Sign in to follow this  
Followers 0
niman

2015 Fujian H5N1 In Whatcom County Washington Wigeons

10 posts in this topic

USDA has released Fujian clade 2.3.4.4 H5N1 sequences from wigeons in Whatcom County Washingtopn.

Share this post


Link to post
Share on other sites
LOCUS       KU201864                1744 bp    cRNA    linear   VRL 22-DEC-2015
DEFINITION  Influenza A virus (A/American wigeon/Washington/196340/2015(H5N1))
            segment 4 hemagglutinin (HA) gene, complete cds.
ACCESSION   KU201864
VERSION     KU201864.1  GI:965568374
KEYWORDS    .
SOURCE      Influenza A virus (A/American wigeon/Washington/196340/2015(H5N1))
  ORGANISM  Influenza A virus (A/American wigeon/Washington/196340/2015(H5N1))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1744)
  AUTHORS   Killian,M.L., Ip,H.S., Griffin,K., Messer,J., McMullen,K., Dusek,R.
            and Bodenstein,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2015) Diagnostic Virology Laboratory, National
            Veterinary Services Laboratories (NVSL), USDA APHIS VS, 1920 Dayton
            Avenue, Ames, IA 50010, USA
COMMENT     GenBank Accession Numbers KU201861-KU201868 represent sequences
            from the 8 segments of Influenza A virus (A/American
            wigeon/Washington/196340/2015(H5N1)).
            
            ##Assembly-Data-START##
            Assembly Method       :: SeqMan NGen v. v4
            Sequencing Technology :: Illumina; IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1744
                     /organism="Influenza A virus (A/American
                     wigeon/Washington/196340/2015(H5N1))"
                     /mol_type="viral cRNA"
                     /strain="A/American wigeon/Washington/196340/2015"
                     /serotype="H5N1"
                     /isolation_source="oropharyngeal/cloacal swab pool from
                     individual bird"
                     /host="American wigeon; hunter harvest"
                     /db_xref="taxon:1763699"
                     /segment="4"
                     /country="USA: Whatcom County, Washington"
                     /collection_date="02-Jan-2015"
                     /note="NVSL 15-006401-3; EP2; Eurasian origin (EA-H5N8
                     clade 2.3.4.4)-North American reassortant"
     gene            17..1720
                     /gene="HA"
     CDS             17..1720
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="ALT19166.1"
                     /db_xref="GI:965568375"
                     /translation="MEKIVLLLAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
                     AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
                     NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF
                     RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
                     STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
                     DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
                     NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
                     VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
                     RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
                     EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
                     I"
     sig_peptide     17..64
                     /gene="HA"
     mat_peptide     65..1051
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1052..1717
                     /gene="HA"
                     /product="HA2"
ORIGIN      
        1 ggttcaatct gtcaaaatgg agaaaatagt gcttcttctt gcagtgatta gccttgttaa
       61 aagtgatcag atttgcattg gttaccatgc aaacaactca acaaagcagg ttgacacgat
      121 aatggagaaa aacgtcactg ttacacatgc ccaagacata ctggaaaaga cacacaacgg
      181 gaagctctgc gatcttaatg gagtgaagcc cctgattcta aaggattgta gcgtagctgg
      241 gtggctcctt ggaaatccaa tgtgcgacga gtttatcagg gtaccggaat ggtcttacat
      301 cgtggagagg gctaacccag ccaacgacct ctgttaccca gggactctca atgactatga
      361 ggaactgaaa cacctattga gcagaataaa tcattttgag aaaactctga tcatccccag
      421 gagttcttgg cccaatcacg aaacatcatt aggggtgagc gcagcatgtc cataccaggg
      481 agcatcctca tttttcagaa atgtggtatg gctcatcaaa aagaacgatg catacccgac
      541 aataaagata agctacaata ataccaatcg ggaagatctt ttgatactgt gggggattca
      601 tcattccaac aatgcagcag agcagacaaa tctttataaa aacccagaca cttatgtttc
      661 cgttgggaca tcaacattaa accagagatt ggtgccaaaa atagctacta gatcccaagt
      721 aaacgggcag agtggaagaa tggatttctt ctggacaatt ttaaaaccga atgatgcaat
      781 ccactttgag agtaatggaa atttcattgc tccagaatat gcatacaaaa ttgtcaagaa
      841 aggggactca acaattatga aaagtgaaat ggagtatggc cactgcaaca ccaaatgtca
      901 aactccaata ggggctataa actctagcat gccattccac aatatacacc ctctcaccat
      961 cggggaatgc cccaaatacg tgaagtcaaa caaattagtc cttgcgactg ggctcagaaa
     1021 tagtcctcta agagaaagaa gaagaaaaag aggactattt ggagctatag cagggtttat
     1081 agagggagga tggcagggaa tggtagacgg ttggtatggg tatcatcata gcaatgagca
     1141 ggggagtggg tacgctgcag acaaagaatc cacccaaaag gcaatagatg gagttaccaa
     1201 taaggtcaac tcaatcattg acaaaatgaa cactcaattt gaggccgttg gaagggaatt
     1261 taataactta gaaaggagaa tagagaattt aaacaagaaa atggaagacg gattcctaga
     1321 tgtctggact tataatgctg aacttttagt tctcatggaa aatgagagaa ctctagattt
     1381 ccatgactca aatgtcaaga acctttacga caaagtccga ctacagctta gggataatgc
     1441 aaaggagctg ggtaatggtt gtttcgagtt ctatcacaaa tgtgataacg aatgtatgga
     1501 gagcgtaaga aatgggacgt atgattaccc taagtattca gaagaagcaa tattaaaaag
     1561 agaagaaata agcggagtga aattagaatc aataggaact taccagatac tgtcaattta
     1621 ttcaacagtg gcgagttccc tagcactggc aatcatagtg gctggtttat ctttatggat
     1681 gtgctctaat gggtcgttac aatgcagaat ttgcatctaa atttgtgagc tcagattgta
     1741 atta

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
30743074100%0.0100%KU201864.1
30683068100%0.099%KU201856.1
30653065100%0.099%KP739421.1
30503050100%0.099%KR150901.1
30473047100%0.099%KU201744.1
30473047100%0.099%KU201752.1
30413041100%0.099%KU201872.1
30323032100%0.099%KU201608.1
30323032100%0.099%KU201632.1
30323032100%0.099%KU201640.1
30323032100%0.099%KU201648.1
30323032100%0.099%KU201728.1
30323032100%0.099%KU201736.1
30323032100%0.099%KU201784.1
30323032100%0.099%KU201832.1
30323032100%0.099%KP307976.1
30323032100%0.099%KP307957.1
30293029100%0.099%KU201656.1
30293029100%0.099%KU201696.1
30293029100%0.099%KU201704.1
30293029100%0.099%KU201808.1
30293029100%0.099%KU201816.1
30293029100%0.099%KU201848.1
30293029100%0.099%KU201880.1
30293029100%0.099%KU201888.1
30293029100%0.099%KT762932.1
30293029100%0.099%KT762956.1
30293029100%0.099%KR234038.1
30293029100%0.099%KR234030.1
30293029100%0.099%KR234014.1
30293029100%0.099%KR150909.1
30293029100%0.099%KP795729.1
30293029100%0.099%KP307984.1
30233023100%0.099%KU201616.1
30233023100%0.099%KU201672.1
30233023100%0.099%KU201688.1
30233023100%0.099%KU201760.1
30233023100%0.099%KU201776.1
30233023100%0.099%KU201800.1
30233023100%0.099%KU201896.1
30233023100%0.099%KU201912.1
30233023100%0.099%KU201920.1
30233023100%0.099%KU201928.1
30233023100%0.099%KT762908.1
30233023100%0.099%KT762948.1
30233023100%0.099%KT002473.1
30233023100%0.099%KR234022.1
30233023100%0.099%KR233990.1
30233023100%0.099%KR233998.1
30233023100%0.099%KR234006.1
30233023100%0.099%KP795737.1
30233023100%0.099%KP739397.1
30203020100%0.099%KU201624.1
30203020100%0.099%KU201664.1
30203020100%0.099%KU201680.1
30203020100%0.099%KU201712.1
30203020100%0.099%KU201720.1
30203020100%0.099%KU201936.1
30203020100%0.099%KT762892.1
30203020100%0.099%KT762916.1
30203020100%0.099%KR233982.1
30203020100%0.099%KP739381.1
30143014100%0.099%KU201768.1
30143014100%0.099%KU201792.1
30143014100%0.099%KT762924.1
30143014100%0.099%KP739389.1
30113011100%0.099%KU201840.1
30113011100%0.099%KT388572.1
30053005100%0.099%KT388700.1
30053005100%0.099%KT388692.1
30053005100%0.099%KT388684.1
30053005100%0.099%KT388652.1
30053005100%0.099%KT388644.1
30053005100%0.099%KT388636.1
30053005100%0.099%KT388612.1
30053005100%0.099%KT388556.1
30053005100%0.099%KT388548.1
30053005100%0.099%KT388532.1
30053005100%0.099%KT388516.1
30053005100%0.099%KT388500.1
30053005100%0.099%KT388492.1
30053005100%0.099%KT388484.1
30053005100%0.099%KT388452.1
30053005100%0.099%KT762900.1
30053005100%0.099%KT762940.1
30053005100%0.099%KT002489.1
30023002100%0.099%KU201824.1
30023002100%0.099%KU201904.1
30023002100%0.099%KU201943.1
30023002100%0.099%KT388660.1
30023002100%0.099%KT388628.1
30023002100%0.099%KT388604.1
30023002100%0.099%KT388540.1
30023002100%0.099%KT388508.1
30023002100%0.099%KT388460.1
30023002100%0.099%KT388444.1
30023002100%0.099%KT762884.1
30023002100%0.099%KT280932.1
30023002100%0.099%KR492974.3
30023002100%0.099%KT002505.1
29962996100%0.099%KT002481.1
29962996100%0.099%KT002513.1
29962996100%0.099%KT002521.1
29962996100%0.099%KT002528.1
29932993100%0.099%KT388708.1
29932993100%0.099%KT388676.1
29932993100%0.099%KT388668.1
29932993100%0.099%KT388620.1
29932993100%0.099%KT388596.1
29932993100%0.099%KT388580.1
29932993100%0.099%KT388564.1
29932993100%0.099%KT388524.1
29932993100%0.099%KT388476.1
29932993100%0.099%KT388468.1
29932993100%0.099%KT002497.1
29932993100%0.099%KJ509036.1
29872987100%0.099%KJ756628.1
29872987100%0.099%KJ509108.1
29842984100%0.099%KJ756636.1
29842984100%0.099%KJ756632.1
29842984100%0.099%KJ756624.1
29842984100%0.099%KJ756623.1
29842984100%0.099%KJ756621.1
29842984100%0.099%KJ756619.1
29842984100%0.099%KJ508988.1
29842984100%0.099%KJ509004.1
29842984100%0.099%KJ509028.1
29842984100%0.099%KJ509044.1
29842984100%0.099%KJ509076.1
29842984100%0.099%KJ509140.1
29782978100%0.099%KJ756629.1
29782978100%0.099%KJ756625.1
29782978100%0.099%KJ508924.1
29782978100%0.099%KJ509100.1
29782978100%0.099%KJ509116.1
29782978100%0.099%KJ509132.1
29782978100%0.099%KJ413842.1
29752975100%0.099%KJ756622.1
29752975100%0.099%KJ508948.1
29752975100%0.099%KJ508956.1
29752975100%0.099%KJ509124.1
29752975100%0.099%KJ509148.1
29752975100%0.099%KJ509164.1
29752975100%0.099%KJ511812.1
29752975100%0.099%AB932556.1
29692969100%0.099%KJ756630.1
29692969100%0.099%KJ756627.1
29692969100%0.099%KJ508980.1
29692969100%0.099%KJ509020.1
29692969100%0.099%KJ509156.1
29692969100%0.099%KJ413850.1
29662966100%0.099%KJ756620.1
29662966100%0.099%KJ508916.1
29602960100%0.099%KJ509084.1
29572957100%0.098%KJ746111.1
2890289099%0.098%KR232364.1
2884288498%0.098%KR233690.1
2883288399%0.098%KR233682.1
2845284596%0.098%KR233674.1
27942794100%0.096%KP735806.1
27942794100%0.096%JQ973694.1
27892789100%0.096%JX534565.1
27582758100%0.096%JX507355.1
27532753100%0.096%JQ041402.1
27442744100%0.096%KT383486.1
27402740100%0.096%KU042758.1
27402740100%0.096%KP286109.1
27402740100%0.096%KP286101.1
27402740100%0.096%JQ041401.1
27362736100%0.096%KP286563.1
27352735100%0.096%KT370058.1
27352735100%0.096%KP285317.1
27352735100%0.096%KP285021.1
27352735100%0.096%KP284973.1
27312731100%0.096%KU143271.1
27312731100%0.096%KT221074.1
27312731100%0.096%KU042766.1
27312731100%0.096%KT370060.1
27312731100%0.096%KP286085.1
27312731100%0.096%KP285029.1
27312731100%0.096%KP285013.1
27312731100%0.096%KP285005.1
27312731100%0.096%KP284965.1
27312731100%0.096%KM504101.1
27312731100%0.096%KJ754145.1
27312731100%0.096%KJ413834.1
27262726100%0.095%KU042754.1
27262726100%0.095%KU042753.1
27262726100%0.095%KU042764.1
27262726100%0.095%KU042765.1
27262726100%0.095%KP417067.1
27262726100%0.095%KP284989.1
27262726100%0.095%KP284957.1
2724272499%0.095%KT313418.1
27222722100%0.095%KT221066.1
27222722100%0.095%KU042756.1
27222722100%0.095%KU042757.1
27222722100%0.095%KU042769.1
27222722100%0.095%KU042770.1
27222722100%0.095%KP765796.1
27222722100%0.095%KP286666.1
27222722100%0.095%KP286548.1
27222722100%0.095%KP286093.1
27222722100%0.095%KP090447.1
27222722100%0.095%KJ508961.1
27222722100%0.095%KJ476669.1
2720272099%0.095%KT313410.1
27172717100%0.095%KT221082.1
27172717100%0.095%KU042755.1
27172717100%0.095%KP090439.1
27172717100%0.095%KJ476657.1
27132713100%0.095%KT370061.1
27132713100%0.095%KP765788.1
27132713100%0.095%KP414809.1
27132713100%0.095%KP286574.1
27132713100%0.095%CY091635.1
27082708100%0.095%KU143262.1
27082708100%0.095%KU143263.1
27082708100%0.095%KU143264.1
27082708100%0.095%KU143269.1
27082708100%0.095%KU143272.1
27082708100%0.095%KU143273.1
27082708100%0.095%KT370062.1
27082708100%0.095%KJ476670.1
27042704100%0.095%KU143261.1
27042704100%0.095%KU143265.1
27042704100%0.095%KU143266.1
27042704100%0.095%KU143270.1
27042704100%0.095%KU042749.1
27042704100%0.095%KU042760.1
27042704100%0.095%KT370063.1
27042704100%0.095%KT370059.1
27042704100%0.095%KM392383.1
27042704100%0.095%KM392382.1
27042704100%0.095%KM392381.1
27042704100%0.095%KM392376.1
27042704100%0.095%KP732547.1
27042704100%0.095%KM496970.1
2700270099%0.095%KU042750.1
26992699100%0.095%KM496965.1
26972697100%0.095%LC028331.1
26952695100%0.095%KU143267.1
26952695100%0.095%KU143268.1
26952695100%0.095%KM392378.1
26952695100%0.095%LC028307.1
26952695100%0.095%LC028200.1
26952695100%0.095%LC028192.1
26952695100%0.095%KC631941.1
26952695100%0.095%CY091627.1
26902690100%0.095%KU042768.1

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
25442544100%0.0100%KP739423.1
25352535100%0.099%KU201858.1
25352535100%0.099%KU201866.1
24752475100%0.099%KJ413479.1
24752475100%0.099%KJ413472.1
24752475100%0.099%CY185905.1
24712471100%0.099%KJ413487.1
24712471100%0.099%KJ413434.1
24662466100%0.099%KJ413420.1
24662466100%0.099%CY186650.1
2459245999%0.099%KJ413413.1
2455245599%0.099%KJ413406.1
2450245099%0.099%KJ413449.1
2450245099%0.099%KJ413392.1
24462446100%0.098%KJ413427.1
24352435100%0.098%JF323779.1
24262426100%0.098%CY045393.1
24122412100%0.098%CY097764.1
2410241097%0.099%KJ413399.1
24032403100%0.098%CY141083.1
24032403100%0.098%CY120613.1
23992399100%0.098%CY133300.1
23942394100%0.098%CY137620.1
2392239298%0.098%GQ290689.1
23902390100%0.098%CY134353.1
23852385100%0.098%CY097352.1
23812381100%0.097%CY139915.1
23812381100%0.097%CY094551.1
23762376100%0.097%CY137644.1
23762376100%0.097%CY077136.1
23762376100%0.097%CY043906.1
23722372100%0.097%CY139898.1
23722372100%0.097%CY133482.1
23672367100%0.097%CY098232.1
2365236598%0.098%GQ290681.1
2360236099%0.097%CY043922.1
23582358100%0.097%EF655838.1
23492349100%0.097%CY186693.1
23362336100%0.097%CY047021.1
23312331100%0.097%CY127768.1
23312331100%0.097%CY077120.1
23182318100%0.096%CY140247.1
23132313100%0.096%CY093991.1
23132313100%0.096%CY093649.1
23132313100%0.096%CY093625.1
23132313100%0.096%CY033358.1
23092309100%0.096%CY094527.1
23092309100%0.096%CY094415.1
23092309100%0.096%CY094407.1
23092309100%0.096%CY094223.1
23092309100%0.096%CY093967.1
23092309100%0.096%CY093641.1
23092309100%0.096%CY093617.1
23092309100%0.096%CY033430.1
23042304100%0.096%CY094559.1
23042304100%0.096%CY094455.1
23042304100%0.096%CY094087.1
23042304100%0.096%CY093943.1
23042304100%0.096%CY093872.1
23042304100%0.096%CY093848.1
23042304100%0.096%CY093832.1
23042304100%0.096%CY093792.1
23042304100%0.096%CY093736.1
23042304100%0.096%CY076663.1
23002300100%0.096%CY140755.1
23002300100%0.096%CY140713.1
23002300100%0.096%CY140601.1
23002300100%0.096%CY101235.1
23002300100%0.096%CY097520.1
23002300100%0.096%CY094543.1
23002300100%0.096%CY094495.1
23002300100%0.096%CY093856.1
23002300100%0.096%CY035851.1
23002300100%0.096%CY033406.1
23002300100%0.096%CY033398.1
23002300100%0.096%AY633214.1
22982298100%0.096%CY093816.1
2295229597%0.097%CY186574.1
22952295100%0.096%CY133163.1
22952295100%0.096%FJ686724.2
22952295100%0.096%CY097576.1
22952295100%0.096%CY094535.1
22952295100%0.096%CY076655.1
22952295100%0.096%CY076647.1
22952295100%0.096%CY039566.1
22952295100%0.096%CY032926.1
2291229198%0.097%CY186424.1
22912291100%0.096%CY141075.1
22912291100%0.096%CY132983.1
22912291100%0.096%FJ686716.2
2289228999%0.096%GU051402.1
22862286100%0.096%CY139631.1
22822282100%0.096%KF424044.1
22822282100%0.096%CY140412.1
22822282100%0.096%CY139560.1
22822282100%0.096%CY138474.1
22822282100%0.096%CY137604.1
22822282100%0.096%CY137042.1
22822282100%0.096%CY095309.1
22822282100%0.096%CY094567.1
22822282100%0.096%FJ032003.1
22822282100%0.096%EF564746.1
22772277100%0.096%CY166348.1
22772277100%0.096%CY136975.1
22772277100%0.096%CY133079.1
22772277100%0.096%GU050745.1
22772277100%0.096%AY633286.1
22772277100%0.096%CY004927.1
22732273100%0.096%CY166874.1
22732273100%0.096%KF424180.1
22732273100%0.096%CY120597.1
22732273100%0.096%GU050759.1
2271227198%0.096%CY048774.1
2269226998%0.096%GQ290692.1
2269226998%0.096%CY055126.1
22682268100%0.096%CY166899.1
22682268100%0.096%KF424052.1
22682268100%0.096%KF424108.1
22682268100%0.096%CY139651.1
22682268100%0.096%JX081140.1
22682268100%0.096%CY137612.1
22682268100%0.096%CY133887.1
22682268100%0.096%GU186787.2
22682268100%0.096%CY053327.1
22682268100%0.096%EF607898.1
22682268100%0.096%CY004509.1
2266226698%0.096%GQ290691.1
2266226697%0.096%CY048783.1
22642264100%0.096%KF424164.1
22642264100%0.096%CY139906.1
22642264100%0.096%JX081127.1
22642264100%0.096%CY137636.1
22642264100%0.096%CY133795.1
22642264100%0.096%CY132631.1
2264226498%0.096%CY054536.1
2264226498%0.096%CY048772.1
22642264100%0.096%FJ357063.1
22642264100%0.096%EF426681.1
2262226298%0.096%CY048779.1
22592259100%0.096%CY186999.1
22592259100%0.096%CY166818.1
22592259100%0.096%CY134385.1
22592259100%0.096%CY120621.1
2257225799%0.096%EF607923.1
22552255100%0.095%CY187087.1
22552255100%0.095%CY137476.1
22552255100%0.095%CY133879.1
2255225597%0.096%CY054541.1
22552255100%0.095%EF607899.1
2251225199%0.096%GU050752.1
22502250100%0.095%