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP)1677.90.000000e+00912/914 (99%)
text_code_colored.pngEPI442020A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP)1676.00.000000e+00957/982 (97%)
text_code_colored.pngEPI597680A/duck/Hunan/316/2005 (A/H5N1) segment 7 (MP)1670.50.000000e+00956/982 (97%)
text_code_colored.pngEPI493836A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP)1670.50.000000e+00956/982 (97%)
text_code_colored.pngEPI493820A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP)1670.50.000000e+00956/982 (97%)
text_code_colored.pngEPI442012A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP)1670.50.000000e+00958/984 (97%)
text_code_colored.pngEPI280107A/Shanghai/1/2006 (A/H5N1) segment 7 (MP)1670.50.000000e+00956/982 (97%)
text_code_colored.pngEPI280099A/Guangdong/1/2006 (A/H5N1) segment 7 (MP)1670.50.000000e+00956/982 (97%)
text_code_colored.pngEPI227312A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP)1670.50.000000e+00956/982 (97%)
text_code_colored.pngEPI164233A/Sichuan/2/2006 (A/H5N1) segment 7 (MP)1670.50.000000e+00956/982 (97%)
text_code_colored.pngEPI164225A/Sichuan/1/2006 (A/H5N1) segment 7 (MP)1670.50.000000e+00956/982 (97%)
text_code_colored.pngEPI111857A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP)1670.50.000000e+00956/982 (97%)
text_code_colored.pngEPI106032A/China/GD01/2006 (A/H5N1) segment 7 (MP)1670.50.000000e+00956/982 (97%)
text_code_colored.pngEPI596298A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 7 (MP)1666.80.000000e+00908/911 (99%)
text_code_colored.pngEPI552771A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 7 (MP)1666.80.000000e+00908/911 (99%)
text_code_colored.pngEPI493828A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP)1665.00.000000e+00956/983 (97%)
text_code_colored.pngEPI399889A/duck/HuBei/03/2010 (A/H5N5) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI276073A/shrike/Tibet/13/2006 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI275985A/duck/Hubei/49/2005 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI275389A/Anhui/2/2005 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI251445A/Anhui/1/2006 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI251423A/Sichuan/3/2006 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI251419A/Zhejiang/1/2006 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI224780A/Shanghai/1/2006 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI167956A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI164241A/Anhui/2/2005 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI164217A/Anhui/1/2005 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI127390A/wild duck/Hunan/021/2005 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI111872A/duck/Guiyang/1558/2006 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI111860A/goose/Guiyang/4030/2005 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI111674A/duck/Hunan/5472/2005 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI111656A/goose/Shantou/3265/2006 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI111644A/goose/Guiyang/538/2006 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI111632A/chicken/Guiyang/4059/2005 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/982 (97%)
text_code_colored.pngEPI111578A/duck/Guangxi/4428/2005 (A/H5N1) segment 7 (MP)1665.00.000000e+00956/983 (97%)
text_code_colored.pngEPI506248A/duck/Laos/3295/2006 (A/H5N1) segment 7 (MP)1659.40.000000e+00952/979 (97%)
text_code_colored.pngEPI337321A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI337314A/environment/Xinjiang/6/2009 (A/H5N1) segment 7 (MP)1659.40.000000e+00955/983 (97%)
text_code_colored.pngEPI280267A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI280259A/environment/Xinjiang/6/2009 (A/H5N1) segment 7 (MP)1659.40.000000e+00955/983 (97%)
text_code_colored.pngEPI275961A/duck/Anhui/1/06 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI275873A/chicken/Sichuan/81/2005 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI275769A/chicken/Hunan/1/2009 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI251431A/Guangdong/1/2008 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI251427A/Anhui/1/2007 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI235901A/duck/Zhejiang/bj/2002 (A/H5N1) segment 7 (MP)1659.40.000000e+00955/983 (97%)
text_code_colored.pngEPI222571A/scaly-breasted munia/Hong Kong/2433/2007 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI221720A/chestnut munia/Hong Kong/2442/2007 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI164328A/goose/Yunnan/4985/2006 (A/H5N1) segment 7 (MP)1659.40.000000e+00955/983 (97%)
text_code_colored.pngEPI164304A/goose/Yunnan/3798/2006 (A/H5N1) segment 7 (MP)1659.40.000000e+00955/983 (97%)
text_code_colored.pngEPI164280A/duck/Yunnan/4873/2006 (A/H5N1) segment 7 (MP)1659.40.000000e+00955/983 (97%)
text_code_colored.pngEPI164267A/Jiangxi/1/2005 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI123805A/Chicken/Laos/Xaythiani 32/2006 (A/H5N1) segment 7 (MP)1659.40.000000e+00955/983 (97%)
text_code_colored.pngEPI111884A/duck/Hunan/1204/2006 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI111878A/duck/Guiyang/1722/2006 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI111641A/duck/Guiyang/497/2006 (A/H5N1) segment 7 (MP)1659.40.000000e+00954/982 (97%)
text_code_colored.pngEPI111611A/duck/Guangxi/288/2006 (A/H5N1) segment 7 (MP)1659.40.000000e+00955/983 (97%)
text_code_colored.pngEPI111608A/goose/Guangxi/224/2006 (A/H5N1) segment 7 (MP)1659.40.000000e+00955/983 (97%)
text_code_colored.pngEPI111587A/chicken/Guangxi/4989/2005 (A/H5N1) segment 7 (MP)1659.40.000000e+00955/983 (97%)
text_code_colored.pngEPI135982A/duck/Hunan/533/2004 (A/H5N1) segment 7 (MP)1657.60.000000e+00954/982 (97%)
text_code_colored.pngEPI111659A/goose/Shantou/3295/2006 (A/H5N1) segment 7 (MP)1657.60.000000e+00951/978 (97%)
text_code_colored.pngEPI111527A/common magpie/Hong Kong/645/2006 (A/H5N1) segment 7 (MP)1657.60.000000e+00951/978 (97%)
text_code_colored.pngEPI530991A/duck/Zhejiang/W24/2013 (A/H5N8) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI408138A/chicken/Hmawbi/517/2007 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI406409A/Muscovy duck/Ca Mau/22/2007 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI406347A/chicken/Hanoi/45/2007 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI406339A/duck/Soc Trang/31/2007 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI361519A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI350529A/duck/Vietnam/NCVD-013/2008 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI280115A/Hubei/1/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00952/982 (96%)
text_code_colored.pngEPI280091A/Hunan/1/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI276009A/duck/Hunan/69/2004 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI275777A/chicken/Hunan/21/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI275465A/Guangxi/1/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI251424A/Guangdong/2/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI229699A/crested eagle/Belgium/01/2004 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI227011A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI225090A/duck/Nam Dinh/218/2006 (A/H5) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI180954A/duck/Laos/25/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI174623A/duck/Hunan/3315/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI174615A/chicken/Hunan/1793/2007 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI174613A/duck/Henan/1650/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI170659A/chicken/Vietnam/209/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI170651A/duck/Vietnam/210/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI170644A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI170637A/chicken/Vietnam/212/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI170630A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI170616A/chicken/Vietnam/216/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI170608A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI170600A/duck/Vietnam/218/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI170592A/duck/Vietnam/219/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI164384A/goose/Yunnan/6384/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI164352A/goose/Yunnan/5599/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI164344A/goose/Yunnan/5540/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI164320A/goose/Yunnan/4389/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI164312A/goose/Yunnan/4371/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI164259A/Guangxi/1/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI126692A/human/China/GD02/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI123811A/Chicken/Laos/Xaythiani 37/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI123808A/Chicken/Laos/Xaythiani 36/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI113318A/Shenzhen/406H/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111938A/chicken/Fujian/12239/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI111929A/goose/Guangxi/1898/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111920A/duck/Guangxi/1550/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111917A/goose/Guangxi/1458/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111722A/chicken/Fujian/584/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI111695A/chicken/Fujian/9821/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI111692A/duck/Fujian/9713/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI111689A/duck/Fujian/9651/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI111671A/duck/Hunan/5152/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111668A/duck/Hunan/5106/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111662A/chicken/Shantou/3840/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI111653A/chicken/Shantou/1233/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI111647A/duck/Shantou/13323/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00953/982 (97%)
text_code_colored.pngEPI111635A/chicken/Guiyang/29/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111614A/duck/Guangxi/392/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111605A/duck/Guangxi/150/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111575A/goose/Guangxi/4289/2005 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111533A/chicken/Hong Kong/947/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111530A/little egret/Hong Kong/718/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI111515A/magpie robin/Hong Kong/75/2006 (A/H5N1) segment 7 (MP)1653.90.000000e+00954/983 (97%)
text_code_colored.pngEPI136001A/duck/Hunan/733/2004 (A/H5N1) segment 7 (MP)1652.00.000000e+00953/982 (97%)
text_code_colored.pngEPI111716A/chicken/Fujian/11933/2005 (A/H5N1) segment 7 (MP)1652.00.000000e+00948/975 (97%)
text_code_colored.pngEPI111638A/duck/Guiyang/293/2006 (A/H5N1) segment 7 (MP)1652.00.000000e+00948/975 (97%)
text_code_colored.pngEPI690795A/goose/Jiangsu/QD5/2014 (A/H5N8) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI583875A/duck/Shaoxing/5240/2013 (A/H0) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI530992A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI500905A/Chicken/Hunan/S3003/2009 (A/H6N6) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI438178A/chicken/Thailand/l1nk/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI408139A/quail/Thanatpin/2283/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI327186A/openbill stork/Thailand/VSMU-12-BKK/2003 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI327183A/openbill stork/Thailand/VSMU-5-NSN/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI327182A/openbill stork/Thailand/VSMU-4-NSN/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI280147A/Jiangsu/2/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI280139A/Jiangsu/1/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI275673A/Thailand/WRAIR1724H/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI275665A/Thailand/WRAIR1723H/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI275657A/Thailand/WRAIR1722H/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI275649A/Thailand/WRAIR1721H/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI270191A/Vietnam/UT30850/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00951/980 (97%)
text_code_colored.pngEPI251437A/Shandong/1/2009 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI251428A/Hunan/1/2008 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI229664A/duck/Ang Thong/71 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI228352A/open-bill stork/Thailand/VSMU-9-BKK/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI222587A/scaly-breasted munia/Hong Kong/45/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI222005A/environment/Hunan/1-8/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI220533A/environment/Hunan/6-69/2008 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI180930A/chicken/Laos/33/2008 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI180906A/chicken/Laos/13/2008 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI180858A/chicken/Laos/A0464/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI180819A/chicken/Laos/P0072/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI180808A/chicken/Laos/P0001/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI174624A/duck/Hunan/3340/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI174617A/duck/Hunan/1964/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI174616A/duck/Hunan/1930/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI174611A/chicken/Henan/1362/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI174610A/chicken/Anhui/1089/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI174609A/duck/Hunan/689/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI170715A/chicken/Vietnam/202/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI170691A/duck/Vietnam/205/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI170675A/duck/Vietnam/207/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI170667A/duck/Vietnam/208/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI170623A/duck/Vietnam/215/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI168003A/little egret/Hong Kong/8863/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI167206A/chicken/Suphanburi/NIAH108192/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI164376A/goose/Yunnan/6193/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI164368A/goose/Yunnan/5979/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI164360A/goose/Yunnan/5769/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI164336A/goose/Yunnan/5141/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI164288A/duck/Yunnan/5310/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI141280A/Jiangsu/1/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI141272A/Jiangsu/2/2007 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI139583A/Ck/HK/YU22/2002 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI119147A/duck/Hunan/15/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI116590A/Thailand/SP83/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI114698A/golden pheasant/Thailand/VSMU-21-SPB/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI111935A/duck/Guangxi/2143/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI111923A/goose/Guangxi/1633/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI111908A/chicken/Guangxi/1212/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI111890A/duck/Guiyang/1081/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI111887A/goose/Guiyang/765/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI111875A/goose/Guiyang/1636/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI111869A/goose/Guiyang/1461/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI111863A/duck/Fujian/10160/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI111731A/duck/Fujian/720/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI111725A/duck/Fujian/668/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI111719A/duck/Fujian/12032/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI111710A/duck/Fujian/11094/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00952/982 (96%)
text_code_colored.pngEPI111521A/magpie robin/Hong Kong/366/2006 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI102697A/little grebe/Thailand/Phichit-01/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI100590A/duck/Hunan/149/2005 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI26407A/Chicken/Henan/16/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI26395A/chicken/Henan/01/2004 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI20568A/Ck/HK/61.9/02 (A/H5N1) segment 7 (MP)1648.30.000000e+00953/983 (96%)
text_code_colored.pngEPI135640A/silky chicken/Shantou/4071/2002 (A/H5N1) segment 7 (MP)1646.50.000000e+00952/982 (96%)
text_code_colored.pngEPI135621A/chicken/Shantou/4059/2002 (A/H5N1) segment 7 (MP)1646.50.000000e+00952/982 (96%)
text_code_colored.pngEPI135583A/quail/Shantou/3846/2002 (A/H5N1) segment 7 (MP)1646.50.000000e+00952/982 (96%)
text_code_colored.pngEPI111665A/chicken/Shantou/3923/2006 (A/H5N1) segment 7 (MP)1646.50.000000e+00949/978 (97%)
text_code_colored.pngEPI111524A/crested myna/Hong Kong/540/2006 (A/H5N1) segment 7 (MP)1646.50.000000e+00947/975 (97%)
text_code_colored.pngEPI22975A/Dk/HN/5806/2003 (A/H5N1) segment 7 (MP)1646.50.000000e+00952/982 (96%)
text_code_colored.pngEPI22879A/Gs/Thailand/79/2004 (A/H5N1) segment 7 (MP)1646.50.000000e+00952/982 (96%)
text_code_colored.pngEPI22876A/Dk/Thailand/71.1/2004 (A/H5N1) segment 7 (MP)1646.50.000000e+00952/982 (96%)
text_code_colored.pngEPI22867A/Ck/Thailand/9.1/2004 (A/H5N1) segment 7 (MP)1646.50.000000e+00952/982 (96%)
text_code_colored.pngEPI167775A/Muscovy duck/Vietnam/NCVD-46/2007 (A/H5N1) segment 7 (MP)1644.60.000000e+00949/978 (97%)
text_code_colored.pngEPI167769A/chicken/Vietnam/NCVD-45/2007 (A/H5N1) segment 7 (MP)1644.60.000000e+00949/978 (97%)
text_code_colored.pngEPI123802A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 7 (MP)1644.60.000000e+00952/983 (96%)
text_code_colored.pngEPI561504A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI509701A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI448902A/chicken/Bangladesh/3012/2011 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI406387A/chicken/Ha Tay/44/2007 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI368257A/chicken/Thailand/TS02/2006 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI368249A/duck/Thailand/TS01/2006 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI351431A/muscovy duck/Vietnam/NCVD-079/2008 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI337306A/water/Xinjiang/3/2009 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI337274A/environment/Guizhou/2/2009 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI327185A/openbill stork/Thailand/VSMU-8-BKK/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI327184A/openbill stork/Thailand/VSMU-6-BKK/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI327181A/chicken/Thailand/ICRC-7372/2010 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI327180A/chicken/Thailand/ICRC-7356/2010 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI314323A/pigeon/Thailand/VSMU-7-NPT/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI286282A/duck/Mong Cai/07-58/2007 (A/H5N1) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI280251A/water/Xinjiang/3/2009 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI276025A/duck/Jiangxi/80/2005 (A/H5N1) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI275641A/Thailand/WRAIR1720H/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI251438A/Xinjiang/1/2009 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI235899A/duck/Shanghai/xj/2002 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI228709A/duck/Chonburi/Thailand/CU-5/04 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI226906A/brown-headed gull/VSMU-28-SPK/2005 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI222876A/tree sparrow/Jiangsu/1/2008 (A/H5N1) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI221900A/duck/Hunan/3/2007 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI220372A/chicken/Thailand/ST-351/2008 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI180946A/chicken/Laos/37/2008 (A/H5N1) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI180938A/chicken/Laos/35/2008 (A/H5N1) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI180834A/duck/Laos/P0117/2007 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI175653A/duck/Hubei/Hangmei01/2006 (A/H5N1) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI174622A/chicken/Hunan/3157/2006 (A/H5N1) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI174621A/chicken/Hubei/3002/2007 (A/H5N1) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI174619A/chicken/Hubei/2856/2007 (A/H5N1) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI174618A/duck/Hunan/1994/2007 (A/H5N1) segment 7 (MP)1642.80.000000e+00951/982 (96%)
text_code_colored.pngEPI168019A/common buzzard/Hong Kong/9213/2007 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI167211A/pigeon/Thailand/VSMU-11-KRI/2005 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI167204A/chicken/Suphanburi/NIAH7540/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI167201A/chicken/Kohn Kaen/NIAH330/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI164296A/duck/Yunnan/6490/2006 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI154810A/Kalij pheasant/Thailand/vsmu-1/2008 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI152383A/Thailand/16/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI131998A/chicken/Vietnam/15/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI126168A/chicken/Thailand/ICRC-V143/2007 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI117932A/chicken/Thailand/vsmu-3-BKK/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI116605A/chicken/Laos/7191/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI116602A/chicken/Viet Nam/1/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00952/983 (96%)
text_code_colored.pngEPI116599A/Thailand/16/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI116596A/Thailand/Chaiyaphum/622/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI115362A/chicken/Thailand/2/04 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)
text_code_colored.pngEPI114712A/Tiger/Thailand/VSMU-1-SPB/2004 (A/H5N1) segment 7 (MP)1642.80.000000e+00953/984 (96%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI690781A/goose/Taiwan/TNO20/2015 (A/H5N8) segment 1 (PB2)4211.50.000000e+002280/2280 (100%)
text_code_colored.pngEPI690749A/goose/Taiwan/TNO16/2015 (A/H5N8) segment 1 (PB2)4211.50.000000e+002280/2280 (100%)
text_code_colored.pngEPI690669A/goose/Taiwan/TNO6/2015 (A/H5N8) segment 1 (PB2)4211.50.000000e+002280/2280 (100%)