Sign in to follow this  
Followers 0
niman

MERS Alpha 229E Camel Sequences from Saudi Arabia - HKU Science Paper

72 posts in this topic

LOCUS       KT368845               30116 bp    RNA     linear   VRL 17-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate
            camel/Jeddah/D92/2014, complete genome.
ACCESSION   KT368845
VERSION     KT368845.1  GI:922058076
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 30116)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Co-circulation of three camel coronavirus species and recombination
            of MERS-CoVs in Saudi Arabia
  JOURNAL   Science (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 30116)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2015) Centre of Influenza Research & State Key
            Laboratory of Emerging Infectious Diseases, The University of Hong
            Kong, Laboratory Block, 21 Sassoon Road, Pokfulam, Hong Kong SAR,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..30116
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="camel/Jeddah/D92/2014"
                     /host="camel"
                     /db_xref="taxon:1335626"
                     /country="Saudi Arabia"
                     /collection_date="Dec-2014"
     gene            279..21514
                     /gene="orf1ab"
     CDS             join(279..13433,13433..21514)
                     /gene="orf1ab"
                     /ribosomal_slippage
                     /codon_start=1
                     /product="polyprotein ORF1ab"
                     /protein_id="ALA49571.1"
                     /db_xref="GI:922058078"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVVAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVCSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVQQCCTAAVDLSMDRLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
                     RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
                     RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
                     RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
                     KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
                     DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
                     VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
                     RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
                     VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
                     EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
                     MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGVTCVIGTTKFYG
                     GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
                     LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
                     NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
                     AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
                     LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
                     YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
                     SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
                     FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
                     PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
                     ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
                     RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
                     RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
                     NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
                     PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
                     KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
                     SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
                     TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYS
                     RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
                     FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
                     MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
                     WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
                     CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
                     DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
                     VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
                     DIDYVPLKSAVCITTCNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
                     WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
                     TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
                     VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDV
                     VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
                     ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
                     AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
                     RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
                     TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
                     DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
                     TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
                     FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
                     LSVSTDVLVNTYRKLR"
     gene            279..13454
                     /gene="orf1a"
     CDS             279..13454
                     /gene="orf1a"
                     /codon_start=1
                     /product="polyprotein ORF1a"
                     /protein_id="ALA49570.1"
                     /db_xref="GI:922058077"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVVAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVCSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVQQCCTAAVDLSMDRLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
     gene            21456..25517
                     /gene="S"
     CDS             21456..25517
                     /gene="S"
                     /codon_start=1
                     /product="spike protein"
                     /protein_id="ALA49572.1"
                     /db_xref="GI:922058079"
                     /translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
                     PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
                     ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
                     MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
                     YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
                     NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
                     RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
                     PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
                     SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
                     DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
                     LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
                     VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
                     SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
                     TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
                     IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
                     QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
                     QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
                     AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
                     QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
                     SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
                     IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
                     VAPQVTYQNISTNLPPPLLSNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
                     TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
                     TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
     gene            25532..25843
                     /gene="orf3"
     CDS             25532..25843
                     /gene="orf3"
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="ALA49573.1"
                     /db_xref="GI:922058080"
                     /translation="MRVQRPPTLLLVFSLSLLVTAFSKPLYVPEHCQNYSGCMLRACI
                     KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGPTEHVTSVNLFDVGYSV
                     N"
     gene            25852..26181
                     /gene="orf4a"
     CDS             25852..26181
                     /gene="orf4a"
                     /codon_start=1
                     /product="ORF4a"
                     /protein_id="ALA49574.1"
                     /db_xref="GI:922058081"
                     /translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
                     WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
                     EEESFSN"
     gene            26093..26833
                     /gene="orf4b"
     CDS             26093..26833
                     /gene="orf4b"
                     /codon_start=1
                     /product="ORF4b"
                     /protein_id="ALA49575.1"
                     /db_xref="GI:922058082"
                     /translation="MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
                     EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
                     TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
                     PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTLNYIITMPCFRTYPQQMFVTPLA
                     VDVVSIRSSNQGNKQIVHSYPILHHPGF"
     gene            26840..27514
                     /gene="orf5"
     CDS             26840..27514
                     /gene="orf5"
                     /codon_start=1
                     /product="ORF5"
                     /protein_id="ALA49576.1"
                     /db_xref="GI:922058083"
                     /translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
                     VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
                     ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
                     CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
                     PSSLIV"
     gene            27590..27838
                     /gene="E"
     CDS             27590..27838
                     /gene="E"
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ALA49577.1"
                     /db_xref="GI:922058084"
                     /translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
                     TGLNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
     gene            27853..28512
                     /gene="M"
     CDS             27853..28512
                     /gene="M"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="ALA49578.1"
                     /db_xref="GI:922058085"
                     /translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
                     VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
                     MRTGSWWSFNPETNCLLNVPFGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
                     DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
                     A"
     gene            28566..29807
                     /gene="N"
     CDS             28566..29807
                     /gene="N"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="ALA49579.1"
                     /db_xref="GI:922058086"
                     /translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
                     TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
                     TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
                     HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGSSPGPSGIGAVGGDLLYLDL
                     LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
                     NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
                     IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVRGSI
                     TQRTRTRPSVQPGPMIDVNTD"
     gene            28762..29100
                     /gene="orf8b"
     CDS             28762..29100
                     /gene="orf8b"
                     /codon_start=1
                     /product="ORF8b"
                     /protein_id="ALA49580.1"
                     /db_xref="GI:922058087"
                     /translation="MPIPPLRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLEPDPKQ
                     HSHSGLLRMASFGSMKMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
                     IVNHLQEPLA"
ORIGIN      
        1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
       61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
      121 gtggcactaa tttgcctgct catctaggca gtggacatat gctcaacact gggtataatt
      181 ctaattgaat actatttttc agttagagcg tcgtgtctct tgtacgtctc ggtcacaata
      241 cacggtttcg tccggtgcgt ggcaattcgg ggcacatcat gtctttcgtg gctggtgtga
      301 tcgcgcaagg tgcgcgcggt acgtatcgag cagcgctcaa ctctgaaaaa catcaagacc
      361 atgtgtctct aactgtgcca ctctgtggtt caggaaacct ggttgaaaaa ctttcaccat
      421 ggttcatgga tggcgaaaat gcctatgaag tggtgaaggc catgttactt aaaaaagagc
      481 cacttctcta tgtgcccatc cggctggctg gacacactag acacctccca ggtcctcgtg
      541 tgtacctggt tgagaggctc attgcttgtg aaaatccatt catggttaac caattggctt
      601 atagctctag tgcaaatggc agcctggttg gcacaacttt gcagggcaag cctattggta
      661 tgttcttccc ttatgacatc gaacttgtca caggaaagca aaatattctc ctgcgcaagt
      721 atggccgtgg tggttatcac tacaccccat tccactatga gcgagacaac acctcttgcc
      781 ctgagtggat ggacgatttt gaggcggatc ctaaaggcaa atatgcccag aatctgctta
      841 agaagttgat tggcggtgat gtcactccag ttgaccaata catgtgtggc gttgatggaa
      901 aacccattag tgcctacgca tttttaatgg ccaaggatgg aataaccaaa ctggctgatg
      961 ttgaagcgga cgtcgcagca cgtgctgatg acgaaggctt catcacatta aagaacaatc
     1021 tatatagatt ggtttggcat gttgagcgta aagacgttcc atatcctaag caatctattt
     1081 ttactattaa tagtgtggtc caaaaggatg gtgttgaaaa cactcctcct cactatttta
     1141 ctcttggatg caaaatttta acgctcaccc cacgcaacaa gtggagtggc gtttctgact
     1201 tgtccctcaa acaaaaactc ctttacacct tctatggtaa ggagtcactt gagaacccaa
     1261 cctacattta ccactccgca ttcattgagt gtggaagttg tggtaatgat tcctggctta
     1321 cagggaatgc tatccaaggg tttgcctgtg gatgtggggc atcatataca gctaatgatg
     1381 tcgaagtcca atcatctggc atgattaagc caaatgctct tctttgtgct acttgcccct
     1441 ttgctaaggg tgacagctgt tcttctaatt gcaaacattc agttgctcag ttggttagtt
     1501 acctttctga acgctgtaat gttattgctg attctaagtc cttcacactt atctttggtg
     1561 gcgtagctta cgcctacttt ggatgtgagg aaggtactat gtactttgtg cctagagcta
     1621 agtctgttgt ctcaaggatt ggagactcca tctttacagg ctgtactggc tcttggaaca
     1681 aggtcactca aattgctaac atgttcttgg aacagactca gcattccctt aactttgtgg
     1741 gagagttcgt tgtcaacgat gttgtcctcg caattctctc tggaaccaca actaatgttg
     1801 acaaaatacg ccagcttctc aaaggtgtca ccattgacaa gttgcgtgat tatttagctg
     1861 actatgacgt agcagtcact gccggcccat tcatggataa tgctattaat gttggtggta
     1921 caggattaca gtatgccgcc attactgcac cttatgtagt tctcactggc ttaggtgagt
     1981 cctttaagaa agttgcaacc ataccgtaca aggtttgcaa ctctgttaag gatactctga
     2041 cttattatgc tcacagcgtg ttgtacagag tttttcctta tgacatggat tctggtgtgt
     2101 catcctttag tgaactactt tttgattgcg ttgatctttc agtagcttct acctattttt
     2161 tagtccgcct cttgcaagat aagactggcg actttatgtc tacaattatt acttcctgcc
     2221 aaactgctgt tagtaagctt ctagatacat gttttgaagc tacagaagca acatttaact
     2281 tcttgttaga tttggcagga ttgttcagaa tctttcttcg caatgcctat gtgtacactt
     2341 cacaagggtt tgtggtggtc aatggcaaag tttctacact tgtcaaacaa gtgttagact
     2401 tgcttaataa gggtatgcaa cttttgcata caaaggtctc ctgggctggt tctaatatca
     2461 gtgctgttat ctacagcggc agggagtctc taatattccc atcgggaacc tattactgtg
     2521 tcaccactaa ggctaagtcc gttcaacaag atcttgacgt tattttgcct ggtgagtttt
     2581 ccaagaagca gttaggactg ctccaaccta ctgacaattc tacaactgtt agtgttactg
     2641 tatccagtaa catggttgaa actgttgtgg gtcaacttga gcaaactaat atgcatagtc
     2701 ctgatgttat agtaggtgac tatgtcatta ttagtgaaaa attgtttgtg cgtagtaagg
     2761 aagaagacgg atttgccttc taccctgctt gcactaatgg tcatgctgta ccgactctct
     2821 ttagacttaa gggaggtgca cctgtaaaaa aagtagcctt tggcggtgat caagtacatg
     2881 aggttgttgc tgtaagaagt gttactgtcg agtacaacat tcatgctgta ttagacacac
     2941 tacttgcttc ttctagtctt agaacctttg ttgtagataa gtctttgtca attgaggagt
     3001 ttgctgacgt agtaaaggaa caagtctcag acttgcttgt taaattactg cgtggaatgc
     3061 cgattccaga ttttgattta gacgatttta ttgacgcacc atgctattgc tttaacgctg
     3121 agggtgatgc atcttggtct tctactatga tcttctctct tcaccccgtc gagtgtgacg
     3181 aggagtgttc tgaagtagag gcttcagatt tagaagaagg tgaatcagag tgcatttctg
     3241 agacttcaac tgaacaagtt gacgtttctc atgaggtttc tgacgacgag tgggctgctg
     3301 cagttgatga agcgttcccc ctcgatgaag cagaagatgt tactgaatct gtgcaagaag
     3361 aagcacaacc agtagaagta cctgttgaag atattgcgca ggttgtcata gctgacacct
     3421 tacaggaaac tcctgttgtg tttgatactg ttgaagtccc accgcaagtg gtgaaacttc
     3481 cgtctgaacc tcagactatc cagcccgagg taaaagaagt tgcacctgtc tatgaggctg
     3541 ataccgaaca gacacagagt gttactgtta aacctaagag gttacgcaaa aagcgtaatg
     3601 ttgacccttt gtccaatttt gaacataagg ttattacaga gtgcgttacc atagttttag
     3661 gtgacgcaat tcaagtagcc aagtgctatg gggagtctgt gttagttaat gctgctaaca
     3721 cacatcttaa gcatggcggt ggtatcgctg gtgctattaa tgcggcttca aaaggggctg
     3781 tccaaaaaga gtcagatgag tatattctgg ctaaagggcc gttacaagta ggagattcag
     3841 ttctcttgca aggccattct ctagctaaga atatcctgca tgtcgtaggc ccagatgccc
     3901 gcgctaaaca ggatgtttct ctccttagta agtgctataa ggctatgaat gcatatcctc
     3961 ttgtagtcac tcctcttgtt tcagcaggca tatttggtgt aaaaccagct gtgtcttttg
     4021 attatcttat tagagaggct aagactagag ttttagtcgt cgttaattcc caagatgtct
     4081 ataagagtct taccatagtt gacattccac agagtttgac tttttcatat gatgggttac
     4141 gtggcgcaat acgtaaagct aaagattatg gttttactgt ttttgtgtgc acagacaact
     4201 ctgctaacac taaagttctt aggaacaagg gtgttgatta tactaagaag tttcttacag
     4261 ttgacggtgt gcaatattat tgctacacgt ctaaggacac tttagatgat atcttacaac
     4321 aggctaataa gtctgttggt attatatcta tgcctttggg atatgtgtct catggtttag
     4381 acttaattca agcagggagt gtcgtgcgta gagttaacgt gccctacgtg tgtctcctag
     4441 ctaataaaga gcaagaagct attttgatgt ctgaagacgt taagttaaac ccttcagaag
     4501 attttataaa gcacgtccgc actaatggtg gttacaattc ttggcattta gtcgagggtg
     4561 aactattggt gcaagactta cgcttaaata agctcctgca ttggtctgat caaaccatat
     4621 gctacaagga tagtgtgttt tatgttgtaa agaatagtac agcttttcca tttgaaacac
     4681 tttcagcatg tcgtgcgtat ttggattcac gcacgacaca gcagttaaca atcgaagtct
     4741 tagtgactgt cgatggtgta aattttagaa cagtcgttct aaataataag aacacttata
     4801 gatcacagct tggatgcgtt ttctttaatg gtgctgatat ttctgatacc attcctgatg
     4861 agaaacagaa tggtcacagt ttatatctag cagacaattt gactgctgat gaaacaaagg
     4921 cgcttaaaga gttatatggc cccgttgatc ctactttctt acacagattc tattcactta
     4981 aggcagcagt ccataagtgg aagatggttg tgtgtgataa ggtatgttct ctcaaattga
     5041 gtgataataa ttgttatctt aatgcagtta ttatgacact tgatttattg aaggacatta
     5101 aatttgttat acctgctcta cagcatgcat ttatgaaaca taagggcggt gattcaactg
     5161 acttcatagc cctcattatg gcttatggca attgcacatt tggtgctcca gatgatgcct
     5221 ctcggttact tcacaccgtg cttgcaaagg ctgagttatg ctgttctgca cgcatggttt
     5281 ggagagagtg gtgcaatgtc tgtggcataa aagatgttgt tctacaaggc ttaagagctt
     5341 gttgttacgt gggtgtgcaa accgttgaag atctgcgtgc tcgcatgaca tatgtatgcc
     5401 agtgtggtgg tgaacgtcat cggcaaatag tcgaacacac cactccctgg ttgctgctct
     5461 caggcacacc aaatgaaaaa ttggtgacaa ccttcacggc gcctgatttt gtagcgttta
     5521 atgtctttca gggcattgaa acggctgttg gccattatgt tcatgctcgc ctgaagggtg
     5581 gtcttatttt aaagtttgac tctggcaccg ttagcaagac ttcagactgg aagtgcaagg
     5641 tgacagatgt acttttcccc ggccaaaaat acagtagcga ttgtaatgtc gtacggtatt
     5701 ctttggacgg taatttcaga acagaggttg atcccgacct atctgctttc tatgttaagg
     5761 atggtaaata ctttacaagt gaaccacccg taacatattc accagctaca attttagctg
     5821 gtagtgtcta cactaatagc tgccttgtat cgtctgatgg acaacctggc ggtgatgcta
     5881 ttagtttgag ttttaataac cttttagggt ttgattctag taaaccagtc actaagaaat
     5941 acacttactc cttcttgcct aaagaagacg gcgatgtgtt gttggctgag tttgacactt
     6001 atgaccctat ttataagaat ggtgccatgt ataaaggcaa accaattctt tgggtcaaca
     6061 aagcatctta tgatattaat cttaataagt tcaatagagc tagtttgcgt caaatttttg
     6121 acgtagcccc cattgaactc gaaaataaat tcacaccttt gagtgtggcg tctacaccag
     6181 ttgaacctcc aactgtagat gtggtagcac ttcaacagga aatgacaatt gtcaaatgta
     6241 agggtttaaa taaacctttc gtgaaggaca atgtcagttt cgttgttgat gactcaggta
     6301 ctcccgttgt tgagtatctg tctaaagaag atctacatac attgtatgta gaccctaagt
     6361 atcaagtcat tgtcttaaaa gacaatgtac tttcttctat gcttagattg cacaccgttg
     6421 agtcaggtga tattaacgtt gttgcagctt ccggatcttt gacacgtaaa gtgaagttac
     6481 tatttagggc ttcattttat ttcaaagaat ttgctacccg cactttcact gctaccactg
     6541 ctgtaggtag ttgtataaag agtgtagtgc ggcatctagg tgttactaaa ggcatattga
     6601 caggctgttt tagttttgtc aagatgttat ttatgcttcc actagcttac tttagtgatt
     6661 caaaactcgg caccacagag gttaaagtga gtgctttgaa aacagctggc gttgtgacag
     6721 gtaatgttgt acaacagtgt tgcactgctg ctgttgattt aagtatggat aggttgcgcc
     6781 gtgtggattg gaaatcaacc ctacggttgt tacttatgtt atgcacaact atggtattgt
     6841 tgtcttctgt gtatcacttg tatgtcttca atcaggtctt atcaagtgat gttatgtttg
     6901 aagatgccca aggtttgaaa aagttctaca aagaagttag agcttaccta ggaatctctt
     6961 ctgcttgtga cggtcttgct tcagcttata gggcgaattc atttgatgta cctacattct
     7021 gcgcaaaccg ttctgcaatg tgtaattggt gcttgattag ccaagattcc ataactcact
     7081 acccagctct taagatggtt caaacacatc ttagccacta tgttcttaac atagattggt
     7141 tgtggtttgc atttgagact ggtttggcat acatgctcta tacctcggcc ttcaactggt
     7201 tgttgttggc aggtacattg cattatttct ttgcacaaac ttccatattt gtagactggc
     7261 ggtcatacaa ttatgctgtg tctagtgcct tctggttatt cacccacatt ccaatggcgg
     7321 gtttggtacg aatgtataat ttgttagcat gcctttggct tttacgcaag ttttatcagc
     7381 atgtaatcaa tggttgcaaa gatacggcat gcttgctctg ctataagagg aaccgactta
     7441 ctagagttga agcttctacc gttgtctgtg gtggaaaacg tacgttttat atcacagcaa
     7501 atggcggtat ttcattctgt cgtaggcata attggaattg tgtggattgt gacattgcag
     7561 gtgtggggaa taccttcatc tgtgaagaag tcgcaaatga cctcactacc gccctacgca
     7621 ggcctattaa cgctacggat agatcacatt attatgtgga ttccgttaca gttaaagaga
     7681 ctgttgttca gtttaattat cgtagagacg gtcaaccatt ctacgagcgg tttcccctct
     7741 gcgcttttac aaatctagat aagttgaagt tcaaagaggt ctgtaaaact actactggta
     7801 tacctgaata caactttatc atctacgact catcagatcg tggccaggaa agtttagcta
     7861 ggtctgcatg tgtttattat tctcaagtct tgtgtaaatc aattcttttg gttgactcaa
     7921 gtttggttac ttctgttggt gattctagtg aaatcgccac taaaatgttt gattcctttg
     7981 ttaatagttt cgtctcgctg tataatgtca cacgcgataa gttggaaaaa cttatctcta
     8041 ctgctcgtga tggcgtaagg cgaggcgata acttccatag tgtcttaaca acattcattg
     8101 acgcagcacg aggccccgca ggtgtggagt ctgatgttga gaccaatgaa attgttgact
     8161 ctgtgcagta tgctcataaa catgacatac aaattactaa tgagagttac aataattatg
     8221 taccctcata tgttaaacct gatagtgtgt ctaccagtga tttaggtagt ctcattgatt
     8281 gtaatgcggc ttcagttaac caaattgtct tgcgtaattc taatggtgct tgtatttgga
     8341 acgctgctgc atatatgaaa ctctcggatg cacttaaacg acagattcgc attgcatgcc
     8401 gtaagtgtaa tttagctttc cggttaacca cctcaaagct acgcgctaat gataatatct
     8461 tatcagttag attcactgct aacaaaattg ttggtggtgc tcctacatgg tttaatgtgt
     8521 tgcgtgactt tacgttaaag ggttacgttc ttgctaccat tattgtgttt ctgtgtgctg
     8581 tactgatgta tttgtgttta cctacatttt ctatggtacc tgttgaattt tatgaagacc
     8641 gcatcttgga ctttaaagtt cttgataatg gtatcattag ggatgtaaat cctgatgata
     8701 agtgctttgc taataagcac cggtccttca cacaatggta tcatgagcat gttggtggtg
     8761 tctatgacaa ctctatcaca tgcccattga cagttgcagt aattgctgga gttgctggtg
     8821 ctcgcattcc agacgtacct actacattgg cttgggtgaa caatcagata attttctttg
     8881 tttctcgagt ctttgctaat acaggcagtg tttgctacac tcctatagat gagataccct
     8941 ataagagttt ctctgatagt ggttgcattc ttccatctga gtgcactatg tttagggatg
     9001 cagagggccg tatgacacca tactgccatg atcctactgt tttgcctggg gcttttgcgt
     9061 acagtcagat gaggcctcat gttcgttacg acttgtatga tggtaacatg tttattaaat
     9121 ttcctgaagt agtatttgaa agtacactta ggattactag aactctgtca actcagtact
     9181 gccggttcgg tagttgtgag tatgcacaag agggtgtttg tattaccaca aatggctcgt
     9241 gggccatttt taatgaccac catcttaata gacctggtgt ctattgtggt tctgatttta
     9301 ttgacattgt caggcggtta gcagtatcac tgttccagcc tattacttat ttccaattga
     9361 ctacctcatt ggtcttgggt ataggtttgt gtgcattcct gactttgctc ttttattata
     9421 ttaataaagt aaaacgtgct tttgcagatt acacccagtg tgctgtaatt gctgttgttg
     9481 ctgctgttct taatagcttg tgcatctgct ttgttgcctc tataccattg tgtatagtac
     9541 cttacactgc attgtactat tatgctacat tctattttac taatgagcct gcatttatta
     9601 tgcatgtttc ttggtacatt atgttcgggc ctatcgttcc catatggatg acctgcgtct
     9661 atacagttgc aatgtgcttt agacacttct tctgggtttt agcttatttt agtaagaaac
     9721 atgtagaagt ttttactgat ggtaagctta attgtagttt ccaggacgct gcctctaata
     9781 tctttgttat taacaaggac acttatgcag ctcttagaaa ctctttaact aatgatgcct
     9841 attcacgatt tttggggttg tttaacaagt ataagtactt ctctggtgct atggaaacag
     9901 ccgcttatcg tgaagctgca gcatgtcatc ttgctaaagc cttacaaaca tacagcgaga
     9961 ctggtagtga tcttctttac caaccaccca actgtagcat aacctctggc gtgttgcaaa
    10021 gcggtttggt gaaaatgtca catcccagtg gagatgttga ggcttgtatg gttcaggtta
    10081 cctgcggtag catgactctt aatggtcttt ggcttgacaa cacagtctgg tgcccacgac
    10141 acgtaatgtg cccggctgac cagttgtctg atcctaatta tgatgccttg ttgatttcta
    10201 tgactaatca tagtttcagt gtgcaaaaac acattggcgc tccagcaaac ttgcgtgttg
    10261 ttggtcatgc catgcaaggc actcttttga agttgactgt cgatgttgct aaccctagca
    10321 ctccagccta cacttttaca acagtgaaac ctggcgcagc atttagtgtg ttagcatgct
    10381 ataatggtcg tccgactggt acattcactg ttgtaatgcg ccctaactac acaattaagg
    10441 gttcctttct gtgtggttct tgtggtagtg ttggttacac caaggagggt agtgtgatca
    10501 atttttgtta catgcatcaa atggaacttg ctaatggtac acataccggt tcagcatttg
    10561 atggtactat gtatggtgcc tttatggata aacaagtgca ccaagttcag ttaacagaca
    10621 aatactgcag tgttaatgta gtagcttggc tttacgcagc aatacttaat ggttgcgctt
    10681 ggtttgtaaa acctaatcgc actagtgttg tttcttttaa tgaatgggct cttgccaacc
    10741 aattcactga atttgttggc actcaatccg ttgacatgtt agctgtcaaa acaggcgttg
    10801 ctattgaaca gctgctttat gcgatccaac aactttatac tgggttccag ggaaagcaaa
    10861 tccttggcag tactatgttg gaagatgaat tcacacctga ggatgttaat atgcagatta
    10921 tgggtgtggt tatgcagagt ggtgtgagaa aagttacata tggtactgcg cattggttgt
    10981 tcgcgaccct tgtctcaacc tatgtgataa tcttacaagc cactaaattt actttgtgga
    11041 actacttgtt tgagactatt cccacacagt tgttcccact cttatttgtg actatggcct
    11101 tcgttatgtt gttggttaaa cacaaacaca cctttttgac acttttcttg ttgcctgtgg
    11161 ctatttgttt gacttatgca aacatagtct acgagcccac tactcccatt tcgtcagcgc
    11221 tgattgcagt tgcaaattgg cttgccccca ctaatgctta tatgcgcact acacatactg
    11281 atattggtgt ctacattagt atgtcacttg tattagtcat tgtagtgaag agattgtaca
    11341 acccatcact ttctaacttt gcgttagcat tgtgcagtgg tgtaatgtgg ttgtacactt
    11401 atagcattgg agaagcctca agccccattg cctatctggt ttttgtcact acactcacta
    11461 gtgattatac gattacagtc tttgttactg tcaaccttgc aaaagtttgc acttatgcca
    11521 tctttgctta ctcaccacag cttacacttg tgtttccgga agtgaagatg atacttttat
    11581 tatacacatg tttaggtttc atgtgtactt gctattttgg tgtcttctct cttttgaacc
    11641 ttaagcttag agcacctatg ggtgtctatg actttaaggt ctcaacacaa gagttcagat
    11701 tcatgactgc taacaatcta actgcaccta gaaattcttg ggaggctatg gctctgaact
    11761 ttaagttaat aggtattggc ggtacacctt gtataaaggt tgctgctatg cagtctaaac
    11821 ttacagatct taaatgcaca tctgtggttc tcctctctgt gctccaacag ttacacttag
    11881 aggctaatag tagggcctgg gctttctgtg ttaaatgcca taatgatata ttggcagcaa
    11941 cagaccccag tgaggctttc gagaaattcg taagtctctt tgccacttta atgacttttt
    12001 ctggtaatgt agatcttgat gcgttagcta gtgatatttt tgacactcct agcgtacttc
    12061 aagctactct ttctgagttt tcacacttag ctacctttgc tgagttggaa gctgcgcaga
    12121 aagcctatca ggaagctatg gactctggtg acacctcacc acaagttctt aaggctttgc
    12181 agaaggctgt taatatagct aaaaacgcct atgagaagga taaggcagtg gcccgtaagt
    12241 tagaacgtat ggctgatcag gctatgactt ctatgtataa gcaagcacgt gctgaagaca
    12301 agaaagcaaa aattgtcagt gctatgcaaa ctatgttgtt tggtatgatt aagaagctcg
    12361 acaacgatgt tcttaatggt atcatttcta acgctaggaa tggttgtata cctcttagtg
    12421 tcattccact gtgtgcttca aataaacttc gcgttgtaat tcctgacttc accgtctgga
    12481 atcaggtagt cacatatccc tcgcttaact acgctggggc tttgtgggac attacagtta
    12541 taaacaatgt ggacaatgaa attgttaagt cttcagatgt tgtagacagc aatgaaaatt
    12601 taacatggcc acttgtttta gaatgcacta gggcatccac ttctgccgtt aagttgcaaa
    12661 ataatgagat caaaccttca ggtttaaaaa ccatggttgt gtctgcaggt caagagcaaa
    12721 ctaactgtaa tactagttcc ttagcttatt acgaacctgt gcagggtcgt aaaatgctga
    12781 tggctcttct ttctgataat gcctatctca aatgggcgcg tgttgaaggt aaggacggat
    12841 ttgttagtgt agagctacaa cctccttgca aattcttgat tgcgggacca aaaggacctg
    12901 aaatccgata tctctatttt gttaaaaatc ttaacaacct tcatcgcggg caagtgttag
    12961 ggcacattgc tgcgactgtt agattgcaag ctggttctaa caccgagttt gcctctaatt
    13021 cttcggtgtt gtcacttgtt aacttcaccg ttgatcctca aaaagcttat ctcgatttcg
    13081 tcaatgcggg aggtgcccca ttgacaaatt gtgttaagat gcttactcct aaaactggta
    13141 caggtatagc tatatctgtt aaaccagaga gtacagctga tcaagagact tatggtggag
    13201 cttcagtgtg tctctattgc cgtgcgcata tagaacatcc tgatgtctct ggtgtttgta
    13261 aatataaggg taagtttgtc caaatccctg ctcagtgtgt ccgtgaccct gtgggatttt
    13321 gtttgtcaaa taccccctgt aatgtctgtc aatattggat tggatatggg tgcaattgtg
    13381 actcgcttag gcaagtagca ctgccccaat ctaaagattc caatttttta aacgagtccg
    13441 gggttctatt gtaaatgccc gaatagaacc ctgttcaagt ggtttgtcca ctgatgtcgt
    13501 ctttagggca tttgacatct gcaactataa ggctaaggtt gctggtattg gaaaatacta
    13561 caagactaat acttgtaggt ttgtagaatt agatgaccaa gggcatcatt tagactccta
    13621 ttttgtcgtt aagaggcata ctatggagaa ttatgaacta gagaagcact gttacgattt
    13681 gttacgtgac tgtgatgctg tagctcccca tgatttcttc atctttgatg tagacaaagt
    13741 taaaacacct catattgtac gtcagcgttt aactgagtac actatgatgg atcttgtata
    13801 tgccctgagg cactttgatc aaaatagcga agtgcttaag gctatcttag tgaagtatgg
    13861 ttgctgtgat gttacctact ttgaaaataa actctggttt gattttgttg aaaatcccag
    13921 tgttattggt gtttatcata aacttggaga acgtgtacgc caagctatct taaacactgt
    13981 taaattttgt gaccacatgg tcaaggctgg tttagtcggt gtgctcacac tagacaacca
    14041 ggaccttaat ggcaagtggt atgattttgg tgacttcgta atcactcaac ctggttcagg
    14101 agtagctata gttgatagct actattctta tttgatgcct gtgctctcaa tgaccgattg
    14161 tctggccgct gagacacata gggattgtga ttttaataaa ccactcattg agtggccact
    14221 tactgagtat gattttactg attataaggt acaactcttt gagaagtact ttaaatattg
    14281 ggatcagacg tatcacgcaa attgcgttaa ttgtactgat gaccgttgtg tgttacattg
    14341 tgctaatttc aatgtattgt ttgctatgac catgcctaag acttgtttcg gacccatagt
    14401 ccgaaagatc tttgttgatg gcgtgccatt tgtagtatct tgtggttatc actacaaaga
    14461 attaggttta gtcatgaata tggatgttag tctccataga cataggctct ctcttaagga
    14521 gttgatgatg tatgccgctg atccagccat gcacattgcc tcctctaacg cttttcttga
    14581 tttgaggaca tcatgtttta gtgtcgctgc acttacaact ggtttgactt ttcaaactgt
    14641 gcggcctggc aattttaacc aagacttcta tgatttcgtg gtatctaaag gtttctttaa
    14701 ggagggctct tcagttacgc tcaaacattt tttctttgct caagatggta atgctgctat
    14761 tacagattat aattactatt cttataatct gcctactatg tgtgacatca aacaaatgtt
    14821 gttctgcatg gaagttgtaa acaagtactt cgaaatctat gacggtggtt gtcttaatgc
    14881 ttctgaagtg gttgttaata atttagacaa gagtgctggc catcctttta ataagtttgg
    14941 caaagctcgt gtctattatg agagcatgtc ttaccaggag caagatgaac tctttgccat
    15001 gacaaagcgt aacgtcattc ctaccatgac tcaaatgaat ctaaaatatg ctattagtgc
    15061 taagaataga gctcgcactg ttgcaggcgt gtccatactt agcacaatga ctaatcgtca
    15121 gtaccatcag aaaatgctta agtccatggc tgcaactcgt ggagtgactt gcgtcattgg
    15181 tactacaaag ttctatggtg gctgggattt catgcttaaa acattgtaca aagatgttga
    15241 taatccgcat cttatgggtt gggattaccc taagtgtgat agagctatgc ctaatatgtg
    15301 tagaatcttt gcttcactca tattagctcg taaacatggc acttgttgta ctacaaggga
    15361 cagattttat cgcttggcaa atgagtgtgc tcaggtgcta agcgaatatg ttctatgtgg
    15421 tggtggttac tacgtcaaac ctggaggtac cagtagcgga gacgccacca ctgcatatgc
    15481 caatagtgtc tttaacattt tgcaggcgac aactgctaat gtcagtgcac ttatgggtgc
    15541 taatggcaac aagattgttg acaaagaagt taaagacatg cagtttgatt tgtatgtcaa
    15601 tgtttacagg agcactagcc cagaccccaa atttgttgat aaatactatg cttttcttaa
    15661 taagcacttt tctatgatga tactgtctga tgacggtgtc gtttgctata atagtgatta
    15721 tgcagctaag ggttacattg ctggaataca gaattttaag gaaacgctgt attatcagaa
    15781 caatgtcttt atgtctgaag ctaaatgctg ggtggaaacc gatctgaaga aagggccaca
    15841 tgaattctgt tcacagcata cgctttatat taaggatggc gacgatggtt acttccttcc
    15901 ttatccagac ccttcaagaa ttttgtctgc cggttgcttt gtagatgata tcgttaagac
    15961 tgacggtaca ctcatggtag agcggtttgt gtctttggct atagatgctt accctctcac
    16021 aaagcatgaa gatatagaat accagaatgt attctgggtc tacttacagt atatagaaaa
    16081 actgtataaa gaccttacag gacacatgct tgacagttat tctgtcatgc tatgtggtga
    16141 taattctgct aagttttggg aagaggcatt ctatagagat ctctatagtt cgcctaccac
    16201 tttgcaggct gtcggttcat gcgttgtatg ccattcacag acttccctac gctgtgggac
    16261 atgcatccgt agaccatttc tctgctgtaa atgctgctat gatcatgtta tagcaactcc
    16321 acataagatg gttttgtctg tttctcctta cgtttgtaat gcccctggtt gtggcgtttc
    16381 agacgttact aagctatatt taggtggtat gagctacttt tgtgtagatc atagacctgt
    16441 gtgtagtttt ccactttgcg ctaatggtct tgtattcggc ttatacaaga atatgtgcac
    16501 aggtagtcct tctatagttg aatttaatag gttggctacc tgtgactgga ctgaaagtgg
    16561 tgattacacc cttgccaata ctacaacaga accactcaaa ctttttgctg ctgagacttt
    16621 acgtgccact gaagaggcgt ctaagcagtc ttatgctatt gccaccatca aagaaattgt
    16681 tggtgagcgc caactattac ttgtgtggga ggctggcaag tccaaaccac cactcaatcg
    16741 taattatgtt tttactggtt atcatataac caaaaatagt aaagtgcagc tcggtgagta
    16801 catcttcgag cgcattgatt atagtgatgc tgtatcctac aagtctagta caacgtataa
    16861 actgactgta ggtgacatct tcgtacttac ctcccactct gtggctacct tgacggcgcc
    16921 cacaattgtg aatcaagaga ggtatgttaa aattactggg ttgtacccaa ccattacggt
    16981 acctgaagag ttcgcaagtc atgttgccaa cttccaaaaa tcaggttata gtaaatatgt
    17041 cactgttcag ggaccacctg gcactggcaa aagtcatttt gctatagggt tagcgattta
    17101 ctaccctaca gcacgtgttg tttatacagc atgttcacac gcagctgttg atgctttgtg
    17161 tgaaaaagct tttaaatatt tgaacattgc taaatgttcc cgtatcattc ctgcaaaggc
    17221 acgtgttgag tgctatgaca ggtttaaagt taatgagaca aattctcaat atttgtttag
    17281 tactattaat gctctaccag aaacttctgc cgatattctg gtggttgatg aggttagtat
    17341 gtgcactaat tatgatcttt caattattaa tgcacgtatt aaagctaagc acattgtcta
    17401 tgtaggagat ccagcacagt tgccagctcc taggactttg ttgactagag gcacattgga
    17461 accagaaaat ttcaatagtg tcactagatt gatgtgtaac ttaggtcctg acatattttt
    17521 aagtatgtgc tacaggtgtc ctaaggaaat agtaagcact gtgagcgctc ttgtctacaa
    17581 taataaattg ttagccaaga aggagctttc aggccagtgc tttaaaatac tctataaggg
    17641 caatgtgacg catgatgcta gctctgccat taatagacca caactcacat ttgtgaagaa
    17701 ttttattact gccaatccgg catggagtaa ggcagtcttt atttcgcctt ataattcaca
    17761 gaatgctgtg gctcgttcaa tgctgggcct tactactcag actgttgatt cctcacaggg
    17821 ttcagaatac cagtacgtta tcttctgtca aacagcagat acggcacatg ctaacaacat
    17881 taacagattt aatgttgcaa tcactcgtgc ccaaaaaggt attctttgtg ttatgacatc
    17941 tcaggcactc tttgagtcct tagagtttac tgaattgtct tttactaatt acaagctcca
    18001 gtctcagatt gtaactggcc tttttaaaga ttgctctaga gaaacttctg gcctctcacc
    18061 tgcttatgca ccaacatacg ttagtgttga tgacaagtat aagacgagtg atgagctttg
    18121 cgtgaatctt aatttacccg caaatgtccc atactctcgt gttatttcca ggatgggctt
    18181 taaactcgat gcaacagttc ctggatatcc taagcttttc attactcgtg aagaggctgt
    18241 aaggcaagtt cgaagctgga taggcttcga tgttgagggt gctcatgctt cccgtaatgc
    18301 atgtggcacc aatgtgcctc tacaattagg attttcaact ggtgtgaact ttgttgttca
    18361 gccagttggt gttgtagaca ctgagtgggg taacatgtta acgggcattg ctgcccgtcc
    18421 tccaccaggt gaacagttta agcacctcgt gcctcttatg cataaggggg ctgcatggcc
    18481 tattgttaga cgacgtatag tgcaaatgtt gtcagacact ttagacaaat tgtctgatta
    18541 ctgtacgttt gtttgttggg ctcatggctt tgaattaacg tctgcatcat acttttgcaa
    18601 gataggtaag gaacagaagt gttgcatgtg caatagacgc gctgcagcgt actcttcacc
    18661 tctgcaatct tatgcctgtt ggactcattc ctgcggttat gattatgtct acaacccttt
    18721 ctttgtcgat gttcaacagt ggggttatgt aggcaatctt gctactaatc acgatcgtta
    18781 ttgctctgtc catcaaggag ctcatgtggc ttctaatgat gcaataatga ctcgttgttt
    18841 agctattcat tcttgtttta tagaacgtgt ggattgggat atagagtatc cttatatctc
    18901 acatgaaaag aaattgaatt cctgttgtag aatcgttgag cgcaacgtcg tacgtgctgc
    18961 tcttcttgcc ggttcatttg acaaagtcta tgatattggc aatcctaaag gaattcctat
    19021 tgttgatgac cctgttgttg attggcatta ttttgatgca cagcccttga ccaggaaggt
    19081 acaacagctt ttctatacag aggacatggc ctcaagattt gctgatgggc tctgcttatt
    19141 ttggaactgt aatgtaccaa aatatcctaa taatgcaatt gtatgcaggt ttgacacacg
    19201 tgtgcattct gagttcaatt tgccaggttg tgatggcggt agtttgtatg ttaacaagca
    19261 cgcttttcat acaccagcat atgatgtgag tgcattccgt gatctgaaac ctttaccatt
    19321 cttttattat tctactacac catgtgaagt gcatggtaat ggtagtatga tagaggatat
    19381 tgattatgta cccctaaaat ctgcagtctg tattacaact tgtaatttag ggggcgctgt
    19441 ttgtaggaag catgctacag agtacagaga gtatatggaa gcatataatc ttgtctctgc
    19501 atcaggtttc cgcctttggt gttataagac ctttgatatt tataatctct ggtctacttt
    19561 tacaaaagtt caaggtttgg aaaacattgc ttttaatgtt gttaaacaag gccattttat
    19621 tggtgttgag ggtgaactac ctgtagctgt agtcaatgat aagatcttca ccaagagtgg
    19681 cgttaatgac atttgtatgt ttgagaataa aaccactttg cctactaata tagcttttga
    19741 actctatgct aagcgtgctg tacgctcgca tcccgatttc aaattgctac acaatttaca
    19801 agcagacatt tgctacaagt tcgtcctttg ggattatgaa cgtagcaata tttatggtac
    19861 tgctactatt ggtgtatgta agtacactga tattgatgtt aattcagctt tgaatatatg
    19921 ttttgacata cgcgataatg gttcattgga gaagttcatg tctactccca atgccatctt
    19981 tatttctgat agaaaaatca agaaataccc ttgtatggta ggtcctgatt atgcttactt
    20041 caatggtgct atcatccgtg atagtgatgt tgttaaacaa ccagtgaagt tctacttgta
    20101 taagaaagtc aataatgagt ttattgatcc tactgagtgt atttacactc agagtcgctc
    20161 ttgtagtgac ttcctacccc tgtctgacat ggagaaagac tttctatctt ttgatagtga
    20221 tgttttcatt aagaagtatg gcttggaaaa ctatgctttt gagcacgtag tctatggaga
    20281 cttctctcat actacgttag gcggtcttca cttgcttatt ggtttataca agaagcaaca
    20341 ggaaggtcat attattatgg aagaaatgct aaaaggtagc tcaactattc ataactattt
    20401 tattactgag actaacacag cggcttttaa ggcggtgtgt tctgttatag atttaaagct
    20461 tgacgacttt gttatgattt taaagagtca agaccttggc gtagtatcca aggttgtcaa
    20521 ggttcctatt gacttaacaa tgattgagtt tatgttatgg tgtaaggatg gacaggttca
    20581 aaccttctac cctcgactcc aggcttctgc agattggaaa cctggtcatg caatgccatc
    20641 cctctttaaa gttcaaaatg taaaccttga acgttgtgag cttgctaatt acaagcaatc
    20701 tattcctatg cctcgcggtg tgcacatgaa catcgctaaa tatatgcaat tgtgccagta
    20761 tttaaatact tgcacattag ccgtgcctgc caatatgcgt gttatacatt ttggcgctgg
    20821 ttctgataaa ggtatcgctc ctggtacatc agttttacga cagtggcttc ctacagatgc
    20881 cattattata gataatgatt taaatgagtt cgtgtcagat gctgacataa ctttatttgg
    20941 agattgtgta actgtacgtg tcggccaaca agtggatctt gttatttccg acatgtatga
    21001 tcctactact aagaatgtaa caggtagtaa tgagtcaaag gctttattct ttacttacct
    21061 gtgtaacctc attaataata atcttgctct tggtggttct gttgctatta aaataacaga
    21121 acactcttgg agcgttgaac tttatgaact tatgggaaaa tttgcttggt ggactgtttt
    21181 ctgcaccaat gcaaatgcat cctcatctga aggattcctt ttaggtatta attacttggg
    21241 tactattaaa gaaaatatag atggtggtgc tatgcacgcc aactatatat tttggagaaa
    21301 ttccactcct atgaatctga gtacttactc actttttgat ttatccaagt ttcaattaaa
    21361 attaaaagga acaccagttc ttcaattaaa ggagagtcaa attaacgaac tcgtaatatc
    21421 tctcctgtcg cagggtaagt tacttatccg tgacaatgat acactcagtg tttctactga
    21481 tgttcttgtt aacacctaca gaaagttacg ttgatgtagg gccagattct gttaagtctg
    21541 cttgtattga ggttgatata caacagacct tctttgataa aacttggcct aggccaattg
    21601 atgtttctaa ggctgacggt attatatacc ctcaaggccg tacatattct aacataacta
    21661 tcacttatca aggtcttttt ccctatcagg gagaccatgg tgatatgtat gtttactctg
    21721 caggacatgc tacaggcaca actccacaaa agttgtttgt agctaactat tctcaggacg
    21781 tcaaacagtt tgctaatggg tttgtcgtcc gtataggagc agctgccaat tccactggca
    21841 ctgttattat tagcccatct accagcgcta ctatacgaaa aatttaccct gcttttatgc
    21901 tgggttcttc agttggtaat ttctcagatg gtaaaatggg ccgcttcttc aatcatactc
    21961 tagttctttt gcccgatgga tgtggcactt tacttagagc tttttattgt attctagagc
    22021 ctcgctctgg aaatcattgt cctgctggca attcctatac ttcttttgcc acttatcaca
    22081 ctcctgcaac agattgttct gatggcaatt acaatcgtaa tgccagtctg aactctttta
    22141 aggagtattt taatttacgt aactgcacct ttatgtacac ttataacatt accgaagatg
    22201 agattttaga gtggtttggc attacacaaa ctgctcaagg tgttcacctc ttctcatctc
    22261 ggtatgttga tttgtacggc ggcaatatgt ttcaatttgc caccttgcct gtttatgata
    22321 ctattaagta ttattctatc attcctcaca gtattcgttc tatccaaagt gatagaaaag
    22381 cttgggctgc cttctacgta tataaacttc aaccgttaac tttcctgttg gatttttctg
    22441 ttgatggtta tatacgcaga gctatagact gtggttttaa tgatttgtca caactccact
    22501 gctcatatga atccttcgat gttgaatctg gagtttattc agtttcgtct ttcgaagcaa
    22561 aaccttctgg ctcagttgtg gaacaggctg aaggtgttga atgtgatttt tcacctcttc
    22621 tgtctggcac acctcctcag gtttataatt tcaagcgttt ggtttttacc aattgcaatt
    22681 ataatcttac caaattgctt tcactttttt ctgtgaatga ttttacttgt agtcaaatat
    22741 ctccagcagc aattgctagc aactgttatt cttcactgat tttggattat ttttcatacc
    22801 cacttagtat gaaatccgat ctcagtgtta gttctgctgg tccaatatcc cagtttaatt
    22861 ataaacagtc cttttctaat cccacatgtt tgatcttagc gactgttcct cataacctta
    22921 ctactattac taagcctctt aagtacagct atattaacaa gtgctctcgt cttctttctg
    22981 atgatcgtac tgaagtacct cagttagtga acgctaatca atactcaccc tgtgtatcca
    23041 ttgttccatc cactgtgtgg gaagacggtg attattatag gaaacaacta tctccacttg
    23101 aaggtggtgg ctggcttgtt gctagtggct caactgttgc catgactgag caattacaga
    23161 tgggctttgg tattacagtt caatatggta cagacaccaa tagtgtttgc cccaagcttg
    23221 aatttgctaa tgacacaaaa attgcctctc aattaggcaa ttgcgtggaa tattccctct
    23281 atggtgtttc gggccgtggt gtttttcaga attgcacagc tgtaggtgtt cgacagcagc
    23341 gctttgttta tgatgcgtac cagaatttag ttggctatta ttctgatgat ggcaactact
    23401 actgtctgcg tgcttgtgtt agtgttcctg tttctgtcat ctatgataaa gaaactaaaa
    23461 cccacgctac tctatttggt agtgttgcat gtgaacacat ttcttctacc atgtctcaat
    23521 actcccgttc tacgcgatca atgcttaaac ggcgagattc tacatatggc ccccttcaga
    23581 cacctgttgg ttgtgtccta ggacttgtta attcctcttt gttcgtagag gactgcaagt
    23641 tgcctctcgg tcaatctctc tgtgctcttc ctgacacacc tagtactctc acacctcgca
    23701 gtgtgcgctc tgtgccaggt gaaatgcgct tggcatccat tgcttttaat catcccattc
    23761 aggttgatca acttaatagt agttatttta aattaagtat acccactaat ttttcctttg
    23821 gtgtgactca ggagtacatt cagacaacca ttcagaaagt tactgttgat tgtaaacagt
    23881 acgtttgcaa tggtttccag aagtgtgagc aattactgcg cgagtatggc cagttttgtt
    23941 ccaaaataaa ccaggctctc catggtgcca atttacgcca ggatgattct gtacgtaatt
    24001 tgtttgcgag cgtgaaaagc tctcaatcat ctcctatcat accaggtttt ggaggtgact
    24061 ttaatttgac acttctagaa cctgtttcta tatctactgg cagtcgtagt gcacgtagtg
    24121 ctattgagga tttgctattt gacaaagtca ctatagctga tcctggttat atgcaaggtt
    24181 acgatgattg tatgcagcaa ggtccagcat cagctcgtga tcttatttgt gctcaatatg
    24241 tggctggtta taaagtatta cctcctctta tggatgttaa tatggaagcc gcgtatactt
    24301 catctttgct tggcagcata gcaggtgttg gctggactgc tggcttatcc tcctttgctg
    24361 ctattccatt tgcacagagt attttttata ggttaaacgg tgttggcatt actcaacagg
    24421 ttctttcaga gaaccaaaag cttattgcca ataagtttaa tcaggctctg ggagctatgc
    24481 aaacaggctt cactacaact aatgaagctt ttcggaaggt tcaggatgct gtgaacaaca
    24541 atgcacaggc tctatccaaa ttagctagcg agctatctaa tacttttggt gctatttccg
    24601 cctctattgg agacatcata caacgtcttg atgttctcga acaggacgcc caaatagaca
    24661 gacttattaa tggccgtttg acaacactaa atgcttttgt tgcacagcag cttgttcgtt
    24721 ccgaatcagc tgctctttcc gctcaattgg ctaaagataa agtcaatgag tgtgtcaagg
    24781 cacaatccaa gcgttctgga ttttgcggtc aaggcacaca tatagtgtcc tttgttgtaa
    24841 atgcccctaa tggcctttac tttatgcatg ttggttatta ccctagcaac cacattgagg
    24901 ttgtttctgc ttatggtctt tgcgatgcag ctaaccctac taattgtata gcccctgtta
    24961 atggctactt tattaaaact aataacacta ggattgttga tgagtggtca tatactggct
    25021 cgtccttcta tgcacctgag cccatcacct ctcttaatac taagtatgtt gcaccacagg
    25081 tgacatacca aaacatttct actaacctcc ctcctcctct tctcagcaat tccaccggga
    25141 ttgacttcca agatgagttg gatgagtttt tcaaaaatgt tagcaccagt atacctaatt
    25201 ttggttctct aacacagatt aatactacat tactcgatct tacctacgag atgttgtctc
    25261 ttcaacaagt tgttaaagcc cttaatgagt cttatataga ccttaaagag cttggcaatt
    25321 atacttatta caacaaatgg ccgtggtaca tttggcttgg tttcattgct gggcttgttg
    25381 ccttagctct atgcgtcttc ttcatactgt gctgcactgg ttgtggcaca aactgtatgg
    25441 gaaaacttaa gtgtaatcgt tgttgtgata gatacgagga atacgacctc gagccgcata
    25501 aggttcatgt tcactaatta acgaactatc aatgagagtt caaagaccac ccactctctt
    25561 gttagtgttc tcactctctc ttttggtcac tgcattttca aaacctctct atgtacccga
    25621 gcattgtcag aattattctg gttgcatgct tagggcttgt attaaaactg cccaagctga
    25681 tacagctggt ctttatacaa attttcgaat tgacgtccca tctgcagaat caactggtac
    25741 tcaatcagtt tctgtcgatc gtgagtcaac ttcaactcat gatggtccta ccgaacatgt
    25801 tactagtgtg aatctttttg acgttggtta ctcagttaat taacgaactc tatggattac
    25861 gtgtctctgc ttaatcaaat ttggcagaag taccttaatt caccgtatac tacttgtttg
    25921 tatatcccta aacccacagc taagtataca cctttagttg gcacttcatt gcaccctgtg
    25981 ctgtggaact gtcagctatc ctttgctggt tatactgaat ctgctgttaa ttctacaaaa
    26041 gctttggcca aacaggacgc agctcagcga atcgcttggt tgctacataa ggatggagga
    26101 atccctgatg gatgttccct ctacctccgg cactcaagtt tattcgcgca aagcgaggaa
    26161 gaggagtcat tctccaacta agaaactgcg ctacgttaag cgtagatttt ctcttctgcg
    26221 ccctgaagac cttagtgtta ttgtccaacc aacacactat gtcagggtta cattttcaga
    26281 ccccaacatg tggtatctac gttcgggtca tcatttacac tcagttcaca attggcttaa
    26341 accttatggc ggccaacctg tttctgagta ccatattact ctagctttgc taaatctcac
    26401 tgatgaagat ttagctagag atttttcacc cattgcgctc tttttgcgca atgtcagatt
    26461 tgagctacat gagttcgcct tgctgcgcaa aactcttgtt cttaatgcat cagagatcta
    26521 ctgtgctaac atacatagat ttaagcctgt gtatagagtt aacacggcaa tccctactat
    26581 taaggattgg cttctcgttc agggattttc cctttaccat agtggcctcc ctttacatat
    26641 gtcaatctct aaattgcatg cactggatga tgttactctc aattacatca ttacaatgcc
    26701 atgctttaga acttatcctc aacaaatgtt tgttactcct ttggccgtag atgttgtctc
    26761 catacggtct tccaatcagg gtaataaaca aattgttcat tcttacccca ttttacatca
    26821 tccaggattt taacgaacta tggctttctc ggcgtcttta tttaaacccg tccagctagt
    26881 cccagtttct cctgcatttc atcgcattga gtctactgac tctattgttt tcacatacat
    26941 tcctgctagc ggctatgtag ctgctttagc tgtcaatgtg tgtctcattc ccctattatt
    27001 actgctacgt caagatactt gtcgtcgcag cattatcaga actatggttc tctatttcct
    27061 tgttctgtat aactttttat tagccattgt actagtcaat ggtgtacatt atccaactgg
    27121 aagttgcctg atagccttct tagttatcct cataatactt tggtttgtag atagaattcg
    27181 tttctgtctc atgctgaatt cctacattcc actgtttgac atgcgttctc actttattcg
    27241 tgttagtaca gtttcttctc atggtatggt ccctgtcata cacaccaaac cattatttat
    27301 tagaaacttc gatcagcgtt gcagctgttc tcgttgtttt tatttgcact cttccactta
    27361 tatagagtgc acttatatta gccgttttag taagattagc ctagtttctg taactgactt
    27421 ctccttaaac ggcaatgttt ccactgtttt cgtgcctgca acgcgcgatt cagttcctct
    27481 tcacataatc gccccgagct cgcttatcgt ttaagcagct ctgcgctact atgggtcccg
    27541 tgtagaggct aatccattag tctctctttg gacatatgga aaacgaacta tgttaccctt
    27601 tgtccaagaa cgaatagggt tgttcatagt aaactttttc atttttaccg tagtatgtgc
    27661 tataacactc ttggtgtgta tggctttcct tacggctact agattatgtg tgcaatgtat
    27721 gacaggtctc aataccctgt tagttcagcc cgcattatac ttgtataata ctggacgttc
    27781 agtctatgta aaattccagg atagtaaacc ccctctacca cctgacgagt gggtttaacg
    27841 aactccttca taatgtctaa tatgacgcaa ctcactgagg cgcagattat tgccattatt
    27901 aaagactgga actttgcatg gtccctgatc tttctcttaa ttactatcgt actacagtat
    27961 ggatacccat cccgtagtat gactgtctat gtctttaaaa tgtttgtttt atggctccta
    28021 tggccatctt ccatggcgct atcaatattt agcgccattt atccaattga tctagcttcc
    28081 cagataatct ctggcattgt agcagctgtt tcagctatga tgtggatttc ctactttgtg
    28141 cagagtatcc ggctgtttat gagaactgga tcatggtggt cattcaatcc tgagactaat
    28201 tgccttttga acgttccatt tggtggtaca actgtcgtac gtccactcgt agaggactct
    28261 accagtgtaa ctgctgttgt aaccaatggc cacctcaaaa tggctggcat gcatttcggt
    28321 gcttgtgact acgacagact tcctaatgaa gtcaccgtgg ccaaacccaa tgtgctgatt
    28381 gctttaaaaa tggtgaagcg gcaaagctac ggaactaatt ccggcgttgc catttaccat
    28441 agatataagg caggtaatta caggagtccg cctattacgg cggatattga acttgcattg
    28501 cttcgagctt aggctcttta gtaagagtat cttaattgat tttaacgaat ctcaatttca
    28561 ttgttatggc atcccctgct gcacctcgtg ctgtttcctt tgccgataac aatgatataa
    28621 caaatacaaa cctgtctcga ggtagaggac gtaatccaaa accacgagct gcaccaaata
    28681 acactgtctc ttggtacact gggcttaccc aacacgggaa agtccctctt acctttccac
    28741 ctgggcaggg tgtacctctt aatgccaatt ccacccctgc gcaaaatgct gggtattggc
    28801 ggagacagga cagaaaaatt aataccggga atggaattaa gcaactggct cccaggtggt
    28861 acttctacta cactggaacc ggacccgaag cagcactccc attccgggct gttaaggatg
    28921 gcatcgtttg ggtccatgaa gatggcgcca ctgatgctcc ttcaactttt gggacgcgga
    28981 accctaacaa tgattcagct attgttacac aattcgcgcc cggtactaag cttcctaaaa
    29041 acttccacat tgaggggact ggaggcaata gtcaatcatc ttcaagagcc tctagcgtaa
    29101 gcagaaactc ttccagatct agttcacaag gttcaagatc aggaaactct acccgcggca
    29161 gttctccagg tccatctgga atcggagcag tagggggtga tctactttac cttgatcttc
    29221 tgaacagact acaagccctt gagtctggca aagtaaagca atcgcagcca aaagtaatca
    29281 ctaagaaaga tgctgctgct gctaaaaata agatgcgcca caagcgcact tccaccaaaa
    29341 gtttcaacat ggtgcaagct tttggtcttc gcggaccagg agacctccag ggaaactttg
    29401 gtgatcttca attgaataaa ctcggcactg aggacccacg ttggccccaa attgctgagc
    29461 ttgctcctac agctagtgct tttatgggta tgtcgcaatt taaacttacc catcagaaca
    29521 atgatgatca tggcaaccct gtgtacttcc ttcggtacag tggagccatt aaacttgacc
    29581 caaagaatcc caactacaat aagtggttgg agcttcttga gcaaaatatt gatgcctaca
    29641 aaaccttccc taagaaggaa aagaaacaaa aggcaccaaa agaagaatca acagaccaaa
    29701 tgtctgaacc tccaaaggag cagcgtgtgc gaggtagcat cactcagcgc actcgcaccc
    29761 gtccaagtgt tcagcctggt ccaatgattg atgttaacac tgattagtgt cactcaaagt
    29821 aacaagatcg cggcaatcgt ttgtgtttgg taaccccatc tcaccatcgc ttgtccactc
    29881 ttgcacagaa tggaatcatg ttgtaattac agtgcaataa ggtaattata acccatttaa
    29941 ttgatagcta tgctttatta aagtgtgtag ctgtagagag aatgttaaag actgtcacct
    30001 ctgcgtgatt gcaagtgaac agtgcccccc gggaagagct ctacagtgtg aaatgtaaat
    30061 aaaaatagct attattcaat tagattaggc taattagatg atttgcaaaa aaaaaa

Share this post


Link to post
Share on other sites
LOCUS       KT368846               30115 bp    RNA     linear   VRL 17-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate
            camel/Jeddah/N51/2014, complete genome.
ACCESSION   KT368846
VERSION     KT368846.1  GI:922058088
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 30115)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Co-circulation of three camel coronavirus species and recombination
            of MERS-CoVs in Saudi Arabia
  JOURNAL   Science (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 30115)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2015) Centre of Influenza Research & State Key
            Laboratory of Emerging Infectious Diseases, The University of Hong
            Kong, Laboratory Block, 21 Sassoon Road, Pokfulam, Hong Kong SAR,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..30115
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="camel/Jeddah/N51/2014"
                     /host="camel"
                     /db_xref="taxon:1335626"
                     /country="Saudi Arabia"
                     /collection_date="Nov-2014"
     gene            279..21514
                     /gene="orf1ab"
     CDS             join(279..13433,13433..21514)
                     /gene="orf1ab"
                     /ribosomal_slippage
                     /codon_start=1
                     /product="polyprotein ORF1ab"
                     /protein_id="ALA49582.1"
                     /db_xref="GI:922058090"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGISDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACHKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAIQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
                     RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
                     RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
                     RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
                     KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
                     DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
                     VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
                     RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
                     VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
                     EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
                     MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
                     GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
                     LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
                     NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
                     AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
                     LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
                     YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
                     SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
                     FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
                     PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
                     ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
                     RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
                     RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
                     NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
                     PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
                     KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
                     SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
                     TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS
                     RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
                     FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
                     MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
                     WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
                     CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
                     DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
                     VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
                     DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
                     WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
                     TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
                     VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV
                     VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
                     ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
                     AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
                     RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
                     TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
                     DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
                     TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
                     FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
                     LSVSTDVLVNTYRKLR"
     gene            279..13454
                     /gene="orf1a"
     CDS             279..13454
                     /gene="orf1a"
                     /codon_start=1
                     /product="polyprotein ORF1a"
                     /protein_id="ALA49581.1"
                     /db_xref="GI:922058089"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGISDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACHKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAIQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
     gene            21456..25517
                     /gene="S"
     CDS             21456..25517
                     /gene="S"
                     /codon_start=1
                     /product="spike protein"
                     /protein_id="ALA49583.1"
                     /db_xref="GI:922058091"
                     /translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
                     PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
                     ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
                     MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
                     YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
                     NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
                     RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
                     PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
                     SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
                     DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
                     LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
                     VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
                     SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
                     TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
                     IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
                     QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
                     QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
                     AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
                     QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
                     SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
                     IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
                     VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
                     TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
                     TGCGTNCMGKLKFNRCCDRYEEYDLEPHKVHVH"
     gene            25532..25843
                     /gene="orf3"
     CDS             25532..25843
                     /gene="orf3"
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="ALA49584.1"
                     /db_xref="GI:922058092"
                     /translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
                     KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
                     N"
     gene            25852..26181
                     /gene="orf4a"
     CDS             25852..26181
                     /gene="orf4a"
                     /codon_start=1
                     /product="ORF4a"
                     /protein_id="ALA49585.1"
                     /db_xref="GI:922058093"
                     /translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
                     WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
                     EEESFSN"
     gene            26093..26833
                     /gene="orf4b"
     CDS             26093..26833
                     /gene="orf4b"
                     /codon_start=1
                     /product="ORF4b"
                     /protein_id="ALA49586.1"
                     /db_xref="GI:922058094"
                     /translation="MEESLTDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
                     EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
                     TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
                     PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
                     VDVVSIRSSNQGNKQIVHSYPILHHPGF"
     gene            26840..27514
                     /gene="orf5"
     CDS             26840..27514
                     /gene="orf5"
                     /codon_start=1
                     /product="ORF5"
                     /protein_id="ALA49587.1"
                     /db_xref="GI:922058095"
                     /translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
                     VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
                     ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
                     CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
                     PSSLIV"
     gene            27590..27838
                     /gene="E"
     CDS             27590..27838
                     /gene="E"
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ALA49588.1"
                     /db_xref="GI:922058096"
                     /translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
                     TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
     gene            27853..28512
                     /gene="M"
     CDS             27853..28512
                     /gene="M"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="ALA49589.1"
                     /db_xref="GI:922058097"
                     /translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
                     VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
                     MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
                     DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
                     A"
     gene            28566..29807
                     /gene="N"
     CDS             28566..29807
                     /gene="N"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="ALA49590.1"
                     /db_xref="GI:922058098"
                     /translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
                     TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
                     TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
                     HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
                     LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
                     NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
                     IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
                     TQRTRTRPSVQPGPMIDVNTD"
     gene            28762..29100
                     /gene="orf8b"
     CDS             28762..29100
                     /gene="orf8b"
                     /codon_start=1
                     /product="ORF8b"
                     /protein_id="ALA49591.1"
                     /db_xref="GI:922058099"
                     /translation="MPIPPLRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLELDPKQ
                     HSHSGLLRMASFGSMKMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
                     IVNHLQEPLA"
ORIGIN      
        1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
       61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
      121 gtggcactaa tttgcctgct catctaggca gtggacatat gctcaacact gggtataatt
      181 ctaattgaat actatttttc agttagagcg tcgtgtctct tgtacgtctc ggtcacaata
      241 tacggtttcg tccggtgcgt ggcaattcgg ggcacatcat gtctttcgtg gctggtgtga
      301 tcgcgcaagg tgcgcgcggt acgtatcgag cagcgctcaa ctctgaaaaa catcaagacc
      361 atgtgtctct aactgtgcca ctctgtggtt caggaaacct ggttgaaaaa ctttcaccat
      421 ggttcatgga tggcgaaaat gcctatgaag tggtgaaggc catgttactt aaaaaagagc
      481 cacttctcta tgtgcccatc cggctggctg gacacactag acacctccca ggtcctcgtg
      541 tgtacctggt tgagaggctc attgcttgtg aaaatccatt catggttaac caattggctt
      601 atagctctag tgcaaatggc agcctggttg gcacaacttt gcagggcaag cctattggta
      661 tgttcttccc ttatgacatc gaacttgtca caggaaagca aaatattctc ctgcgcaagt
      721 atggccgtgg tggttatcac tacaccccag tccactatga gcgagacaac acctcttgcc
      781 ctgagtggat ggacgatttt gaggcggatc ctaaaggcaa atatgcccag aatctgctta
      841 agaagttgat tggcggtgat gtcactccag ttgaccaata catgtgtggc gttgatggaa
      901 aacccattag tgcctacgca tttttaatgg ccaaggatgg aataaccaaa ctggctgatg
      961 ttgaagcgga cgtcgcagca cgtgctgatg acgaaggctt catcacatta aagaacaatc
     1021 tatatagatt ggtttggcat gttgagcgta aagacgttcc atatcctaag caatctattt
     1081 ttactattaa tagtgtggtc caaaaggatg gtgttgaaaa cactcctcct cactatttta
     1141 ctcttggatg caaaatttta acgctcaccc cacgcaacaa gtggagtggc atttctgact
     1201 tgtccctcaa acaaaaactc ctttacacct tctatggtaa ggagtcactt gagaacccaa
     1261 cctacattta ccactccgca ttcattgagt gtggaagttg tggtaatgat tcctggctta
     1321 cagggaatgc tatccaaggg tttgcctgtg gatgtggggc atcatataca gctaatgatg
     1381 tcgaagtcca atcatctggc atgattaagc caaatgctct tctttgtgct acttgcccct
     1441 ttgctaaggg tgacagctgt tcttctaatt gcaaacattc agttgctcag ttggttagtt
     1501 acctttctga acgctgtaat gttattgctg attctaagtc cttcacactt atctttggtg
     1561 gcgtagctta cgcctacttt ggatgtgagg aaggtactat gtactttgtg cctagagcta
     1621 agtctgttgt ctcaaggatt ggagactcca tctttacagg ctgtactggc tcttggaaca
     1681 aggtcactca aattgctaac atgttcttgg aacagactca gcattccctt aactttgtgg
     1741 gagagttcgt tgtcaacgat gttgtcctcg caattctctc tggaaccaca actaatgttg
     1801 acaaaatacg ccagcttctc aaaggtgtca ccattgacaa gttgcgtgat tatttagctg
     1861 actatgacgt agcagtcact gccggcccat tcatggataa tgctattaat gttggtggta
     1921 caggattaca gtatgccgcc attactgcac cttatgtagt tctcactggc ttaggtgagt
     1981 cctttaagaa agttgcaacc ataccgtaca aggtttgcaa ctctgttaag gatactctga
     2041 cttattatgc tcacagcgtg ttgtacagag tttttcctta tgacatggat tctggtgtgt
     2101 catcctttag tgaactactt tttgattgcg ttgatctttc agtagcttct acctattttt
     2161 tagtccgcct cttgcaagat aagactggcg actttatgtc tacaattatt acttcctgcc
     2221 aaactgctgt tagtaagctt ctagatacat gttttgaagc tacagaagca acatttaact
     2281 tcttgttaga tttggcagga ttgttcagaa tctttcttcg caatgcctat gtgtacactt
     2341 cacaagggtt tgtggtggtc aatggcaaag tttctacact tgtcaaacaa gtgttagact
     2401 tgcttaataa gggtatgcaa cttttgcata caaaggtctc ctgggctggt tctaatatca
     2461 gtgctgttat ctacagcggc agggagtctc taatattccc atcgggaacc tattactgtg
     2521 tcaccactaa ggctaagtcc gttcaacaag atcttgacgt tattttgcct ggtgagtttt
     2581 ccaagaagca gttaggactg ctccaaccta ctgacaattc tacaactgtt agtgttactg
     2641 tatccagtaa catggttgaa actgttgtgg gtcaacttga gcaaactaat atgcatagtc
     2701 ctgatgttat agtaggtgac tatgtcatta ttagtgaaaa attgtttgtg cgtagtaagg
     2761 aagaagacgg attcgccttc taccctgctt gcactaatgg tcatgctgta ccgactctct
     2821 ttagacttaa gggaggtgca cctgtaaaaa aagtagcctt tggcggtgat caagtacatg
     2881 aggttgctgc tgtaagaagt gttactgtcg agtacaacat tcatgctgta ttagacacac
     2941 tacttgcttc ttctagtctt agaacctttg ttgtagataa gtctttgtca attgaggagt
     3001 ttgctgacgt agtaaaggaa caagtctcag acttgcttgt taaattactg cgtggaatgc
     3061 cgattccaga ttttgattta gacgatttta ttgatgcacc atgctattgc tttaacgctg
     3121 agggtgatgc atcttggtct tctactatga tcttctctct tcaccccgtc gagtgtgacg
     3181 aggagtgttc tgaagtagag gcttcagatt tagaagaagg tgaatcagag tgcatttctg
     3241 agacttcaac tgaacaagtt gacgtttctc atgaggtttc tgacgacgag tgggctgctg
     3301 cagttgatga agcgttcccc ctcgatgaag cagaagatgt tactgaatct gtgcaagaag
     3361 aagcacaacc agtagaagta cctgttgaag atattgcgca ggttgtcata gctgacacct
     3421 tacaggaaac tcctgttgtg tctgatactg ttgaagtccc accgcaagtg gtgaaacttc
     3481 cgtctgaacc tcagactatc cagcccgagg taaaagaagt tgcacctgtc tatgaggctg
     3541 ataccgaaca gacacagagt gttactgtta aacctaagag gttacgcaaa aagcgtaatg
     3601 ttgacccttt gtccaatttt gaacataagg ttattacaga gtgcgttacc atagttttag
     3661 gtgacgcaat tcaagtagcc aagtgctatg gggagtctgt gttagttaat gctgctaaca
     3721 cacatcttaa gcatggcggt ggtatcgctg gtgctattaa tgcggcttca aaaggggctg
     3781 tccaaaaaga gtcagatgag tatattctgg ctaaagggcc gttacaagta ggagattcag
     3841 ttctcttgca aggccattct ctagctaaga atatcctgca tgtcgtaggc ccagatgccc
     3901 gcgctaaaca ggatgtttct ctccttagta agtgctataa ggctatgaat gcatatcctc
     3961 ttgtagtcac tcctcttgtt tcaacaggca tatttggtgt aaaaccagct gtgtcttttg
     4021 attatcttat tagagaggct aagactagag ttttagtcgt cgttaattcc caagatgtct
     4081 ataagagtct taccatagtt gacattccac agagtttgac tttttcatat gatgggttac
     4141 gtggcgcaat acgtaaagct aaagattatg gttttactgt ttttgtgtgc acagacaact
     4201 ctgctaacac taaagttctt aggaacaagg gtgttgatta tactaagaag tttcttacag
     4261 ttgacggtgt gcaatattat tgctacacgt ctaaggacac tttagatgat atcttacaac
     4321 aggctaataa gtctgttggt attatatcta tgcctttggg atatgtgtct catggtttag
     4381 acttaattca agcagggagt gtcgtgcgta gagttaacgt gccctacgtg tgtctcctag
     4441 ctaataaaga gcaagaagct attttgatgt ctgaagacgt taagttaaac ccttcagaag
     4501 attttataaa gcacgtccgc actaatggtg gttacaattc ttggcattta gtcgagggtg
     4561 aactattggt gcaagactta cgcttaaata agctcctgca ttggtctgat caaaccatat
     4621 gctacaagga tagtgtgttt tatgttgtaa agaatagtac agcttttcca tttgaaacac
     4681 tttcagcatg tcgtgcgtat ttggattcac gcacgacaca gcagttaaca atcgaagtct
     4741 tagtgactgt cgatggtgta aattttagaa cagtcgttct aaataataag aacacttata
     4801 gatcacagct tggatgcgtt ttctttaatg gtgctgatat ttctgatacc attcctgatg
     4861 agaaacagaa tggtcacagt ttatatctag cagacaattt gactgctgat gaaacaaagg
     4921 cgcttaaaga gttatatggc cccgttgatc ctactttctt acacagattc tattcactta
     4981 aggctgcagt ccataagtgg aagatggttg tgtgtgataa ggtacgttct ctcaaattga
     5041 gtgataataa ttgttatctt aatgcagtta ttatgacact tgatttattg aaggacatta
     5101 aatttgttat acctgctcta cagcatgcat ttatgaaaca taagggcggt gattcaactg
     5161 acttcatagc cctcattatg gcttatggca attgcacatt tggtgctcca gatgatgcct
     5221 ctcggttact tcataccgtg cttgcaaagg ctgagttatg ctgttctgca cgcatggttt
     5281 ggagagagtg gtgcaatgtc tgtggcataa aagatgttgt tctacaaggc ttaaaagctt
     5341 gttgttacgt gggtgtgcaa actgttgaag atctgcgtgc tcgcatgaca tatgtatgcc
     5401 agtgtggtgg tgaacgtcat cggcaaatag tcgaacacac caccccctgg ttgctgctct
     5461 caggcacacc aaatgaaaaa ttggtgacaa cctccacggc gcctgatttt gtagcgttta
     5521 atgtctttca gggcattgaa acggctgttg gccattatgt tcatgctcgc ctgaagggtg
     5581 gtcttatttt aaagtttgac tctggcaccg ttagcaagac ttcagactgg aagtgcaagg
     5641 tgacagatgt acttttcccc ggccaaaaat acagtagcga ttgtaatgtc gtacggtatt
     5701 ctttggacgg taatttcaga acagaggttg atcccgacct atctgctttc tatgttaagg
     5761 atggtaaata ctttacaagt gaaccacccg taacatattc accagctaca attttagctg
     5821 gtagtgtcta cactaatagc tgccttgtat cgtctgatgg acaacctggc ggtgatgcta
     5881 ttagtttgag ttttaataac cttttagggt ttgattctag taaaccagtc actaagaaat
     5941 acacttactc cttcttgcct aaagaagacg gcgatgtgtt gttggctgag tttgacactt
     6001 atgaccctat ttataagaat ggtgccatgt ataaaggcaa accaattctt tgggtcaaca
     6061 aagcatctta tgatactaat cttaataagt tcaatagagc tagtttgcgt caaatttttg
     6121 acgtagcccc cattgaactc gaaaataaat tcacaccttt gagtgtggcg tccacaccag
     6181 ttgaacctcc aactgtagat gtggtagcac ttcaacagga aatgacaatt gtcaaatgta
     6241 agggtttaaa taaacctttc gtgaaggaca atgtcagttt cgttgttgat gactcaggta
     6301 ctcccgttgt tgagtatctg tctaaagaag atctacatac attgtatgta gaccctaagt
     6361 atcaagtcat tgtcttaaaa gacaatgtac tttcttctat gcttagattg cacaccgttg
     6421 agtcaggtga tattaacgtt gttgcagctt ccggatcttt gacacgtaaa gtgaagttac
     6481 tatttagggc ttcattttat ttcaaagaat ttgctacccg cactttcact gctaccactg
     6541 ctgtaggtag ttgtataaag agtgtagtgc ggcatctagg tgttactaaa ggcatattga
     6601 caggctgttt tagttttgtc aagatgttat ttattcttcc actagcttac tttagtgatt
     6661 caaaactcgg caccacagag gttaaagtga gtgctttgaa aacagctggc gttgtgacag
     6721 gtaatgttgt aaaacagtgt tgcactgctg ctgttgattt aagtatggat aagttgcgcc
     6781 gtgtggattg gaaatcaacc ctacggttgt tacttatgtt atgcacaact atggtattgt
     6841 tgtcttctgt gtatcacttg tatgtcttca atcaggtctt atcaagtgat gttatgtttg
     6901 aagatgccca aggtttgaaa aagttctaca aagaagttag agcttaccta ggaatctctt
     6961 ctgcttgtga cggtcttgct tcagcttata gggcgaattc atttgatgta cctacattct
     7021 gcgcaaaccg ttctgcaatg tgtaattggt gcttgattag ccaagattcc ataactcact
     7081 acccagctct taagatggtt caaacacatc ttagccacta tgttcttaac atagattggt
     7141 tgtggtttgc atttgagact ggtttggcat acatgctcta tacctcggcc ttcaactggt
     7201 tgttgttggc aggtacattg cattatttct ttgcacagac ttccatattt gtagactggc
     7261 ggtcatacaa ttatgctgtg tctagtgcct tctggttatt cacccacatt ccaatggcgg
     7321 gtttggtacg aatgtataat ttgttagcat gcctttggct tttacgcaag ttttatcagc
     7381 atgtaatcaa tggttgcaaa gatacggcat gcttgctctg ctataagagg aaccgactta
     7441 ctagagttga agcttctacc gttgtctgtg gtggaaaacg tacgttttat atcacagcaa
     7501 atggcggtat ttcattctgt cgtaggcata attggaattg tgtggattgt gacattgcag
     7561 gtgtggggaa taccttcatc tgtgaagaag tcgcaaatga cctcactacc gccctacgca
     7621 ggcctattaa cgctacggat agatcacatt attatgtgga ttccgttaca gttaaagaga
     7681 ctgttgttca gtttaattat cgtagagacg gtcaaccatt ctacgagcgg tttcccctct
     7741 gcgcttttac aaatctagat aagttgaagt tcaaagaggt ctgtaaaact actactggta
     7801 tacctgaata caactttatc atctacgact catcagatcg tggccaggaa agtttagcta
     7861 ggtctgcatg tgtttattat tctcaagtct tgtgtaaatc aattcttttg gttgactcaa
     7921 gtttggttac ttctgttggt gattctagtg aaatcgccac taaaatgttt gattcctttg
     7981 ttaatagttt cgtctcgctg tataatgtca cacgcgataa gttggaaaaa cttatctcta
     8041 ctgctcgtga tggcgtaagg cgaggcgata acttccatag tgtcttaaca acattcattg
     8101 acgcagcacg aggccccgca ggtgtggagt ctgatgttga gaccaatgaa attgttgact
     8161 ctgtgcagta tgctcataaa catgacatac aaattactaa tgagagttac aataattatg
     8221 taccctcata tgttaaacct gatagtgtgt ctaccagtga tttaggtagt ctcattgatt
     8281 gtaatgcggc ttcagttaac caaattgtct tgcgtaattc taatggtgct tgtatttgga
     8341 acgctgctgc atatatgaaa ctctcggatg cacttaaacg acagattcgc attgcatgcc
     8401 ataagtgtaa tttagctttc cggttaacca cctcaaagct acgcgctaat gataatatct
     8461 tatcagttag attcactgct aacaaaattg ttggtggtgc tcctacatgg tttaatgtgt
     8521 tgcgtgactt tacgttaaag ggttacgttc ttgctaccat tattgtgttt ctgtgtgctg
     8581 tactgatgta tttgtgttta cctacatttt ctatggtacc tgttgaattt tatgaagacc
     8641 gcatcttgga ctttaaagtt cttgataatg gtatcattag ggatgtaaat cctgatgata
     8701 agtgctttgc taataagcac cggtccttca cacaatggta tcatgagcat gttggtggtg
     8761 tctatgacaa ctctatcaca tgcccattga cagttgcagt aattgctgga gttgctggtg
     8821 ctcgcattcc agacgtacct actacattgg cttgggtgaa caatcagata attttctttg
     8881 tttctcgagt ctttgctaat acaggcagtg tttgctacac tcctatagat gagataccct
     8941 ataagagttt ctctgatagt ggttgcattc ttccatctga gtgcactatg tttagggatg
     9001 cagagggccg tatgacacca tactgccatg atcctactgt tttgcctggg gcttttgcgt
     9061 acagtcagat gaggcctcat gttcgttacg acttgtatga tggtaacatg tttattaaat
     9121 ttcctgaagt agtatttgaa agtacactta ggattactag aactctgtca actcagtact
     9181 gccggttcgg tagttgtgag tatgcacaag agggtgtttg tattaccaca aatggctcgt
     9241 gggccatttt taatgaccac catcttaata gacctggtgt ctattgtggc tctgatttta
     9301 ttgacattgt caggcggtta gcagtatcac tgttccagcc tattacttat ttccaattga
     9361 ctacctcatt ggtcttgggt ataggtttgt gtgcattcct gactttgctc ttctattata
     9421 ttaataaagt aaaacgtgct tttgcagatt acacccagtg tgctgtaatt gctgttgttg
     9481 ctgctgttct taatagcttg tgcatctgct ttgttgcctc tataccattg tgtatagtac
     9541 cttacactgc attgtactat tatgctacat tctattttac taatgagcct gcatttatta
     9601 tgcatgtttc ttggtacatt atgttcgggc ctatcgttcc catatggatg acctgcgtct
     9661 atacagttgc aatgtgcttt agacacttct tctgggtttt agcttatttt agtaagaaac
     9721 atgtagaagt ttttactgat ggtaagctta attgtagttt ccaggacgct gcctctaata
     9781 tctttgttat taacaaggac acttatgcag ctcttagaaa ctctttaact aatgatgcct
     9841 attcacgatt tttggggttg tttaacaagt ataagtactt ctctggtgct atggaaacag
     9901 ccgcttatcg tgaagctgca gcatgtcatc ttgctaaagc cttacaaaca tacagcgaga
     9961 ctggtagtga tcttctttac caaccaccca actgtagcat aacctctggc gtgttgcaaa
    10021 gcggtttggt gaaaatgtca catcccagtg gagatgttga ggcttgtatg gttcaggtta
    10081 cctgcggtag catgactctt aatggtcttt ggcttgacaa cacagtctgg tgcccacgac
    10141 acgtaatgtg cccggctgac cagttgtctg atcctaatta tgatgccttg ttgatttcta
    10201 tgactaatca tagtttcagt gtgcaaaaac acattggcgc tccagcaaac ttgcgtgttg
    10261 ttggtcatgc catgcaaggc actcttttga agttgactgt cgatgttgct aaccctagca
    10321 ctccagccta cacttttaca acagtgaaac ctggcgcagc atttagtgtg ttagcatgct
    10381 ataatggtcg tccgactggt acattcactg ttgtaatgcg ccctaactac acaattaagg
    10441 gttcctttct gtgtggttct tgtggtagtg ttggttacac caaggagggt agtgtgatca
    10501 atttttgtta catgcatcaa atggaacttg ctaatggtac acataccggt tcagcatttg
    10561 atggtactat gtatggtgcc tttatggata aacaagtgca ccaagttcag ttaacagaca
    10621 aatactgcag tgttaatgta gtagcttggc tttacgcagc aatacttaat ggttgcgctt
    10681 ggtttgtaaa acctaatcgc actagtgttg tttcttttaa tgaatgggct cttgccaacc
    10741 aattcactga atttgttggc actcaatccg ttgacatgtt agctgtcaaa acaggcgttg
    10801 ctattgaaca gctgctttat gcgatccaac aactttatac tgggttccag ggaaagcaaa
    10861 tccttggcag tactatgttg gaagatgaat tcacacctga ggatgttaat atgcagatta
    10921 tgggtgtggt tatgcagagt ggtgtgagaa aagttacata tggtactgcg cattggttgt
    10981 tcgcgaccct tgtctcaacc tatgtgataa tcttacaagc cactaaattt actttgtgga
    11041 actacttgtt tgagactatt cccacacagt tgttcccact cttatttgtg actatggcct
    11101 tcgttatgtt gttggttaaa cacaaacaca cctttttgac acttttcttg ttgcctgtgg
    11161 ctatttgttt gacttatgca aacatagtct acgagcccac tactcccatt tcgtcagcgc
    11221 tgattgcagt tgcaaattgg cttgccccca ctaatgctta tatgcgcact acacatactg
    11281 atattggtgt ctacattagt atgtcacttg tattagtcat tgtagtgaag agattgtaca
    11341 acccatcact ttctaacttt gcgttagcat tgtgcagtgg tgtaatgtgg ttgtacactt
    11401 atagcattgg agaagcctca agccccattg cctatctggt ttttgtcact acactcacta
    11461 gtgattatac gattacagtc tttgttactg tcaaccttgc aaaagtttgc acttatgcca
    11521 tctttgctta ctcaccacag cttacacttg tgtttccgga agtgaagatg atacttttat
    11581 tatacacatg tttaggtttc atgtgtactt gctattttgg tgtcttctct cttttgaacc
    11641 ttaagcttag agcacctatg ggtgtctatg actttaaggt ctcaacacaa gagttcagat
    11701 tcatgactgc taacaatcta actgcaccta gaaattcttg ggaggctatg gctctgaact
    11761 ttaagttaat aggtattggc ggtacacctt gtataaaggt tgctgctatt cagtctaaac
    11821 ttacagatct taaatgcaca tctgtggttc tcctctctgt gctccaacag ttacacttag
    11881 aggctaatag tagggcctgg gctttctgtg ttaaatgcca taatgatata ttggcagcaa
    11941 cagaccccag tgaggctttc gagaaattcg taagtctctt tgccacttta atgacttttt
    12001 ctggtaatgt agatcttgat gcgttagcta gtgatatttt tgacactcct agcgtacttc
    12061 aagctactct ttctgagttt tcacacttag ctacctttgc tgagttggaa gctgcgcaga
    12121 aagcctatca ggaagctatg gactctggtg acacctcacc acaagttctt aaggctttgc
    12181 agaaggctgt taatatagct aaaaacgcct atgagaagga taaggcagtg gcccgtaagt
    12241 tagaacgtat ggctgatcag gctatgactt ctatgtataa gcaagcacgt gctgaagaca
    12301 agaaagcaaa aattgtcagt gctatgcaaa ctatgttgtt tggtatgatt aagaagctcg
    12361 acaacgatgt tcttaatggt atcatttcta acgctaggaa tggttgtata cctcttagtg
    12421 tcattccact gtgtgcttca aataaacttc gcgttgtaat tcctgacttc accgtctgga
    12481 atcaggtagt cacatatccc tcgcttaact acgctggggc tttgtgggac attacagtta
    12541 taaacaatgt ggacaatgaa attgttaagt cttcagatgt tgtagacagc aatgaaaatt
    12601 taacatggcc acttgtttta gaatgcacta gggcatccac ttctgccgtt aagttgcaaa
    12661 ataatgagat caaaccttca ggtttaaaaa ccatggttgt gtctgcaggt caagagcaaa
    12721 ctaactgtaa tactagttcc ttagcttatt acgaacctgt gcagggtcgt aaaatgctga
    12781 tggctcttct ttctgataat gcctatctca aatgggcgcg tgttgaaggt aaggacggat
    12841 ttgttagtgt agagctacaa cctccttgca aattcttgat tgcgggacca aaaggacctg
    12901 aaatccgata tctctatttt gttaaaaatc ttaacaacct tcatcgcggg caagtgttag
    12961 ggcacattgc tgcgactgtt agattgcaag ctggttctaa caccgagttt gcctctaatt
    13021 cttcggtgtt gtcacttgtt aacttcaccg ttgatcctca aaaagcttat ctcgatttcg
    13081 tcaatgcggg aggtgcccca ttgacaaatt gtgttaagat gcttactcct aaaactggta
    13141 caggtatagc tatatctgtt aaaccagaga gtacagctga tcaagagact tatggtggag
    13201 cttcagtgtg tctctattgc cgtgcgcata tagaacatcc tgatgtctct ggtgtttgta
    13261 aatataaggg taagtttgtc caaatccctg ctcagtgtgt ccgtgaccct gtgggatttt
    13321 gtttgtcaaa taccccctgt aatgtctgtc aatattggat tggatatggg tgcaattgtg
    13381 actcgcttag gcaagtagca ctgccccaat ctaaagattc caatttttta aacgagtccg
    13441 gggttctatt gtaaatgccc gaatagaacc ctgttcaagt ggtttgtcca ctgatgtcgt
    13501 ctttagggca tttgacatct gcaactataa ggctaaggtt gctggtattg gaaaatacta
    13561 caagactaat acttgtaggt ttgtagaatt agatgaccaa gggcatcatt tagactccta
    13621 ttttgtcgtt aagaggcata ctatggagaa ttatgaacta gagaagcact gttacgattt
    13681 gttacgtgac tgtgatgctg tagctcccca tgatttcttc atctttgatg tagacaaagt
    13741 taaaacacct catattgtac gtcagcgttt aactgagtac actatgatgg atcttgtata
    13801 tgccctgagg cactttgatc aaaatagcga agtgcttaag gctatcttag tgaagtatgg
    13861 ttgctgtgat gttacctact ttgaaaataa actctggttt gattttgttg aaaatcccag
    13921 tgttattggt gtttatcata aacttggaga acgtgtacgc caagctatct taaacactgt
    13981 taaattttgt gaccacatgg tcaaggctgg tttagtcggt gtgctcacac tagacaacca
    14041 ggaccttaat ggcaagtggt atgattttgg tgacttcgta atcactcaac ctggttcagg
    14101 agtagctata gttgatagct actattctta tttgatgcct gtgctctcaa tgaccgattg
    14161 tctggccgct gagacacata gggattgtga ttttaataaa ccactcattg agtggccact
    14221 tactgagtat gattttactg attataaggt acaactcttt gagaagtact ttaaatattg
    14281 ggatcagacg tatcacgcaa attgcgttaa ttgtactgat gaccgttgtg tgttacattg
    14341 tgctaatttc aatgtattgt ttgctatgac catgcctaag acttgtttcg gacccatagt
    14401 ccgaaagatc tttgttgatg gcgtgccatt tgtagtatct tgtggttatc actacaaaga
    14461 attaggttta gtcatgaata tggatgttag tctccataga cataggctct ctcttaagga
    14521 gttgatgatg tatgccgctg atccagccat gcacattgcc tcctctaacg cttttcttga
    14581 tttgaggaca tcatgtttta gtgtcgctgc acttacaact ggtttgactt ttcaaactgt
    14641 gcggcctggc aattttaacc aagacttcta tgatttcgtg gtatctaaag gtttctttaa
    14701 ggagggctct tcagttacgc tcaaacattt tttctttgct caagatggta atgctgctat
    14761 tacagattat aattactatt cttataatct gcctactatg tgtgacatca aacaaatgtt
    14821 gttctgcatg gaagttgtaa acaagtactt cgaaatctat gacggtggtt gtcttaatgc
    14881 ttctgaagtg gttgttaata atttagacaa gagtgctggc catcctttta ataagtttgg
    14941 caaagctcgt gtctattatg agagcatgtc ttaccaggag caagatgaac tctttgccat
    15001 gacaaagcgt aacgtcattc ctaccatgac tcaaatgaat ctaaaatatg ctattagtgc
    15061 taagaataga gctcgcactg ttgcaggcgt gtccatactt agcacaatga ctaatcgcca
    15121 gtaccatcag aaaatgctta agtccatggc tgcaactcgt ggagcgactt gcgtcattgg
    15181 tactacaaag ttctatggtg gctgggattt catgcttaaa acattgtaca aagatgttga
    15241 taatccgcat cttatgggtt gggattaccc taagtgtgat agagctatgc ctaatatgtg
    15301 tagaatcttc gcttcactca tattagctcg taaacatggc acttgttgta ctacaaggga
    15361 cagattttat cgcttggcaa atgagtgtgc tcaggtgcta agcgaatatg ttctatgtgg
    15421 tggtggttac tacgtcaaac ctggaggtac cagtagcgga gatgccacca ctgcatatgc
    15481 caatagtgtc tttaacattt tgcaggcgac aactgctaat gtcagtgcac ttatgggtgc
    15541 taatggcaac aagattgttg acaaagaagt taaagacatg cagtttgatt tgtatgtcaa
    15601 tgtttacagg agcactagcc cagaccccaa atttgttgat aaatactatg cttttcttaa
    15661 taagcacttt tctatgatga tactgtctga tgacggtgtc gtttgctata atagtgatta
    15721 tgcagctaag ggttacattg ctggaataca gaattttaag gaaacgctgt attatcagaa
    15781 caatgtcttt atgtctgaag ctaaatgctg ggtggaaacc gatctgaaga aagggccaca
    15841 tgaattctgt tcacagcata cgctttatat taaggatggc gacgatggtt acttccttcc
    15901 ttatccagac ccttcaagaa ttttgtctgc cggttgcttt gtagatgata tcgttaagac
    15961 tgacggtaca ctcatggtag agcggtttgt gtctttggct atagatgctt accctctcac
    16021 aaagcatgaa gatatagaat accagaatgt attctgggtc tacttacagt atatagaaaa
    16081 actgtataaa gaccttacag gacacatgct tgacagttat tctgtcatgc tatgtggtga
    16141 taattctgct aagttttggg aagaggcatt ctacagagat ctctatagtt cgcctaccac
    16201 tttgcaggct gtcggttcat gcgttgtatg ccattcacag acttctctac gctgtgggac
    16261 atgcatccgt agaccatttc tctgctgtaa atgctgctat gatcatgtta tagcaactcc
    16321 acataagatg gttttgtctg tttctcctta cgtttgtaat gcccctggtt gtggcgtttc
    16381 agacgttact aagctatatt taggtggtat gagctacttt tgtgtagatc atagacctgt
    16441 gtgtagtttt ccactttgcg ctaatggtct tgtattcggc ttatacaaga atatgtgcac
    16501 aggtagtcct tctatagttg aatttaatag gttggctacc tgtgactgga ctgaaagtgg
    16561 tgattacacc cttgccaata ctacaacaga accactcaaa ctttttgctg ctgagacttt
    16621 acgtgccact gaagaggcgt ctaagcagtc ttatgctatt gccaccatca aagaaattgt
    16681 tggtgagcgc caactattac ttgtgtggga ggctggcaag tccaaaccac cactcaatcg
    16741 taattatgtt tttactggtt atcatataac caaaaatagt aaagtgcagc tcggtgagta
    16801 catcttcgag cgcattgatt atagtgatgc tgtatcctac aagtctagta caacgtataa
    16861 actgactgta ggtgacatct tcgtacttac ctctcactct gtggctacct tgacggcgcc
    16921 cacaattgtg aatcaagaga ggtatgttaa aattactggg ttgtacccaa ccattacggt
    16981 acctgaagag ttcgcaagtc atgttgccaa cttccaaaaa tcaggttata gtaaatatgt
    17041 cactgttcag ggaccacctg gcactggcaa aagtcatttt gctatagggt tagcgattta
    17101 ctaccctaca gcacgtgttg tttatacagc atgttcacac gcagctgttg atgctttgtg
    17161 tgaaaaagct tttaaatatt tgaacattgc taaatgttcc cgtatcattc ctgcaaaggc
    17221 acgtgttgag tgctatgaca ggtttaaagt taatgagaca aattctcaat atttgtttag
    17281 tactattaat gctctaccag aaacttctgc cgatattctg gtggttgatg aggttagtat
    17341 gtgcactaat tatgatcttt caattattaa tgcacgtatt aaagctaagc acattgtcta
    17401 tgtaggagat ccagcacagt tgccagctcc taggactttg ttgactagag gcacattgga
    17461 accagaaaat ttcaatagtg tcactagatt gatgtgtaac ttaggtcctg acatattttt
    17521 aagtatgtgc tacaggtgtc ctaaggaaat agtaagcact gtgagcgctc ttgtctacaa
    17581 taataaattg ttagccaaga aggagctttc aggccagtgc tttaaaatac tctataaggg
    17641 caatgtgacg catgatgcta gctctgccat taatagacca caactcacat ttgtgaagaa
    17701 ttttattact gccaatccgg catggagtaa ggcagtcttt atttcgcctt ataattcaca
    17761 gaatgctgtg gctcgttcaa tgctgggtct tactactcag actgttgatt cctcacaggg
    17821 ttcagaatac cagtacgtta tcttctgtca aacagcagat acggcacatg ctaacaacat
    17881 taacagattt aatgttgcaa tcactcgtgc ccaaaaaggt attctttgtg ttatgacatc
    17941 tcaggcactc tttgagtcct tagagtttac tgaattgtct tttactaatt acaagctcca
    18001 gtctcagatt gtaactggcc tttttaaaga ttgctctaga gaaacttctg gcctctcacc
    18061 tgcttatgca ccaacatacg ttagtgttga tgacaagtat aagacgagtg atgagctttg
    18121 cgtgaatctt aatttacccg caaatatccc atactctcgt gttatttcca ggatgggctt
    18181 taaactcgat gcaacagttc ctggatatcc taagcttttc attactcgtg aagaggctgt
    18241 aaggcaagtt cgaagctgga taggcttcga tgttgagggt gctcatgctt cccgtaatgc
    18301 atgtggcacc aatgtgcctc tacaattagg attttcaact ggtgtgaact ttgttgttca
    18361 gccagttggt gttgtagaca ctgagtgggg taacatgtta acgggcattg ctgcccgtcc
    18421 tccaccaggt gaacagttta agcacctcgt gcctcttatg cataaggggg ctgcgtggcc
    18481 tattgttaga cgacgtatag tgcaaatgtt gtcagacact ttagacaaat tgtctgatta
    18541 ctgtacgttt gtttgttggg ctcatggctt tgaattaacg tctgcatcat acttttgcaa
    18601 gataggtaag gaacagaagt gttgcatgtg caatagacgc gctgcagcgt actcttcacc
    18661 tctgcaatct tatgcctgct ggactcattc ctgcggttat gattatgtct acaacccttt
    18721 ctttgtcgat gttcaacagt ggggttatgt aggcaatctt gctactaatc acgatcgtta
    18781 ttgctctgtc catcaaggag ctcatgtggc ttctaatgat gcaataatga ctcgttgttt
    18841 agctattcat tcttgtttta tagaacgtgt ggattgggat atagagtatc cttatatctc
    18901 acatgaaaag aaattgaatt cctgttgtag aatcgttgag cgcaacgtcg tacgtgctgc
    18961 tcttcttgcc ggttcatttg acaaagtcta tgatattggc aatcctaaag gaattcctat
    19021 tgttgatgac cctgtggttg attggcatta ttttgatgca cagcccttga ccagaaaggt
    19081 acaacagctt ttctatacag aggacatggc ctcaagattt gctgatgggc tctgcttatt
    19141 ttggaactgt aatgtaccaa aatatcctaa taatgcaatt gtatgcaggt ttgacacacg
    19201 tgtgcattct gagttcaatt tgccaggttg tgatggcggt agtttgtatg ttaacaagca
    19261 cgcttttcat acaccagcat atgatgtgag tgcattccgt gatctgaaac ctttaccatt
    19321 cttttattat tctactacac catgtgaagt gcatggtaat ggtagtatga tagaggatat
    19381 tgattatgta cccctaaaat ctgcagtctg tattacagct tgtaatttag ggggcgctgt
    19441 ttgtaggaag catgctacag agtacagaga gtatatggaa gcatataatc ttgtctctgc
    19501 atcaggtttc cgcctttggt gttataagac ctttgatatt tataatctct ggtctacttt
    19561 tacaaaagtt caaggtttgg aaaacattgc ttttaatgtt gttaaacaag gccattttat
    19621 tggtgttgag ggtgaactac ctgtagctgt agtcaatgat aagatcttca ccaagagtgg
    19681 cgttaatgac atttgtatgt ttgagaataa aaccactttg cctactaata tagcttttga
    19741 actctatgct aagcgtgctg tacgctcgca tcccgatttc aaattgctac acaatttaca
    19801 agcagacatt tgctacaagt tcgtcctttg ggattatgaa cgtagcaata tttatggtac
    19861 tgctactatt ggtgtatgta agtacactga tattgatgtt aattcagctt tgaatatatg
    19921 ttttgacata cgcgataatg gttcattgga gaagttcatg tctactccca atgccatctt
    19981 tatttctgat agaaaaatta agaaataccc ttgtattgta ggtcctgatt atgcttactt
    20041 caatggtgct atcatccgtg atagtgatgt tgttaaacaa ccagtgaagt tctacttgta
    20101 taagaaagtc aataatgagt ttattgatcc tactgagtgt atttacactc agagtcgctc
    20161 ttgtagtgac ttcctacccc tgtctgacat ggagaaagac tttctatctt ttgatagtga
    20221 tgttttcatt aagaagtatg gcttggaaaa ctatgctttt gagcacgtag tctatggaga
    20281 cttctctcat actacgttag gcggtcttca cttgcttatt ggtttataca agaagcaaca
    20341 ggaaggtcat attattatgg aagaaatgct aaaaggtagc tcaactattc ataactattt
    20401 tattactgag actaacacag cggcttttaa ggcggtgtgt tctgttatag atttaaagct
    20461 tgacgacttt gttatgattt taaagagtca agaccttggc gtagtatcca aggttgtcaa
    20521 ggttcctatt gacttaacaa tgattgagtt tatgttatgg tgtaaggatg gacaggttca
    20581 aaccttctac cctcgactcc aggcttctgc agattggaaa cctggtcatg caatgccatc
    20641 cctctttaaa gttcaaaatg taaaccttga acgttgtgag cttgctaatt acaagcaatc
    20701 tattcctatg cctcgcggtg tgcacatgaa catcgctaaa tatatgcaat tgtgccagta
    20761 tttaaatact tgcacattag ccgtgcctgc caatatgcgt gttatacatt ttggcgctgg
    20821 ttctgataaa ggtatcgctc ctggtacatc agttttacga cagtggcttc ctacagatgc
    20881 cattattata gataatgatt taaatgagtt cgtgtcagat gctgacataa ctttatttgg
    20941 agattgtgta actgtacgtg tcggccaaca agtggatctt gttatttccg acatgtatga
    21001 tcctactact aagaatgtaa caggtagtaa tgagtcaaag gctttattct ttacttacct
    21061 gtgtaacctc attaataata atcttgctct tggtgggtct gttgctatta aaataacaga
    21121 acactcttgg agcgttgaac tttatgaact tatgggaaaa tttgcttggt ggactgtttt
    21181 ctgcaccaat gcaaatgcat cctcatctga aggattcctc ttaggtatta attacttggg
    21241 tactattaaa gaaaatatag atggtggtgc tatgcacgcc aactatatat tttggagaaa
    21301 ttccactcct atgaatctga gtacttactc actttttgat ttatccaagt ttcaattaaa
    21361 attaaaagga acaccagttc ttcaattaaa ggagagtcaa attaacgaac tcgtaatatc
    21421 tctcctgtcg cagggtaagt tacttatccg tgacaatgat acactcagtg tttctactga
    21481 tgttcttgtt aacacctaca gaaagttacg ttgatgtagg gccagattct gttaagtctg
    21541 cttgtattga ggttgatata caacagactt tctttgataa aacttggcct aggccaattg
    21601 atgtttctaa ggctgacggt attatatacc ctcaaggccg tacatattct aacataacta
    21661 tcacttatca aggtcttttt ccctatcagg gagaccatgg tgatatgtat gtctactctg
    21721 caggacatgc tacaggcaca actccacaaa agttgtttgt agctaactat tctcaggacg
    21781 tcaaacagtt tgctaatggg tttgtcgtcc gtataggagc agctgccaat tccactggca
    21841 ctgttattat tagcccatct accagcgcta ctatacgaaa aatttaccct gcttttatgc
    21901 tgggttcttc agttggtaat ttctcagatg gtaaaatggg ccgcttcttc aatcatactc
    21961 tagttctttt gcccgatgga tgtggcactt tacttagagc tttttattgt attctagagc
    22021 ctcgctctgg aaatcattgt cctgctggca attcctatac ttcttttgcc acttatcaca
    22081 ctcctgcaac agattgttct gatggcaatt acaatcgtaa tgccagtctg aactctttta
    22141 aggagtattt taatttacgt aactgcacct ttatgtacac ttataacatt accgaagatg
    22201 agattttaga gtggtttggc attacacaaa ctgctcaagg tgttcacctc ttctcatctc
    22261 ggtatgttga tttgtacggc ggcaatatgt ttcaatttgc caccttgcct gtttatgata
    22321 ctattaagta ttattctatc attcctcaca gtattcgttc tatccaaagt gatagaaaag
    22381 cttgggctgc cttctacgta tataaacttc aaccgttaac tttcctgttg gatttttctg
    22441 ttgatggtta tatacgcaga gctatagact gtggttttaa tgatttgtca caactccact
    22501 gctcatatga atccttcgat gttgaatctg gagtttattc agtttcgtct ttcgaagcaa
    22561 aaccttctgg ctcagttgtg gaacaggctg aaggtgttga atgtgatttt tcacctcttc
    22621 tgtctggcac acctcctcag gtttataatt tcaagcgttt ggtttttacc aattgcaatt
    22681 ataatcttac caaattgctt tcactttttt ctgtgaatga ttttacttgt agtcaaatat
    22741 ctccagcagc aattgctagc aactgttatt cttcactgat tttggattat ttttcatacc
    22801 cacttagtat gaaatccgat ctcagtgtta gttctgctgg tccaatatcc cagtttaatt
    22861 ataaacagtc cttttctaat cccacatgtt tgattttagc gactgttcct cataacctta
    22921 ctactattac taagcctctt aagtacagct atattaacaa gtgctctcgt cttctttctg
    22981 atgatcgtac tgaagtacct cagttagtga acgctaatca atactcaccc tgtgtatcca
    23041 ttgtcccatc cactgtgtgg gaagacggtg attattatag gaaacaacta tctccacttg
    23101 aaggtggtgg ctggcttgtt gctagtggct caactgttgc catgactgag caattacaga
    23161 tgggctttgg tattacagtt caatatggta cagacaccaa tagtgtttgc cccaagcttg
    23221 aatttgctaa tgacacaaaa attgcctctc aattaggcaa ttgcgtggaa tattccctct
    23281 atggtgtttc gggccgtggt gtttttcaga attgcacagc tgtaggtgtt cgacagcagc
    23341 gctttgttta tgatgcgtac cagaatttag ttggctatta ttctgatgat ggcaactact
    23401 actgtttgcg tgcttgtgtt agtgttcctg tttctgtcat ctatgataaa gaaactaaaa
    23461 cccacgctac tctatttggt agtgttgcat gtgaacacat ttcctctacc atgtctcaat
    23521 actcccgttc tacgcgatca atgcttaaac ggcgagattc tacatatggt ccccttcaga
    23581 cacctgttgg ttgtgtccta ggacttgtta attcctcttt gttcgtagag gactgcaagt
    23641 tgcctcttgg tcaatctctc tgtgctcttc ctgacacacc tagtactctc acacctcgca
    23701 gtgtgcgctc tgttccaggt gaaatgcgct tggcatccat tgcttttaat catcctattc
    23761 aggttgatca acttaatagt agttatttta aattaagtat acctactaat ttttcctttg
    23821 gtgtgactca ggagtacatt cagacaacca ttcagaaagt tactgttgat tgtaaacagt
    23881 acgtttgcaa tggtttccag aagtgtgagc aattactgcg cgagtatggc cagttttgtt
    23941 ccaaaataaa ccaggctctc catggtgcca atttacgcca ggatgattct gtacgtaatt
    24001 tgtttgcgag cgtgaaaagc tctcaatcat ctcctatcat accaggtttt ggaggtgact
    24061 ttaatttgac acttctagaa cctgtttcta tatctactgg cagtcgtagt gcacgtagtg
    24121 ctattgagga tttgctattt gacaaagtca ctatagctga tcctggttat atgcaaggtt
    24181 acgatgattg tatgcagcaa ggtccagcat cagctcgtga tcttatttgt gctcaatatg
    24241 tggctggtta taaagtatta cctcctctta tggatgttaa tatggaagcc gcgtacactt
    24301 catctttgct tggcagcata gcaggtgttg gctggactgc tggcttatcc tcctttgctg
    24361 ctattccatt tgcacagagt attttttata ggttaaacgg tgttggcatt actcaacagg
    24421 ttctttcaga gaaccaaaag cttattgcca ataagtttaa tcaggctctg ggagctatgc
    24481 aaacaggctt cactacaact aatgaagctt ttcggaaggt tcaggatgct gtgaacaaca
    24541 atgcacaggc tctatccaaa ttagctagcg agctatctaa tacttttggt gctatttccg
    24601 cctctattgg agacatcata caacgtcttg atgttctcga acaggacgcc caaatagaca
    24661 gacttattaa tggccgtttg acaacactaa atgcttttgt tgcacagcag cttgttcgtt
    24721 ccgaatcagc tgctctttcc gctcaattgg ctaaagataa agtcaatgag tgtgtcaagg
    24781 cacaatccaa gcgttctgga ttttgcggtc aaggcacaca tatagtgtcc tttgttgtaa
    24841 atgcccctaa tggcctttac tttatgcatg ttggttatta ccctagcaac cacattgagg
    24901 ttgtttctgc ttatggtctt tgcgatgcag ctaaccctac taattgtata gcccctgtta
    24961 atggctactt tattaaaact aataacacta ggattgttga tgagtggtca tatactggct
    25021 cgtccttcta tgcacctgag cccatcacct ctcttaatac taagtatgtt gcaccacagg
    25081 tgacatacca aaacatttct actaacctcc ctcctcctct tctcggcaat tccaccggga
    25141 ttgacttcca agatgagttg gatgagtttt tcaaaaatgt tagcaccagt atacctaatt
    25201 ttggttctct aacacagatt aatactacat tactcgatct tacctacgag atgttgtctc
    25261 ttcaacaagt tgttaaagcc cttaatgagt cttacataga ccttaaagag cttggcaatt
    25321 atacttatta caacaaatgg ccgtggtaca tttggcttgg tttcattgct gggcttgttg
    25381 ccttagctct atgcgtcttc ttcatactgt gctgcactgg ttgtggcaca aactgtatgg
    25441 gaaaacttaa gtttaatcgt tgttgtgata gatacgagga atacgacctc gagccgcata
    25501 aggttcatgt tcactaatta acgaactatc aatgagagtt caaagaccac ccactctctt
    25561 gttagtgttc tcactctctt ttttggtcac tgcattttca aaacctctct atgtacctga
    25621 gcattgtcag aattattctg gttgcatgct tagggcttgt attaaaactg cccaagctga
    25681 tacagctggt ctttatacaa attttcgaat tgacgtccca tctgcagaat caactggtac
    25741 tcaatcagtt tctgtcgatc gtgagtctac ttcaactcat gatggtctta ccgaacatgt
    25801 tactagtgtg aatctttttg acgttggtta ctcagttaat taacgaactc tatggattac
    25861 gtgtctctgc ttaatcaaat ttggcagaag taccttaatt caccgtatac tacttgtttg
    25921 tatatcccta aacccacagc taagtataca cctttagttg gcacttcatt gcaccctgtg
    25981 ctgtggaact gtcagctatc ctttgctggt tatactgaat ctgctgttaa ttctacaaaa
    26041 gctttggcca aacaggacgc agctcagcga atcgcttggt tgctacataa ggatggagga
    26101 atccctgacg gatgttccct ctacctccgg cactcaagtt tattcgcgca aagcgaggaa
    26161 gaggagtcat tctccaacta agaaactgcg ctacgttaag cgtagatttt ctcttctgcg
    26221 ccctgaagac cttagtgtta ttgtccaacc aacacactat gtcagggtta cattttcaga
    26281 ccccaacatg tggtatctac gttcgggtca tcatttacac tcagttcaca attggcttaa
    26341 accttatggc ggccaacctg tttctgagta ccatattact ctagctttgc taaatctcac
    26401 tgatgaagat ttagctagag atttttcacc cattgcgctc tttttgcgca atgtcagatt
    26461 tgagctacat gagttcgcct tgctgcgcaa aactcttgtt cttaatgcat cagagatcta
    26521 ctgtgctaac atacatagat ttaagcctgt gtatagagtt aacacggcaa tccctactat
    26581 taaggattgg cttctcgttc agggattttc cctttaccat agtggcctcc ctttacatat
    26641 gtcaatctct aaattgcatg cactggatga tgttactcgc aattacatca ttacaatgcc
    26701 atgctttaga acttatcctc aacaaatgtt tgttactcct ttggccgtag atgttgtctc
    26761 catacggtct tccaatcagg gtaataaaca aattgttcat tcttacccca ttttacatca
    26821 tccaggattt taacgaacta tggctttctc ggcgtcttta tttaaacccg tccagctagt
    26881 cccagtttct cctgcatttc atcgcattga gtctactgac tctattgttt tcacatacat
    26941 tcctgctagc ggctatgtag ctgctttagc tgtcaatgtg tgtctcattc ccctattatt
    27001 actgctacgt caagatactt gtcgtcgcag cattatcaga actatggttc tctatttcct
    27061 tgttctttat aactttttat tagccattgt actagtcaat ggtgtacatt atccaactgg
    27121 aagttgcctg atagccttct tagttatcct cataatactt tggtttgtag atagaattcg
    27181 tttctgtctc atgctgaatt cctacattcc actgtttgac atgcgttctc actttattcg
    27241 tgttagtaca gtttcttctc atggtatggt ccctgtcata cacaccaaac cattatttat
    27301 tagaaacttc gatcagcgtt gcagctgttc tcgttgtttt tatttgcact cttctactta
    27361 tatagagtgc acttatatta gccgttttag taagattagc ctagtttctg taactgactt
    27421 ctccttaaac ggcaatgttt ccactgtttt cgtgcctgca acgcgcgatt cagttcctct
    27481 tcacataatc gccccgagct cgcttatcgt ttaagcagct ctgcgctact atgggtcccg
    27541 tgtagaggct aatccattag tctctctttg gacatatgga aaacgaacta tgttaccctt
    27601 tgtccaagaa cgaatagggt tgttcatagt aaactttttc atttttaccg tagtatgtgc
    27661 tataacactc ttggtgtgta tggctttcct tacggctact agattatgtg tgcaatgtat
    27721 gacaggcttc aataccctgt tagttcagcc cgcattatac ttgtataata ctggacgttc
    27781 agtctatgta aaattccagg atagtaaacc ccctctacca cctgacgagt gggtttaacg
    27841 aactccttca taatgtctaa tatgacgcaa ctcactgagg cgcagattat tgccattatt
    27901 aaagactgga actttgcatg gtccctgatc tttctcttaa ttactatcgt actacagtat
    27961 ggatacccat cccgtagtat gactgtctat gtctttaaaa tgtttgtttt atggctccta
    28021 tggccatctt ccatggcgct atcaatattt agcgccattt atccaattga tctagcttcc
    28081 cagataatct ctggcattgt agcagctgtt tcagctatga tgtggatttc ctactttgtg
    28141 cagagtatcc ggctgtttat gagaactgga tcatggtggt cattcaatcc tgagactaat
    28201 tgccttttga acgttccaat tggtggtaca actgtcgtac gtccactcgt agaggactct
    28261 accagtgtaa ctgctgttgt aaccaatggt cacctcaaaa tggctggcat gcatttcggt
    28321 gcttgtgact acgacagact tcctaatgaa gtcaccgtgg ccaaacccaa tgtgctgatt
    28381 gctttaaaaa tggtgaagcg gcaaagctac ggaactaatt ccggcgttgc catttaccat
    28441 agatataagg caggtaatta caggagtccg cctattacgg cggatattga acttgcattg
    28501 cttcgagctt aggctcttta gtaagagtat cttaattgat tttaacgaat ctcaatttca
    28561 ttgttatggc atcccctgct gcacctcgtg ctgtttcctt tgccgataac aatgatataa
    28621 caaatacaaa cctgtctcga ggtagaggac gtaatccaaa accacgagct gcaccaaata
    28681 acactgtctc ttggtacact gggcttaccc aacacgggaa agtccctctt acctttccac
    28741 ctgggcaggg tgtacctctt aatgccaatt ccacccctgc gcaaaatgct gggtattggc
    28801 ggagacagga cagaaaaatt aataccggga atggaattaa gcaactggct cccaggtggt
    28861 acttctacta cactggaact ggacccgaag cagcactccc attccgggct gttaaggatg
    28921 gcatcgtttg ggtccatgaa gatggcgcca ctgatgctcc ttcaactttt gggacgcgga
    28981 accctaacaa tgattcagct attgttacac aattcgcgcc cggtactaag cttcctaaaa
    29041 acttccacat tgaggggact ggaggcaata gtcaatcatc ttcaagagcc tctagcgtaa
    29101 gcagaaactc ttccagatct agttcacaag gttcaagatc aggaaactct acccgcggca
    29161 cttctccagg tccatctgga atcggagcag taggaggtga tctactttac cttgatcttc
    29221 tgaacagact acaagccctt gagtctggca aagtaaagca atcgcagcca aaagtaatca
    29281 ctaagaaaga tgctgctgct gctaaaaata agatgcgcca caagcgcact tccaccaaaa
    29341 gtttcaacat ggtgcaagct tttggtcttc gcggaccagg agacctccag ggaaactttg
    29401 gtgatcttca attgaataaa ctcggcactg aggacccacg ttggccccaa attgctgagc
    29461 ttgctcctac agccagtgct tttatgggta tgtcgcaatt taaacttacc catcagaaca
    29521 atgatgatca tggcaaccct gtgtacttcc ttcggtacag tggagccatt aaacttgacc
    29581 caaagaatcc caactacaat aagtggttgg agcttcttga gcaaaatatt gatgcctaca
    29641 aaaccttccc taagaaggaa aagaaacaaa aggcaccaaa agaagaatca acagaccaaa
    29701 tgtctgaacc tccaaaggag cagcgtgtgc aaggtagcat cactcagcgc actcgcaccc
    29761 gtccaagtgt tcagcctggt ccaatgattg atgttaacac tgattagtgt cactcaaagt
    29821 aacaagatcg cggcaatcgt ttgtgtttgg taaccccatc tcaccatcgc ttgtccactc
    29881 ttgcacagaa tggaatcatg ttgtaattac agtgcaataa ggtaattata acccatttaa
    29941 ttgatagcta tgctttatta aagtgtgtag ctgtagagag aatgttaaag actgtcacct
    30001 ctgcgtgatt gcaagtgaac agtgcccccc gggaagagct ctacagtgtg aaatgtaaat
    30061 aaaaatagct attattcaat tagattaggc taattagatg atttgcaaaa aaaaa

Share this post


Link to post
Share on other sites
LOCUS       KT368847               30110 bp    RNA     linear   VRL 17-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate
            camel/Jeddah/N62(b)/2014, complete genome.
ACCESSION   KT368847
VERSION     KT368847.1  GI:922058100
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 30110)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Co-circulation of three camel coronavirus species and recombination
            of MERS-CoVs in Saudi Arabia
  JOURNAL   Science (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 30110)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2015) Centre of Influenza Research & State Key
            Laboratory of Emerging Infectious Diseases, The University of Hong
            Kong, Laboratory Block, 21 Sassoon Road, Pokfulam, Hong Kong SAR,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..30110
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="camel/Jeddah/N62(b)/2014"
                     /host="camel"
                     /db_xref="taxon:1335626"
                     /country="Saudi Arabia"
                     /collection_date="Nov-2014"
     gene            279..21514
                     /gene="orf1ab"
     CDS             join(279..13433,13433..21514)
                     /gene="orf1ab"
                     /ribosomal_slippage
                     /codon_start=1
                     /product="polyprotein ORF1ab"
                     /protein_id="ALA49593.1"
                     /db_xref="GI:922058102"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGISDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACHKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAIQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
                     RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
                     RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
                     RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
                     KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
                     DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
                     VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
                     RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
                     VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
                     EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
                     MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
                     GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
                     LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
                     NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
                     AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
                     LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
                     YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
                     SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
                     FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
                     PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
                     ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIXVLTSHSVATLTAPTIVNQE
                     RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
                     RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
                     NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
                     PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
                     KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
                     SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
                     TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS
                     RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
                     FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
                     MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
                     WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
                     CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
                     DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
                     VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
                     DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
                     WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
                     TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
                     VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV
                     VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
                     ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
                     AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
                     RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
                     TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
                     DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
                     TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
                     FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
                     LSVSTDVLVNTYRKLR"
     gene            279..13454
                     /gene="orf1a"
     CDS             279..13454
                     /gene="orf1a"
                     /codon_start=1
                     /product="polyprotein ORF1a"
                     /protein_id="ALA49592.1"
                     /db_xref="GI:922058101"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGISDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACHKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAIQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
     gene            21456..25517
                     /gene="S"
     CDS             21456..25517
                     /gene="S"
                     /codon_start=1
                     /product="spike protein"
                     /protein_id="ALA49594.1"
                     /db_xref="GI:922058103"
                     /translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
                     PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
                     ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
                     MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
                     YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
                     NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
                     RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
                     PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
                     SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
                     DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
                     LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
                     VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
                     SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
                     TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
                     IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
                     QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
                     QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
                     AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
                     QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
                     SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
                     IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
                     VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
                     TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
                     TGCGTNCMGKLKFNRCCDRYEEYDLEPHKVHVH"
     gene            25532..25843
                     /gene="orf3"
     CDS             25532..25843
                     /gene="orf3"
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="ALA49595.1"
                     /db_xref="GI:922058104"
                     /translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
                     KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
                     N"
     gene            25852..26181
                     /gene="orf4a"
     CDS             25852..26181
                     /gene="orf4a"
                     /codon_start=1
                     /product="ORF4a"
                     /protein_id="ALA49596.1"
                     /db_xref="GI:922058105"
                     /translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
                     WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
                     EEESFSN"
     gene            26093..26833
                     /gene="orf4b"
     CDS             26093..26833
                     /gene="orf4b"
                     /codon_start=1
                     /product="ORF4b"
                     /protein_id="ALA49597.1"
                     /db_xref="GI:922058106"
                     /translation="MEESLTDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
                     EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
                     TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
                     PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
                     VDVVSIRSSNQGNKQIVHSYPILHHPGF"
     gene            26840..27514
                     /gene="orf5"
     CDS             26840..27514
                     /gene="orf5"
                     /codon_start=1
                     /product="ORF5"
                     /protein_id="ALA49598.1"
                     /db_xref="GI:922058107"
                     /translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
                     VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
                     ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
                     CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
                     PSSLIV"
     gene            27590..27838
                     /gene="E"
     CDS             27590..27838
                     /gene="E"
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ALA49599.1"
                     /db_xref="GI:922058108"
                     /translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
                     TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
     gene            27853..28512
                     /gene="M"
     CDS             27853..28512
                     /gene="M"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="ALA49600.1"
                     /db_xref="GI:922058109"
                     /translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
                     VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
                     MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
                     DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
                     A"
     gene            28566..29807
                     /gene="N"
     CDS             28566..29807
                     /gene="N"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="ALA49601.1"
                     /db_xref="GI:922058110"
                     /translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
                     TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
                     TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
                     HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGLSGIGAVGGDLLYLDL
                     LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
                     NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
                     IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
                     TQRTRTRPSVQPGPMIDVNTD"
     gene            28762..29100
                     /gene="orf8b"
     CDS             28762..29100
                     /gene="orf8b"
                     /codon_start=1
                     /product="ORF8b"
                     /protein_id="ALA49602.1"
                     /db_xref="GI:922058111"
                     /translation="MPIPPLRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLELDPKQ
                     HSHSGLLRMASFGSMKMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
                     IVNHLQEPLA"
ORIGIN      
        1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
       61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
      121 gtggcactaa tttgcctgct catctaggca gtggacatat gctcaacact gggtataatt
      181 ctaattgaat actatttttc agttagagcg tcgtgtctct tgtacgtctc ggtcacaata
      241 tacggtttcg tccggtgcgt ggcaattcgg ggcacatcat gtctttcgtg gctggtgtga
      301 tcgcgcaagg tgcgcgcggt acgtatcgag cagcgctcaa ctctgaaaaa catcaagacc
      361 atgtgtctct aactgtgcca ctctgtggtt caggaaacct ggttgaaaaa ctttcaccat
      421 ggttcatgga tggcgaaaat gcctatgaag tggtgaaggc catgttactt aaaaaagagc
      481 cacttctcta tgtgcccatc cggctggctg gacacactag acacctccca ggtcctcgtg
      541 tgtacctggt tgagaggctc attgcttgtg aaaatccatt catggttaac caattggctt
      601 atagctctag tgcaaatggc agcctggttg gcacaacttt gcagggcaag cctattggta
      661 tgttcttccc ttatgacatc gaacttgtca caggaaagca aaatattctc ctgcgcaagt
      721 atggccgtgg tggttatcac tacaccccag tccactatga gcgagacaac acctcttgcc
      781 ctgagtggat ggacgatttt gaggcggatc ctaaaggcaa atatgcccag aatctgctta
      841 agaagttgat tggcggtgat gtcactccag ttgaccaata catgtgtggc gttgatggaa
      901 aacccattag tgcctacgca tttttaatgg ccaaggatgg aataaccaaa ctggctgatg
      961 ttgaagcgga cgtcgcagca cgtgctgatg acgaaggctt catcacatta aagaacaatc
     1021 tatatagatt ggtttggcat gttgagcgta aagacgttcc atatcctaag caatctattt
     1081 ttactattaa tagtgtggtc caaaaggatg gtgttgaaaa cactcctcct cactatttta
     1141 ctcttggatg caaaatttta acgctcaccc cacgcaacaa gtggagtggc atttctgact
     1201 tgtccctcaa acaaaaactc ctttacacct tctatggtaa ggagtcactt gagaacccaa
     1261 cctacattta ccactccgca ttcattgagt gtggaagttg tggtaatgat tcctggctta
     1321 cagggaatgc tatccaaggg tttgcctgtg gatgtggggc atcatataca gctaatgatg
     1381 tcgaagtcca atcatctggc atgattaagc caaatgctct tctttgtgct acttgcccct
     1441 ttgctaaggg tgacagctgt tcttctaatt gcaaacattc agttgctcag ttggttagtt
     1501 acctttctga acgctgtaat gttattgctg attctaagtc cttcacactt atctttggtg
     1561 gcgtagctta cgcctacttt ggatgtgagg aaggtactat gtactttgtg cctagagcta
     1621 agtctgttgt ctcaaggatt ggagactcca tctttacagg ctgtactggc tcttggaaca
     1681 aggtcactca aattgctaac atgttcttgg aacagactca gcattccctt aactttgtgg
     1741 gagagttcgt tgtcaacgat gttgtcctcg caattctctc tggaaccaca actaatgttg
     1801 acaaaatacg ccagcttctc aaaggtgtca ccattgacaa gttgcgtgat tatttagctg
     1861 actatgacgt agcagtcact gccggcccat tcatggataa tgctattaat gttggtggta
     1921 caggattaca gtatgccgcc attactgcac cttatgtagt tctcactggc ttaggtgagt
     1981 cctttaagaa agttgcaacc ataccgtaca aggtttgcaa ctctgttaag gatactctga
     2041 cttattatgc tcacagcgtg ttgtacagag tttttcctta tgacatggat tctggtgtgt
     2101 catcctttag tgaactactt tttgattgcg ttgatctttc agtagcttct acctattttt
     2161 tagtccgcct cttgcaagat aagactggcg actttatgtc tacaattatt acttcctgcc
     2221 aaactgctgt tagtaagctt ctagatacat gttttgaagc tacagaagca acatttaact
     2281 tcttgttaga tttggcagga ttgttcagaa tctttcttcg caatgcctat gtgtacactt
     2341 cacaagggtt tgtggtggtc aatggcaaag tttctacact tgtcaaacaa gtgttagact
     2401 tgcttaataa gggtatgcaa cttttgcata caaaggtctc ctgggctggt tctaatatca
     2461 gtgctgttat ctacagcggc agggagtctc taatattccc atcgggaacc tattactgtg
     2521 tcaccactaa ggctaagtcc gttcaacaag atcttgacgt tattttgcct ggtgagtttt
     2581 ccaagaagca gttaggactg ctccaaccta ctgacaattc tacaactgtt agtgttactg
     2641 tatccagtaa catggttgaa actgttgtgg gtcaacttga gcaaactaat atgcatagtc
     2701 ctgatgttat agtaggtgac tatgtcatta ttagtgaaaa attgtttgtg cgtagtaagg
     2761 aagaagacgg attcgccttc taccctgctt gcactaatgg tcatgctgta ccgactctct
     2821 ttagacttaa gggaggtgca cctgtaaaaa aagtagcctt tggcggtgat caagtacatg
     2881 aggttgctgc tgtaagaagt gttactgtcg agtacaacat tcatgctgta ttagacacac
     2941 tacttgcttc ttctagtctt agaacctttg ttgtagataa gtctttgtca attgaggagt
     3001 ttgctgacgt agtaaaggaa caagtctcag acttgcttgt taaattactg cgtggaatgc
     3061 cgattccaga ttttgattta gacgatttta ttgatgcacc atgctattgc tttaacgctg
     3121 agggtgatgc atcttggtct tctactatga tcttctctct tcaccccgtc gagtgtgacg
     3181 aggagtgttc tgaagtagag gcttcagatt tagaagaagg tgaatcagag tgcatttctg
     3241 agacttcaac tgaacaagtt gacgtttctc atgaggtttc tgacgacgag tgggctgctg
     3301 cagttgatga agcgttcccc ctcgatgaag cagaagatgt tactgaatct gtgcaagaag
     3361 aagcacaacc agtagaagta cctgttgaag atattgcgca ggttgtcata gctgacacct
     3421 tacaggaaac tcctgttgtg tctgatactg ttgaagtccc accgcaagtg gtgaaacttc
     3481 cgtctgaacc tcagactatc cagcccgagg taaaagaagt tgcacctgtc tatgaggctg
     3541 ataccgaaca gacacagagt gttactgtta aacctaagag gttacgcaaa aagcgtaatg
     3601 ttgacccttt gtccaatttt gaacataagg ttattacaga gtgcgttacc atagttttag
     3661 gtgacgcaat tcaagtagcc aagtgctatg gggagtctgt gttagttaat gctgctaaca
     3721 cacatcttaa gcatggcggt ggtatcgctg gtgctattaa tgcggcttca aaaggggctg
     3781 tccaaaaaga gtcagatgag tatattctgg ctaaagggcc gttacaagta ggagattcag
     3841 ttctcttgca aggccattct ctagctaaga atatcctgca tgtcgtaggc ccagatgccc
     3901 gcgctaaaca ggatgtttct ctccttagta agtgctataa ggctatgaat gcatatcctc
     3961 ttgtagtcac tcctcttgtt tcaacaggca tatttggtgt aaaaccagct gtgtcttttg
     4021 attatcttat tagagaggct aagactagag ttttagtcgt cgttaattcc caagatgtct
     4081 ataagagtct taccatagtt gacattccac agagtttgac tttttcatat gatgggttac
     4141 gtggcgcaat acgtaaagct aaagattatg gttttactgt ttttgtgtgc acagacaact
     4201 ctgctaacac taaagttctt aggaacaagg gtgttgatta tactaagaag tttcttacag
     4261 ttgacggtgt gcaatattat tgctacacgt ctaaggacac tttagatgat atcttacaac
     4321 aggctaataa gtctgttggt attatatcta tgcctttggg atatgtgtct catggtttag
     4381 acttaattca agcagggagt gtcgtgcgta gagttaacgt gccctacgtg tgtctcctag
     4441 ctaataaaga gcaagaagct attttgatgt ctgaagacgt taagttaaac ccttcagaag
     4501 attttataaa gcacgtccgc actaatggtg gttacaattc ttggcattta gtcgagggtg
     4561 aactattggt gcaagactta cgcttaaata agctcctgca ttggtctgat caaaccatat
     4621 gctacaagga tagtgtgttt tatgttgtaa agaatagtac agcttttcca tttgaaacac
     4681 tttcagcatg tcgtgcgtat ttggattcac gcacgacaca gcagttaaca atcgaagtct
     4741 tagtgactgt cgatggtgta aattttagaa cagtcgttct aaataataag aacacttata
     4801 gatcacagct tggatgcgtt ttctttaatg gtgctgatat ttctgatacc attcctgatg
     4861 agaaacagaa tggtcacagt ttatatctag cagacaattt gactgctgat gaaacaaagg
     4921 cgcttaaaga gttatatggc cccgttgatc ctactttctt acacagattc tattcactta
     4981 aggctgcagt ccataagtgg aagatggttg tgtgtgataa ggtacgttct ctcaaattga
     5041 gtgataataa ttgttatctt aatgcagtta ttatgacact tgatttattg aaggacatta
     5101 aatttgttat acctgctcta cagcatgcat ttatgaaaca taagggcggt gattcaactg
     5161 acttcatagc cctcattatg gcttatggca attgcacatt tggtgctcca gatgatgcct
     5221 ctcggttact tcataccgtg cttgcaaagg ctgagttatg ctgttctgca cgcatggttt
     5281 ggagagagtg gtgcaatgtc tgtggcataa aagatgttgt tctacaaggc ttaaaagctt
     5341 gttgttacgt gggtgtgcaa actgttgaag atctgcgtgc tcgcatgaca tatgtatgcc
     5401 agtgtggtgg tgaacgtcat cggcaaatag tcgaacacac caccccctgg ttgctgctct
     5461 caggcacacc aaatgaaaaa ttggtgacaa cctccacggc gcctgatttt gtagcgttta
     5521 atgtctttca gggcattgaa acggctgttg gccattatgt tcatgctcgc ctgaagggtg
     5581 gtcttatttt aaagtttgac tctggcaccg ttagcaagac ttcagactgg aagtgcaagg
     5641 tgacagatgt acttttcccc ggccaaaaat acagtagcga ttgtaatgtc gtacggtatt
     5701 ctttggacgg taatttcaga acagaggttg atcccgacct atctgctttc tatgttaagg
     5761 atggtaaata ctttacaagt gaaccacccg taacatattc accagctaca attttagctg
     5821 gtagtgtcta cactaatagc tgccttgtat cgtctgatgg acaacctggc ggtgatgcta
     5881 ttagtttgag ttttaataac cttttagggt ttgattctag taaaccagtc actaagaaat
     5941 acacttactc cttcttgcct aaagaagacg gcgatgtgtt gttggctgag tttgacactt
     6001 atgaccctat ttataagaat ggtgccatgt ataaaggcaa accaattctt tgggtcaaca
     6061 aagcatctta tgatactaat cttaataagt tcaatagagc tagtttgcgt caaatttttg
     6121 acgtagcccc cattgaactc gaaaataaat tcacaccttt gagtgtggcg tccacaccag
     6181 ttgaacctcc aactgtagat gtggtagcac ttcaacagga aatgacaatt gtcaaatgta
     6241 agggtttaaa taaacctttc gtgaaggaca atgtcagttt cgttgttgat gactcaggta
     6301 ctcccgttgt tgagtatctg tctaaagaag atctacatac attgtatgta gaccctaagt
     6361 atcaagtcat tgtcttaaaa gacaatgtac tttcttctat gcttagattg cacaccgttg
     6421 agtcaggtga tattaacgtt gttgcagctt ccggatcttt gacacgtaaa gtgaagttac
     6481 tatttagggc ttcattttat ttcaaagaat ttgctacccg cactttcact gctaccactg
     6541 ctgtaggtag ttgtataaag agtgtagtgc ggcatctagg tgttactaaa ggcatattga
     6601 caggctgttt tagttttgtc aagatgttat ttattcttcc actagcttac tttagtgatt
     6661 caaaactcgg caccacagag gttaaagtga gtgctttgaa aacagctggc gttgtgacag
     6721 gtaatgttgt aaaacagtgt tgcactgctg ctgttgattt aagtatggat aagttgcgcc
     6781 gtgtggattg gaaatcaacc ctacggttgt tacttatgtt atgcacaact atggtattgt
     6841 tgtcttctgt gtatcacttg tatgtcttca atcaggtctt atcaagtgat gttatgtttg
     6901 aagatgccca aggtttgaaa aagttctaca aagaagttag agcttaccta ggaatctctt
     6961 ctgcttgtga cggtcttgct tcagcttata gggcgaattc atttgatgta cctacattct
     7021 gcgcaaaccg ttctgcaatg tgtaattggt gcttgattag ccaagattcc ataactcact
     7081 acccagctct taagatggtt caaacacatc ttagccacta tgttcttaac atagattggt
     7141 tgtggtttgc atttgagact ggtttggcat acatgctcta tacctcggcc ttcaactggt
     7201 tgttgttggc aggtacattg cattatttct ttgcacagac ttccatattt gtagactggc
     7261 ggtcatacaa ttatgctgtg tctagtgcct tctggttatt cacccacatt ccaatggcgg
     7321 gtttggtacg aatgtataat ttgttagcat gcctttggct tttacgcaag ttttatcagc
     7381 atgtaatcaa tggttgcaaa gatacggcat gcttgctctg ctataagagg aaccgactta
     7441 ctagagttga agcttctacc gttgtctgtg gtggaaaacg tacgttttat atcacagcaa
     7501 atggcggtat ttcattctgt cgtaggcata attggaattg tgtggattgt gacattgcag
     7561 gtgtggggaa taccttcatc tgtgaagaag tcgcaaatga cctcactacc gccctacgca
     7621 ggcctattaa cgctacggat agatcacatt attatgtgga ttccgttaca gttaaagaga
     7681 ctgttgttca gtttaattat cgtagagacg gtcaaccatt ctacgagcgg tttcccctct
     7741 gcgcttttac aaatctagat aagttgaagt tcaaagaggt ctgtaaaact actactggta
     7801 tacctgaata caactttatc atctacgact catcagatcg tggccaggaa agtttagcta
     7861 ggtctgcatg tgtttattat tctcaagtct tgtgtaaatc aattcttttg gttgactcaa
     7921 gtttggttac ttctgttggt gattctagtg aaatcgccac taaaatgttt gattcctttg
     7981 ttaatagttt cgtctcgctg tataatgtca cacgcgataa gttggaaaaa cttatctcta
     8041 ctgctcgtga tggcgtaagg cgaggcgata acttccatag tgtcttaaca acattcattg
     8101 acgcagcacg aggccccgca ggtgtggagt ctgatgttga gaccaatgaa attgttgact
     8161 ctgtgcagta tgctcataaa catgacatac aaattactaa tgagagttac aataattatg
     8221 taccctcata tgttaaacct gatagtgtgt ctaccagtga tttaggtagt ctcattgatt
     8281 gtaatgcggc ttcagttaac caaattgtct tgcgtaattc taatggtgct tgtatttgga
     8341 acgctgctgc atatatgaaa ctctcggatg cacttaaacg acagattcgc attgcatgcc
     8401 ataagtgtaa tttagctttc cggttaacca cctcaaagct acgcgctaat gataatatct
     8461 tatcagttag attcactgct aacaaaattg ttggtggtgc tcctacatgg tttaatgtgt
     8521 tgcgtgactt tacgttaaag ggttacgttc ttgctaccat tattgtgttt ctgtgtgctg
     8581 tactgatgta tttgtgttta cctacatttt ctatggtacc tgttgaattt tatgaagacc
     8641 gcatcttgga ctttaaagtt cttgataatg gtatcattag ggatgtaaat cctgatgata
     8701 agtgctttgc taataagcac cggtccttca cacaatggta tcatgagcat gttggtggtg
     8761 tctatgacaa ctctatcaca tgcccattga cagttgcagt aattgctgga gttgctggtg
     8821 ctcgcattcc agacgtacct actacattgg cttgggtgaa caatcagata attttctttg
     8881 tttctcgagt ctttgctaat acaggcagtg tttgctacac tcctatagat gagataccct
     8941 ataagagttt ctctgatagt ggttgcattc ttccatctga gtgcactatg tttagggatg
     9001 cagagggccg tatgacacca tactgccatg atcctactgt tttgcctggg gcttttgcgt
     9061 acagtcagat gaggcctcat gttcgttacg acttgtatga tggtaacatg tttattaaat
     9121 ttcctgaagt agtatttgaa agtacactta ggattactag aactctgtca actcagtact
     9181 gccggttcgg tagttgtgag tatgcacaag agggtgtttg tattaccaca aatggctcgt
     9241 gggccatttt taatgaccac catcttaata gacctggtgt ctattgtggc tctgatttta
     9301 ttgacattgt caggcggtta gcagtatcac tgttccagcc tattacttat ttccaattga
     9361 ctacctcatt ggtcttgggt ataggtttgt gtgcattcct gactttgctc ttctattata
     9421 ttaataaagt aaaacgtgct tttgcagatt acacccagtg tgctgtaatt gctgttgttg
     9481 ctgctgttct taatagcttg tgcatctgct ttgttgcctc tataccattg tgtatagtac
     9541 cttacactgc attgtactat tatgctacat tctattttac taatgagcct gcatttatta
     9601 tgcatgtttc ttggtacatt atgttcgggc ctatcgttcc catatggatg acctgcgtct
     9661 atacagttgc aatgtgcttt agacacttct tctgggtttt agcttatttt agtaagaaac
     9721 atgtagaagt ttttactgat ggtaagctta attgtagttt ccaggacgct gcctctaata
     9781 tctttgttat taacaaggac acttatgcag ctcttagaaa ctctttaact aatgatgcct
     9841 attcacgatt tttggggttg tttaacaagt ataagtactt ctctggtgct atggaaacag
     9901 ccgcttatcg tgaagctgca gcatgtcatc ttgctaaagc cttacaaaca tacagcgaga
     9961 ctggtagtga tcttctttac caaccaccca actgtagcat aacctctggc gtgttgcaaa
    10021 gcggtttggt gaaaatgtca catcccagtg gagatgttga ggcttgtatg gttcaggtta
    10081 cctgcggtag catgactctt aatggtcttt ggcttgacaa cacagtctgg tgcccacgac
    10141 acgtaatgtg cccggctgac cagttgtctg atcctaatta tgatgccttg ttgatttcta
    10201 tgactaatca tagtttcagt gtgcaaaaac acattggcgc tccagcaaac ttgcgtgttg
    10261 ttggtcatgc catgcaaggc actcttttga agttgactgt cgatgttgct aaccctagca
    10321 ctccagccta cacttttaca acagtgaaac ctggcgcagc atttagtgtg ttagcatgct
    10381 ataatggtcg tccgactggt acattcactg ttgtaatgcg ccctaactac acaattaagg
    10441 gttcctttct gtgtggttct tgtggtagtg ttggttacac caaggagggt agtgtgatca
    10501 atttttgtta catgcatcaa atggaacttg ctaatggtac acataccggt tcagcatttg
    10561 atggtactat gtatggtgcc tttatggata aacaagtgca ccaagttcag ttaacagaca
    10621 aatactgcag tgttaatgta gtagcttggc tttacgcagc aatacttaat ggttgcgctt
    10681 ggtttgtaaa acctaatcgc actagtgttg tttcttttaa tgaatgggct cttgccaacc
    10741 aattcactga atttgttggc actcaatccg ttgacatgtt agctgtcaaa acaggcgttg
    10801 ctattgaaca gctgctttat gcgatccaac aactttatac tgggttccag ggaaagcaaa
    10861 tccttggcag tactatgttg gaagatgaat tcacacctga ggatgttaat atgcagatta
    10921 tgggtgtggt tatgcagagt ggtgtgagaa aagttacata tggtactgcg cattggttgt
    10981 tcgcgaccct tgtctcaacc tatgtgataa tcttacaagc cactaaattt actttgtgga
    11041 actacttgtt tgagactatt cccacacagt tgttcccact cttatttgtg actatggcct
    11101 tcgttatgtt gttggttaaa cacaaacaca cctttttgac acttttcttg ttgcctgtgg
    11161 ctatttgttt gacttatgca aacatagtct acgagcccac tactcccatt tcgtcagcgc
    11221 tgattgcagt tgcaaattgg cttgccccca ctaatgctta tatgcgcact acacatactg
    11281 atattggtgt ctacattagt atgtcacttg tattagtcat tgtagtgaag agattgtaca
    11341 acccatcact ttctaacttt gcgttagcat tgtgcagtgg tgtaatgtgg ttgtacactt
    11401 atagcattgg agaagcctca agccccattg cctatctggt ttttgtcact acactcacta
    11461 gtgattatac gattacagtc tttgttactg tcaaccttgc aaaagtttgc acttatgcca
    11521 tctttgctta ctcaccacag cttacacttg tgtttccgga agtgaagatg atacttttat
    11581 tatacacatg tttaggtttc atgtgtactt gctattttgg tgtcttctct cttttgaacc
    11641 ttaagcttag agcacctatg ggtgtctatg actttaaggt ctcaacacaa gagttcagat
    11701 tcatgactgc taacaatcta actgcaccta gaaattcttg ggaggctatg gctctgaact
    11761 ttaagttaat aggtattggc ggtacacctt gtataaaggt tgctgctatt cagtctaaac
    11821 ttacagatct taaatgcaca tctgtggttc tcctctctgt gctccaacag ttacacttag
    11881 aggctaatag tagggcctgg gctttctgtg ttaaatgcca taatgatata ttggcagcaa
    11941 cagaccccag tgaggctttc gagaaattcg taagtctctt tgccacttta atgacttttt
    12001 ctggtaatgt agatcttgat gcgttagcta gtgatatttt tgacactcct agcgtacttc
    12061 aagctactct ttctgagttt tcacacttag ctacctttgc tgagttggaa gctgcgcaga
    12121 aagcctatca ggaagctatg gactctggtg acacctcacc acaagttctt aaggctttgc
    12181 agaaggctgt taatatagct aaaaacgcct atgagaagga taaggcagtg gcccgtaagt
    12241 tagaacgtat ggctgatcag gctatgactt ctatgtataa gcaagcacgt gctgaagaca
    12301 agaaagcaaa aattgtcagt gctatgcaaa ctatgttgtt tggtatgatt aagaagctcg
    12361 acaacgatgt tcttaatggt atcatttcta acgctaggaa tggttgtata cctcttagtg
    12421 tcattccact gtgtgcttca aataaacttc gcgttgtaat tcctgacttc accgtctgga
    12481 atcaggtagt cacatatccc tcgcttaact acgctggggc tttgtgggac attacagtta
    12541 taaacaatgt ggacaatgaa attgttaagt cttcagatgt tgtagacagc aatgaaaatt
    12601 taacatggcc acttgtttta gaatgcacta gggcatccac ttctgccgtt aagttgcaaa
    12661 ataatgagat caaaccttca ggtttaaaaa ccatggttgt gtctgcaggt caagagcaaa
    12721 ctaactgtaa tactagttcc ttagcttatt acgaacctgt gcagggtcgt aaaatgctga
    12781 tggctcttct ttctgataat gcctatctca aatgggcgcg tgttgaaggt aaggacggat
    12841 ttgttagtgt agagctacaa cctccttgca aattcttgat tgcgggacca aaaggacctg
    12901 aaatccgata tctctatttt gttaaaaatc ttaacaacct tcatcgcggg caagtgttag
    12961 ggcacattgc tgcgactgtt agattgcaag ctggttctaa caccgagttt gcctctaatt
    13021 cttcggtgtt gtcacttgtt aacttcaccg ttgatcctca aaaagcttat ctcgatttcg
    13081 tcaatgcggg aggtgcccca ttgacaaatt gtgttaagat gcttactcct aaaactggta
    13141 caggtatagc tatatctgtt aaaccagaga gtacagctga tcaagagact tatggtggag
    13201 cttcagtgtg tctctattgc cgtgcgcata tagaacatcc tgatgtctct ggtgtttgta
    13261 aatataaggg taagtttgtc caaatccctg ctcagtgtgt ccgtgaccct gtgggatttt
    13321 gtttgtcaaa taccccctgt aatgtctgtc aatattggat tggatatggg tgcaattgtg
    13381 actcgcttag gcaagtagca ctgccccaat ctaaagattc caatttttta aacgagtccg
    13441 gggttctatt gtaaatgccc gaatagaacc ctgttcaagt ggtttgtcca ctgatgtcgt
    13501 ctttagggca tttgacatct gcaactataa ggctaaggtt gctggtattg gaaaatacta
    13561 caagactaat acttgtaggt ttgtagaatt agatgaccaa gggcatcatt tagactccta
    13621 ttttgtcgtt aagaggcata ctatggagaa ttatgaacta gagaagcact gttacgattt
    13681 gttacgtgac tgtgatgctg tagctcccca tgatttcttc atctttgatg tagacaaagt
    13741 taaaacacct catattgtac gtcagcgttt aactgagtac actatgatgg atcttgtata
    13801 tgccctgagg cactttgatc aaaatagcga agtgcttaag gctatcttag tgaagtatgg
    13861 ttgctgtgat gttacctact ttgaaaataa actctggttt gattttgttg aaaatcccag
    13921 tgttattggt gtttatcata aacttggaga acgtgtacgc caagctatct taaacactgt
    13981 taaattttgt gaccacatgg tcaaggctgg tttagtcggt gtgctcacac tagacaacca
    14041 ggaccttaat ggcaagtggt atgattttgg tgacttcgta atcactcaac ctggttcagg
    14101 agtagctata gttgatagct actattctta tttgatgcct gtgctctcaa tgaccgattg
    14161 tctggccgct gagacacata gggattgtga ttttaataaa ccactcattg agtggccact
    14221 tactgagtat gattttactg attataaggt acaactcttt gagaagtact ttaaatattg
    14281 ggatcagacg tatcacgcaa attgcgttaa ttgtactgat gaccgttgtg tgttacattg
    14341 tgctaatttc aatgtattgt ttgctatgac catgcctaag acttgtttcg gacccatagt
    14401 ccgaaagatc tttgttgatg gcgtgccatt tgtagtatct tgtggttatc actacaaaga
    14461 attaggttta gtcatgaata tggatgttag tctccataga cataggctct ctcttaagga
    14521 gttgatgatg tatgccgctg atccagccat gcacattgcc tcctctaacg cttttcttga
    14581 tttgaggaca tcatgtttta gtgtcgctgc acttacaact ggtttgactt ttcaaactgt
    14641 gcggcctggc aattttaacc aagacttcta tgatttcgtg gtatctaaag gtttctttaa
    14701 ggagggctct tcagttacgc tcaaacattt tttctttgct caagatggta atgctgctat
    14761 tacagattat aattactatt cttataatct gcctactatg tgtgacatca aacaaatgtt
    14821 gttctgcatg gaagttgtaa acaagtactt cgaaatctat gacggtggtt gtcttaatgc
    14881 ttctgaagtg gttgttaata atttagacaa gagtgctggc catcctttta ataagtttgg
    14941 caaagctcgt gtctattatg agagcatgtc ttaccaggag caagatgaac tctttgccat
    15001 gacaaagcgt aacgtcattc ctaccatgac tcaaatgaat ctaaaatatg ctattagtgc
    15061 taagaataga gctcgcactg ttgcaggcgt gtccatactt agcacaatga ctaatcgcca
    15121 gtaccatcag aaaatgctta agtccatggc tgcaactcgt ggagcgactt gcgtcattgg
    15181 tactacaaag ttctatggtg gctgggattt catgcttaaa acattgtaca aagatgttga
    15241 taatccgcat cttatgggtt gggattaccc taagtgtgat agagctatgc ctaatatgtg
    15301 tagaatcttc gcttcactca tattagctcg taaacatggc acttgttgta ctacaaggga
    15361 cagattttat cgcttggcaa atgagtgtgc tcaggtgcta agcgaatatg ttctatgtgg
    15421 tggtggttac tacgtcaaac ctggaggtac cagtagcgga gatgccacca ctgcatatgc
    15481 caatagtgtc tttaacattt tgcaggcgac aactgctaat gtcagtgcac ttatgggtgc
    15541 taatggcaac aagattgttg acaaagaagt taaagacatg cagtttgatt tgtatgtcaa
    15601 tgtttacagg agcactagcc cagaccccaa atttgttgat aaatactatg cttttcttaa
    15661 taagcacttt tctatgatga tactgtctga tgacggtgtc gtttgctata atagtgatta
    15721 tgcagctaag ggttacattg ctggaataca gaattttaag gaaacgctgt attatcagaa
    15781 caatgtcttt atgtctgaag ctaaatgctg ggtggaaacc gatctgaaga aagggccaca
    15841 tgaattctgt tcacagcata cgctttatat taaggatggc gacgatggtt acttccttcc
    15901 ttatccagac ccttcaagaa ttttgtctgc cggttgcttt gtagatgata tcgttaagac
    15961 tgacggtaca ctcatggtag agcggtttgt gtctttggct atagatgctt accctctcac
    16021 aaagcatgaa gatatagaat accagaatgt attctgggtc tacttacagt atatagaaaa
    16081 actgtataaa gaccttacag gacacatgct tgacagttat tctgtcatgc tatgtggtga
    16141 taattctgct aagttttggg aagaggcatt ctacagagat ctctatagtt cgcctaccac
    16201 tttgcaggct gtcggttcat gcgttgtatg ccattcacag acttctctac gctgtgggac
    16261 atgcatccgt agaccatttc tctgctgtaa atgctgctat gatcatgtta tagcaactcc
    16321 acataagatg gttttgtctg tttctcctta cgtttgtaat gcccctggtt gtggcgtttc
    16381 agacgttact aagctatatt taggtggtat gagctacttt tgtgtagatc atagacctgt
    16441 gtgtagtttt ccactttgcg ctaatggtct tgtattcggc ttatacaaga atatgtgcac
    16501 aggtagtcct tctatagttg aatttaatag gttggctacc tgtgactgga ctgaaagtgg
    16561 tgattacacc cttgccaata ctacaacaga accactcaaa ctttttgctg ctgagacttt
    16621 acgtgccact gaagaggcgt ctaagcagtc ttatgctatt gccaccatca aagaaattgt
    16681 tggtgagcgc caactattac ttgtgtggga ggctggcaag tccaaaccac cactcaatcg
    16741 taattatgtt tttactggtt atcatataac caaaaatagt aaagtgcagc tcggtgagta
    16801 catcttcgag cgcattgatt atagtgatgc tgtatcctac aagtctagta caacgtataa
    16861 actgactgta ggkgacatcw tcgtacttac ctctcactct gtggctacct tgacggcgcc
    16921 cacaattgtg aatcaagaga ggtatgttaa aattactggg ttgtacccaa ccattacggt
    16981 acctgaagag ttcgcaagtc atgttgccaa cttccaaaaa tcaggttata gtaaatatgt
    17041 cactgttcag ggaccacctg gcactggcaa aagtcatttt gctatagggt tagcgattta
    17101 ctaccctaca gcacgtgttg tttatacagc atgttcacac gcagctgttg atgctttgtg
    17161 tgaaaaagct tttaaatatt tgaacattgc taaatgttcc cgtatcattc ctgcaaaggc
    17221 acgtgttgag tgctatgaca ggtttaaagt taatgagaca aattctcaat atttgtttag
    17281 tactattaat gctctaccag aaacttctgc cgatattctg gtggttgatg aggttagtat
    17341 gtgcactaat tatgatcttt caattattaa tgcacgtatt aaagctaagc acattgtcta
    17401 tgtaggagat ccagcacagt tgccagctcc taggactttg ttgactagag gcacattgga
    17461 accagaaaat ttcaatagtg tcactagatt gatgtgtaac ttaggtcctg acatattttt
    17521 aagtatgtgc tacaggtgtc ctaaggaaat agtaagcact gtgagcgctc ttgtctacaa
    17581 taataaattg ttagccaaga aggagctttc aggccagtgc tttaaaatac tctataaggg
    17641 caatgtgacg catgatgcta gctctgccat taatagacca caactcacat ttgtgaagaa
    17701 ttttattact gccaatccgg catggagtaa ggcagtcttt atttcgcctt ataattcaca
    17761 gaatgctgtg gctcgttcaa tgctgggtct tactactcag actgttgatt cctcacaggg
    17821 ttcagaatac cagtacgtta tcttctgtca aacagcagat acggcacatg ctaacaacat
    17881 taacagattt aatgttgcaa tcactcgtgc ccaaaaaggt attctttgtg ttatgacatc
    17941 tcaggcactc tttgagtcct tagagtttac tgaattgtct tttactaatt acaagctcca
    18001 gtctcagatt gtaactggcc tttttaaaga ttgctctaga gaaacttctg gcctctcacc
    18061 tgcttatgca ccaacatacg ttagtgttga tgacaagtat aagacgagtg atgagctttg
    18121 cgtgaatctt aatttacccg caaatatccc atactctcgt gttatttcca ggatgggctt
    18181 taaactcgat gcaacagttc ctggatatcc taagcttttc attactcgtg aagaggctgt
    18241 aaggcaagtt cgaagctgga taggcttcga tgttgagggt gctcatgctt cccgtaatgc
    18301 atgtggcacc aatgtgcctc tacaattagg attttcaact ggtgtgaact ttgttgttca
    18361 gccagttggt gttgtagaca ctgagtgggg taacatgtta acgggcattg ctgcccgtcc
    18421 tccaccaggt gaacagttta agcacctcgt gcctcttatg cataaggggg ctgcgtggcc
    18481 tattgttaga cgacgtatag tgcaaatgtt gtcagacact ttagacaaat tgtctgatta
    18541 ctgtacgttt gtttgttggg ctcatggctt tgaattaacg tctgcatcat acttttgcaa
    18601 gataggtaag gaacagaagt gttgcatgtg caatagacgc gctgcagcgt actcttcacc
    18661 tctgcaatct tatgcctgct ggactcattc ctgcggttat gattatgtct acaacccttt
    18721 ctttgtcgat gttcaacagt ggggttatgt aggcaatctt gctactaatc acgatcgtta
    18781 ttgctctgtc catcaaggag ctcatgtggc ttctaatgat gcaataatga ctcgttgttt
    18841 agctattcat tcttgtttta tagaacgtgt ggattgggat atagagtatc cttatatctc
    18901 acatgaaaag aaattgaatt cctgttgtag aatcgttgag cgcaacgtcg tacgtgctgc
    18961 tcttcttgcc ggttcatttg acaaagtcta tgatattggc aatcctaaag gaattcctat
    19021 tgttgatgac cctgtggttg attggcatta ttttgatgca cagcccttga ccagaaaggt
    19081 acaacagctt ttctatacag aggacatggc ctcaagattt gctgatgggc tctgcttatt
    19141 ttggaactgt aatgtaccaa aatatcctaa taatgcaatt gtatgcaggt ttgacacacg
    19201 tgtgcattct gagttcaatt tgccaggttg tgatggcggt agtttgtatg ttaacaagca
    19261 cgcttttcat acaccagcat atgatgtgag tgcattccgt gatctgaaac ctttaccatt
    19321 cttttattat tctactacac catgtgaagt gcatggtaat ggtagtatga tagaggatat
    19381 tgattatgta cccctaaaat ctgcagtctg tattacagct tgtaatttag ggggcgctgt
    19441 ttgtaggaag catgctacag agtacagaga gtatatggaa gcatataatc ttgtctctgc
    19501 atcaggtttc cgcctttggt gttataagac ctttgatatt tataatctct ggtctacttt
    19561 tacaaaagtt caaggtttgg aaaacattgc ttttaatgtt gttaaacaag gccattttat
    19621 tggtgttgag ggtgaactac ctgtagctgt agtcaatgat aagatcttca ccaagagtgg
    19681 cgttaatgac atttgtatgt ttgagaataa aaccactttg cctactaata tagcttttga
    19741 actctatgct aagcgtgctg tacgctcgca tcccgatttc aaattgctac acaatttaca
    19801 agcagacatt tgctacaagt tcgtcctttg ggattatgaa cgtagcaata tttatggtac
    19861 tgctactatt ggtgtatgta agtacactga tattgatgtt aattcagctt tgaatatatg
    19921 ttttgacata cgcgataatg gttcattgga gaagttcatg tctactccca atgccatctt
    19981 tatttctgat agaaaaatta agaaataccc ttgtattgta ggtcctgatt atgcttactt
    20041 caatggtgct atcatccgtg atagtgatgt tgttaaacaa ccagtgaagt tctacttgta
    20101 taagaaagtc aataatgagt ttattgatcc tactgagtgt atttacactc agagtcgctc
    20161 ttgtagtgac ttcctacccc tgtctgacat ggagaaagac tttctatctt ttgatagtga
    20221 tgttttcatt aagaagtatg gcttggaaaa ctatgctttt gagcacgtag tctatggaga
    20281 cttctctcat actacgttag gcggtcttca cttgcttatt ggtttataca agaagcaaca
    20341 ggaaggtcat attattatgg aagaaatgct aaaaggtagc tcaactattc ataactattt
    20401 tattactgag actaacacag cggcttttaa ggcggtgtgt tctgttatag atttaaagct
    20461 tgacgacttt gttatgattt taaagagtca agaccttggc gtagtatcca aggttgtcaa
    20521 ggttcctatt gacttaacaa tgattgagtt tatgttatgg tgtaaggatg gacaggttca
    20581 aaccttctac cctcgactcc aggcttctgc agattggaaa cctggtcatg caatgccatc
    20641 cctctttaaa gttcaaaatg taaaccttga acgttgtgag cttgctaatt acaagcaatc
    20701 tattcctatg cctcgcggtg tgcacatgaa catcgctaaa tatatgcaat tgtgccagta
    20761 tttaaatact tgcacattag ccgtgcctgc caatatgcgt gttatacatt ttggcgctgg
    20821 ttctgataaa ggtatcgctc ctggtacatc agttttacga cagtggcttc ctacagatgc
    20881 cattattata gataatgatt taaatgagtt cgtgtcagat gctgacataa ctttatttgg
    20941 agattgtgta actgtacgtg tcggccaaca agtggatctt gttatttccg acatgtatga
    21001 tcctactact aagaatgtaa caggtagtaa tgagtcaaag gctttattct ttacttacct
    21061 gtgtaacctc attaataata atcttgctct tggtgggtct gttgctatta aaataacaga
    21121 acactcttgg agcgttgaac tttatgaact tatgggaaaa tttgcttggt ggactgtttt
    21181 ctgcaccaat gcaaatgcat cctcatctga aggattcctc ttaggtatta attacttggg
    21241 tactattaaa gaaaatatag atggtggtgc tatgcacgcc aactatatat tttggagaaa
    21301 ttccactcct atgaatctga gtacttactc actttttgat ttatccaagt ttcaattaaa
    21361 attaaaagga acaccagttc ttcaattaaa ggagagtcaa attaacgaac tcgtaatatc
    21421 tctcctgtcg cagggtaagt tacttatccg tgacaatgat acactcagtg tttctactga
    21481 tgttcttgtt aacacctaca gaaagttacg ttgatgtagg gccagattct gttaagtctg
    21541 cttgtattga ggttgatata caacagactt tctttgataa aacttggcct aggccaattg
    21601 atgtttctaa ggctgacggt attatatacc ctcaaggccg tacatattct aacataacta
    21661 tcacttatca aggtcttttt ccctatcagg gagaccatgg tgatatgtat gtctactctg
    21721 caggacatgc tacaggcaca actccacaaa agttgtttgt agctaactat tctcaggacg
    21781 tcaaacagtt tgctaatggg tttgtcgtcc gtataggagc agctgccaat tccactggca
    21841 ctgttattat tagcccatct accagcgcta ctatacgaaa aatttaccct gcttttatgc
    21901 tgggttcttc agttggtaat ttctcagatg gtaaaatggg ccgcttcttc aatcatactc
    21961 tagttctttt gcccgatgga tgtggcactt tacttagagc tttttattgt attctagagc
    22021 ctcgctctgg aaatcattgt cctgctggca attcctatac ttcttttgcc acttatcaca
    22081 ctcctgcaac agattgttct gatggcaatt acaatcgtaa tgccagtctg aactctttta
    22141 aggagtattt taatttacgt aactgcacct ttatgtacac ttataacatt accgaagatg
    22201 agattttaga gtggtttggc attacacaaa ctgctcaagg tgttcacctc ttctcatctc
    22261 ggtatgttga tttgtacggc ggcaatatgt ttcaatttgc caccttgcct gtttatgata
    22321 ctattaagta ttattctatc attcctcaca gtattcgttc tatccaaagt gatagaaaag
    22381 cttgggctgc cttctacgta tataaacttc aaccgttaac tttcctgttg gatttttctg
    22441 ttgatggtta tatacgcaga gctatagact gtggttttaa tgatttgtca caactccact
    22501 gctcatatga atccttcgat gttgaatctg gagtttattc agtttcgtct ttcgaagcaa
    22561 aaccttctgg ctcagttgtg gaacaggctg aaggtgttga atgtgatttt tcacctcttc
    22621 tgtctggcac acctcctcag gtttataatt tcaagcgttt ggtttttacc aattgcaatt
    22681 ataatcttac caaattgctt tcactttttt ctgtgaatga ttttacttgt agtcaaatat
    22741 ctccagcagc aattgctagc aactgttatt cttcactgat tttggattat ttttcatacc
    22801 cacttagtat gaaatccgat ctcagtgtta gttctgctgg tccaatatcc cagtttaatt
    22861 ataaacagtc cttttctaat cccacatgtt tgattttagc gactgttcct cataacctta
    22921 ctactattac taagcctctt aagtacagct atattaacaa gtgctctcgt cttctttctg
    22981 atgatcgtac tgaagtacct cagttagtga acgctaatca atactcaccc tgtgtatcca
    23041 ttgtcccatc cactgtgtgg gaagacggtg attattatag gaaacaacta tctccacttg
    23101 aaggtggtgg ctggcttgtt gctagtggct caactgttgc catgactgag caattacaga
    23161 tgggctttgg tattacagtt caatatggta cagacaccaa tagtgtttgc cccaagcttg
    23221 aatttgctaa tgacacaaaa attgcctctc aattaggcaa ttgcgtggaa tattccctct
    23281 atggtgtttc gggccgtggt gtttttcaga attgcacagc tgtaggtgtt cgacagcagc
    23341 gctttgttta tgatgcgtac cagaatttag ttggctatta ttctgatgat ggcaactact
    23401 actgtttgcg tgcttgtgtt agtgttcctg tttctgtcat ctatgataaa gaaactaaaa
    23461 cccacgctac tctatttggt agtgttgcat gtgaacacat ttcctctacc atgtctcaat
    23521 actcccgttc tacgcgatca atgcttaaac ggcgagattc tacatatggt ccccttcaga
    23581 cacctgttgg ttgtgtccta ggacttgtta attcctcttt gttcgtagag gactgcaagt
    23641 tgcctcttgg tcaatctctc tgtgctcttc ctgacacacc tagtactctc acacctcgca
    23701 gtgtgcgctc tgttccaggt gaaatgcgct tggcatccat tgcttttaat catcctattc
    23761 aggttgatca acttaatagt agttatttta aattaagtat acctactaat ttttcctttg
    23821 gtgtgactca ggagtacatt cagacaacca ttcagaaagt tactgttgat tgtaaacagt
    23881 acgtttgcaa tggtttccag aagtgtgagc aattactgcg cgagtatggc cagttttgtt
    23941 ccaaaataaa ccaggctctc catggtgcca atttacgcca ggatgattct gtacgtaatt
    24001 tgtttgcgag cgtgaaaagc tctcaatcat ctcctatcat accaggtttt ggaggtgact
    24061 ttaatttgac acttctagaa cctgtttcta tatctactgg cagtcgtagt gcacgtagtg
    24121 ctattgagga tttgctattt gacaaagtca ctatagctga tcctggttat atgcaaggtt
    24181 acgatgattg tatgcagcaa ggtccagcat cagctcgtga tcttatttgt gctcaatatg
    24241 tggctggtta taaagtatta cctcctctta tggatgttaa tatggaagcc gcgtacactt
    24301 catctttgct tggcagcata gcaggtgttg gctggactgc tggcttatcc tcctttgctg
    24361 ctattccatt tgcacagagt attttttata ggttaaacgg tgttggcatt actcaacagg
    24421 ttctttcaga gaaccaaaag cttattgcca ataagtttaa tcaggctctg ggagctatgc
    24481 aaacaggctt cactacaact aatgaagctt ttcggaaggt tcaggatgct gtgaacaaca
    24541 atgcacaggc tctatccaaa ttagctagcg agctatctaa tacttttggt gctatttccg
    24601 cctctattgg agacatcata caacgtcttg atgttctcga acaggacgcc caaatagaca
    24661 gacttattaa tggccgtttg acaacactaa atgcttttgt tgcacagcag cttgttcgtt
    24721 ccgaatcagc tgctctttcc gctcaattgg ctaaagataa agtcaatgag tgtgtcaagg
    24781 cacaatccaa gcgttctgga ttttgcggtc aaggcacaca tatagtgtcc tttgttgtaa
    24841 atgcccctaa tggcctttac tttatgcatg ttggttatta ccctagcaac cacattgagg
    24901 ttgtttctgc ttatggtctt tgcgatgcag ctaaccctac taattgtata gcccctgtta
    24961 atggctactt tattaaaact aataacacta ggattgttga tgagtggtca tatactggct
    25021 cgtccttcta tgcacctgag cccatcacct ctcttaatac taagtatgtt gcaccacagg
    25081 tgacatacca aaacatttct actaacctcc ctcctcctct tctcggcaat tccaccggga
    25141 ttgacttcca agatgagttg gatgagtttt tcaaaaatgt tagcaccagt atacctaatt
    25201 ttggttctct aacacagatt aatactacat tactcgatct tacctacgag atgttgtctc
    25261 ttcaacaagt tgttaaagcc cttaatgagt cttacataga ccttaaagag cttggcaatt
    25321 atacttatta caacaaatgg ccgtggtaca tttggcttgg tttcattgct gggcttgttg
    25381 ccttagctct atgcgtcttc ttcatactgt gctgcactgg ttgtggcaca aactgtatgg
    25441 gaaaacttaa gtttaatcgt tgttgtgata gatacgagga atacgacctc gagccgcata
    25501 aggttcatgt tcactaatta acgaactatc aatgagagtt caaagaccac ccactctctt
    25561 gttagtgttc tcactctctt ttttggtcac tgcattttca aaacctctct atgtacctga
    25621 gcattgtcag aattattctg gttgcatgct tagggcttgt attaaaactg cccaagctga
    25681 tacagctggt ctttatacaa attttcgaat tgacgtccca tctgcagaat caactggtac
    25741 tcaatcagtt tctgtcgatc gtgagtctac ttcaactcat gatggtctta ccgaacatgt
    25801 tactagtgtg aatctttttg acgttggtta ctcagttaat taacgaactc tatggattac
    25861 gtgtctctgc ttaatcaaat ttggcagaag taccttaatt caccgtatac tacttgtttg
    25921 tatatcccta aacccacagc taagtataca cctttagttg gcacttcatt gcaccctgtg
    25981 ctgtggaact gtcagctatc ctttgctggt tatactgaat ctgctgttaa ttctacaaaa
    26041 gctttggcca aacaggacgc agctcagcga atcgcttggt tgctacataa ggatggagga
    26101 atccctgacg gatgttccct ctacctccgg cactcaagtt tattcgcgca aagcgaggaa
    26161 gaggagtcat tctccaacta agaaactgcg ctacgttaag cgtagatttt ctcttctgcg
    26221 ccctgaagac cttagtgtta ttgtccaacc aacacactat gtcagggtta cattttcaga
    26281 ccccaacatg tggtatctac gttcgggtca tcatttacac tcagttcaca attggcttaa
    26341 accttatggc ggccaacctg tttctgagta ccatattact ctagctttgc taaatctcac
    26401 tgatgaagat ttagctagag atttttcacc cattgcgctc tttttgcgca atgtcagatt
    26461 tgagctacat gagttcgcct tgctgcgcaa aactcttgtt cttaatgcat cagagatcta
    26521 ctgtgctaac atacatagat ttaagcctgt gtatagagtt aacacggcaa tccctactat
    26581 taaggattgg cttctcgttc agggattttc cctttaccat agtggcctcc ctttacatat
    26641 gtcaatctct aaattgcatg cactggatga tgttactcgc aattacatca ttacaatgcc
    26701 atgctttaga acttatcctc aacaaatgtt tgttactcct ttggccgtag atgttgtctc
    26761 catacggtct tccaatcagg gtaataaaca aattgttcat tcttacccca ttttacatca
    26821 tccaggattt taacgaacta tggctttctc ggcgtcttta tttaaacccg tccagctagt
    26881 cccagtttct cctgcatttc atcgcattga gtctactgac tctattgttt tcacatacat
    26941 tcctgctagc ggctatgtag ctgctttagc tgtcaatgtg tgtctcattc ccctattatt
    27001 actgctacgt caagatactt gtcgtcgcag cattatcaga actatggttc tctatttcct
    27061 tgttctttat aactttttat tagccattgt actagtcaat ggtgtacatt atccaactgg
    27121 aagttgcctg atagccttct tagttatcct cataatactt tggtttgtag atagaattcg
    27181 tttctgtctc atgctgaatt cctacattcc actgtttgac atgcgttctc actttattcg
    27241 tgttagtaca gtttcttctc atggtatggt ccctgtcata cacaccaaac cattatttat
    27301 tagaaacttc gatcagcgtt gcagctgttc tcgttgtttt tatttgcact cttctactta
    27361 tatagagtgc acttatatta gccgttttag taagattagc ctagtttctg taactgactt
    27421 ctccttaaac ggcaatgttt ccactgtttt cgtgcctgca acgcgcgatt cagttcctct
    27481 tcacataatc gccccgagct cgcttatcgt ttaagcagct ctgcgctact atgggtcccg
    27541 tgtagaggct aatccattag tctctctttg gacatatgga aaacgaacta tgttaccctt
    27601 tgtccaagaa cgaatagggt tgttcatagt aaactttttc atttttaccg tagtatgtgc
    27661 tataacactc ttggtgtgta tggctttcct tacggctact agattatgtg tgcaatgtat
    27721 gacaggcttc aataccctgt tagttcagcc cgcattatac ttgtataata ctggacgttc
    27781 agtctatgta aaattccagg atagtaaacc ccctctacca cctgacgagt gggtttaacg
    27841 aactccttca taatgtctaa tatgacgcaa ctcactgagg cgcagattat tgccattatt
    27901 aaagactgga actttgcatg gtccctgatc tttctcttaa ttactatcgt actacagtat
    27961 ggatacccat cccgtagtat gactgtctat gtctttaaaa tgtttgtttt atggctccta
    28021 tggccatctt ccatggcgct atcaatattt agcgccattt atccaattga tctagcttcc
    28081 cagataatct ctggcattgt agcagctgtt tcagctatga tgtggatttc ctactttgtg
    28141 cagagtatcc ggctgtttat gagaactgga tcatggtggt cattcaatcc tgagactaat
    28201 tgccttttga acgttccaat tggtggtaca actgtcgtac gtccactcgt agaggactct
    28261 accagtgtaa ctgctgttgt aaccaatggt cacctcaaaa tggctggcat gcatttcggt
    28321 gcttgtgact acgacagact tcctaatgaa gtcaccgtgg ccaaacccaa tgtgctgatt
    28381 gctttaaaaa tggtgaagcg gcaaagctac ggaactaatt ccggcgttgc catttaccat
    28441 agatataagg caggtaatta caggagtccg cctattacgg cggatattga acttgcattg
    28501 cttcgagctt aggctcttta gtaagagtat cttaattgat tttaacgaat ctcaatttca
    28561 ttgttatggc atcccctgct gcacctcgtg ctgtttcctt tgccgataac aatgatataa
    28621 caaatacaaa cctgtctcga ggtagaggac gtaatccaaa accacgagct gcaccaaata
    28681 acactgtctc ttggtacact gggcttaccc aacacgggaa agtccctctt acctttccac
    28741 ctgggcaggg tgtacctctt aatgccaatt ccacccctgc gcaaaatgct gggtattggc
    28801 ggagacagga cagaaaaatt aataccggga atggaattaa gcaactggct cccaggtggt
    28861 acttctacta cactggaact ggacccgaag cagcactccc attccgggct gttaaggatg
    28921 gcatcgtttg ggtccatgaa gatggcgcca ctgatgctcc ttcaactttt gggacgcgga
    28981 accctaacaa tgattcagct attgttacac aattcgcgcc cggtactaag cttcctaaaa
    29041 acttccacat tgaggggact ggaggcaata gtcaatcatc ttcaagagcc tctagcgtaa
    29101 gcagaaactc ttccagatct agttcacaag gttcaagatc aggaaactct acccgcggca
    29161 cttctccagg tctatctgga atcggagcag taggaggtga tctactttac cttgatcttc
    29221 tgaacagact acaagccctt gagtctggca aagtaaagca atcgcagcca aaagtaatca
    29281 ctaagaaaga tgctgctgct gctaaaaata agatgcgcca caagcgcact tccaccaaaa
    29341 gtttcaacat ggtgcaagct tttggtcttc gcggaccagg agacctccag ggaaactttg
    29401 gtgatcttca attgaataaa ctcggcactg aggacccacg ttggccccaa attgctgagc
    29461 ttgctcctac agccagtgct tttatgggta tgtcgcaatt taaacttacc catcagaaca
    29521 atgatgatca tggcaaccct gtgtacttcc ttcggtacag tggagccatt aaacttgacc
    29581 caaagaatcc caactacaat aagtggttgg agcttcttga gcaaaatatt gatgcctaca
    29641 aaaccttccc taagaaggaa aagaaacaaa aggcaccaaa agaagaatca acagaccaaa
    29701 tgtctgaacc tccaaaggag cagcgtgtgc aaggtagcat cactcagcgc actcgcaccc
    29761 gtccaagtgt tcagcctggt ccaatgattg atgttaacac tgattagtgt cactcaaagt
    29821 aacaagatcg cggcaatcgt ttgtgtttgg taaccccatc tcaccatcgc ttgtccactc
    29881 ttgcacagaa tggaatcatg ttgtaattac agtgcaataa ggtaattata acccatttaa
    29941 ttgatagcta tgctttatta aagtgtgtag ctgtagagag aatgttaaag actgtcacct
    30001 ctgcgtgatt gcaagtgaac agtgcccccc gggaagagct ctacagtgtg aaatgtaaat
    30061 aaaaatagct attattcaat tagattaggc taattagatg atttgcaaaa

Share this post


Link to post
Share on other sites
LOCUS       KT368848               30118 bp    RNA     linear   VRL 17-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate
            camel/Jeddah/N68(b)/2014, complete genome.
ACCESSION   KT368848
VERSION     KT368848.1  GI:922058112
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 30118)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Co-circulation of three camel coronavirus species and recombination
            of MERS-CoVs in Saudi Arabia
  JOURNAL   Science (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 30118)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2015) Centre of Influenza Research & State Key
            Laboratory of Emerging Infectious Diseases, The University of Hong
            Kong, Laboratory Block, 21 Sassoon Road, Pokfulam, Hong Kong SAR,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..30118
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="camel/Jeddah/N68(b)/2014"
                     /host="camel"
                     /db_xref="taxon:1335626"
                     /country="Saudi Arabia"
                     /collection_date="Nov-2014"
     gene            279..21514
                     /gene="orf1ab"
     CDS             join(279..13433,13433..21514)
                     /gene="orf1ab"
                     /ribosomal_slippage
                     /codon_start=1
                     /product="polyprotein ORF1ab"
                     /protein_id="ALA49604.1"
                     /db_xref="GI:922058114"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGISDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACHKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAIQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
                     RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
                     RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
                     RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
                     KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
                     DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
                     VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
                     RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
                     VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
                     EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
                     MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
                     GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
                     LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
                     NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
                     AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
                     LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
                     YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
                     SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
                     FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
                     PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
                     ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
                     RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
                     RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
                     NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
                     PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
                     KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
                     SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
                     TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS
                     RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
                     FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
                     MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
                     WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
                     CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
                     DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
                     VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
                     DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
                     WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
                     TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
                     VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV
                     VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
                     ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
                     AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
                     RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
                     TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
                     DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
                     TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
                     FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
                     LSVSTDVLVNTYRKLR"
     gene            279..13454
                     /gene="orf1a"
     CDS             279..13454
                     /gene="orf1a"
                     /codon_start=1
                     /product="polyprotein ORF1a"
                     /protein_id="ALA49603.1"
                     /db_xref="GI:922058113"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGISDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACHKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAIQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
     gene            21456..25517
                     /gene="S"
     CDS             21456..25517
                     /gene="S"
                     /codon_start=1
                     /product="spike protein"
                     /protein_id="ALA49605.1"
                     /db_xref="GI:922058115"
                     /translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
                     PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
                     ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
                     MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
                     YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
                     NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
                     RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
                     PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
                     SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
                     DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
                     LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
                     VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
                     SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
                     TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
                     IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
                     QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
                     QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
                     AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
                     QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
                     SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
                     IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
                     VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
                     TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
                     TGCGTNCMGKLKFNRCCDRYEEYDLEPHKVHVH"
     gene            25532..25843
                     /gene="orf3"
     CDS             25532..25843
                     /gene="orf3"
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="ALA49606.1"
                     /db_xref="GI:922058116"
                     /translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
                     KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
                     N"
     gene            25852..26181
                     /gene="orf4a"
     CDS             25852..26181
                     /gene="orf4a"
                     /codon_start=1
                     /product="ORF4a"
                     /protein_id="ALA49607.1"
                     /db_xref="GI:922058117"
                     /translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
                     WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
                     EEESFSN"
     gene            26093..26833
                     /gene="orf4b"
     CDS             26093..26833
                     /gene="orf4b"
                     /codon_start=1
                     /product="ORF4b"
                     /protein_id="ALA49608.1"
                     /db_xref="GI:922058118"
                     /translation="MEESLTDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
                     EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
                     TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
                     PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
                     VDVVSIRSSNQGNKQIVHSYPILHHPGF"
     gene            26840..27514
                     /gene="orf5"
     CDS             26840..27514
                     /gene="orf5"
                     /codon_start=1
                     /product="ORF5"
                     /protein_id="ALA49609.1"
                     /db_xref="GI:922058119"
                     /translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
                     VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
                     ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
                     CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
                     PSSLIV"
     gene            27590..27838
                     /gene="E"
     CDS             27590..27838
                     /gene="E"
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ALA49610.1"
                     /db_xref="GI:922058120"
                     /translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
                     TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
     gene            27853..28512
                     /gene="M"
     CDS             27853..28512
                     /gene="M"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="ALA49611.1"
                     /db_xref="GI:922058121"
                     /translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
                     VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
                     MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
                     DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
                     A"
     gene            28566..29807
                     /gene="N"
     CDS             28566..29807
                     /gene="N"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="ALA49612.1"
                     /db_xref="GI:922058122"
                     /translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
                     TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
                     TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
                     HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
                     LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
                     NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
                     IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
                     TQRTRTRPSVQPGPMIDVNTD"
     gene            28762..29100
                     /gene="orf8b"
     CDS             28762..29100
                     /gene="orf8b"
                     /codon_start=1
                     /product="ORF8b"
                     /protein_id="ALA49613.1"
                     /db_xref="GI:922058123"
                     /translation="MPIPPLRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLELDPKQ
                     HSHSGLLRMASFGSMKMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
                     IVNHLQEPLA"
ORIGIN      
        1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
       61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
      121 gtggcactaa tttgcctgct catctaggca gtggacatat gctcaacact gggtataatt
      181 ctaattgaat actatttttc agttagagcg tcgtgtctct tgtacgtctc ggtcacaata
      241 tacggtttcg tccggtgcgt ggcaattcgg ggcacatcat gtctttcgtg gctggtgtga
      301 tcgcgcaagg tgcgcgcggt acgtatcgag cagcgctcaa ctctgaaaaa catcaagacc
      361 atgtgtctct aactgtgcca ctctgtggtt caggaaacct ggttgaaaaa ctttcaccat
      421 ggttcatgga tggcgaaaat gcctatgaag tggtgaaggc catgttactt aaaaaagagc
      481 cacttctcta tgtgcccatc cggctggctg gacacactag acacctccca ggtcctcgtg
      541 tgtacctggt tgagaggctc attgcttgtg aaaatccatt catggttaac caattggctt
      601 atagctctag tgcaaatggc agcctggttg gcacaacttt gcagggcaag cctattggta
      661 tgttcttccc ttatgacatc gaacttgtca caggaaagca aaatattctc ctgcgcaagt
      721 atggccgtgg tggttatcac tacaccccag tccactatga gcgagacaac acctcttgcc
      781 ctgagtggat ggacgatttt gaggcggatc ctaaaggcaa atatgcccag aatctgctta
      841 agaagttgat tggcggtgat gtcactccag ttgaccaata catgtgtggc gttgatggaa
      901 aacccattag tgcctacgca tttttaatgg ccaaggatgg aataaccaaa ctggctgatg
      961 ttgaagcgga cgtcgcagca cgtgctgatg acgaaggctt catcacatta aagaacaatc
     1021 tatatagatt ggtttggcat gttgagcgta aagacgttcc atatcctaag caatctattt
     1081 ttactattaa tagtgtggtc caaaaggatg gtgttgaaaa cactcctcct cactatttta
     1141 ctcttggatg caaaatttta acgctcaccc cacgcaacaa gtggagtggc atttctgact
     1201 tgtccctcaa acaaaaactc ctttacacct tctatggtaa ggagtcactt gagaacccaa
     1261 cctacattta ccactccgca ttcattgagt gtggaagttg tggtaatgat tcctggctta
     1321 cagggaatgc tatccaaggg tttgcctgtg gatgtggggc atcatataca gctaatgatg
     1381 tcgaagtcca atcatctggc atgattaagc caaatgctct tctttgtgct acttgcccct
     1441 ttgctaaggg tgacagctgt tcttctaatt gcaaacattc agttgctcag ttggttagtt
     1501 acctttctga acgctgtaat gttattgctg attctaagtc cttcacactt atctttggtg
     1561 gcgtagctta cgcctacttt ggatgtgagg aaggtactat gtactttgtg cctagagcta
     1621 agtctgttgt ctcaaggatt ggagactcca tctttacagg ctgtactggc tcttggaaca
     1681 aggtcactca aattgctaac atgttcttgg aacagactca gcattccctt aactttgtgg
     1741 gagagttcgt tgtcaacgat gttgtcctcg caattctctc tggaaccaca actaatgttg
     1801 acaaaatacg ccagcttctc aaaggtgtca ccattgacaa gttgcgtgat tatttagctg
     1861 actatgacgt agcagtcact gccggcccat tcatggataa tgctattaat gttggtggta
     1921 caggattaca gtatgccgcc attactgcac cttatgtagt tctcactggc ttaggtgagt
     1981 cctttaagaa agttgcaacc ataccgtaca aggtttgcaa ctctgttaag gatactctga
     2041 cttattatgc tcacagcgtg ttgtacagag tttttcctta tgacatggat tctggtgtgt
     2101 catcctttag tgaactactt tttgattgcg ttgatctttc agtagcttct acctattttt
     2161 tagtccgcct cttgcaagat aagactggcg actttatgtc tacaattatt acttcctgcc
     2221 aaactgctgt tagtaagctt ctagatacat gttttgaagc tacagaagca acatttaact
     2281 tcttgttaga tttggcagga ttgttcagaa tctttcttcg caatgcctat gtgtacactt
     2341 cacaagggtt tgtggtggtc aatggcaaag tttctacact tgtcaaacaa gtgttagact
     2401 tgcttaataa gggtatgcaa cttttgcata caaaggtctc ctgggctggt tctaatatca
     2461 gtgctgttat ctacagcggc agggagtctc taatattccc atcgggaacc tattactgtg
     2521 tcaccactaa ggctaagtcc gttcaacaag atcttgacgt tattttgcct ggtgagtttt
     2581 ccaagaagca gttaggactg ctccaaccta ctgacaattc tacaactgtt agtgttactg
     2641 tatccagtaa catggttgaa actgttgtgg gtcaacttga gcaaactaat atgcatagtc
     2701 ctgatgttat agtaggtgac tatgtcatta ttagtgaaaa attgtttgtg cgtagtaagg
     2761 aagaagacgg attcgccttc taccctgctt gcactaatgg tcatgctgta ccgactctct
     2821 ttagacttaa gggaggtgca cctgtaaaaa aagtagcctt tggcggtgat caagtacatg
     2881 aggttgctgc tgtaagaagt gttactgtcg agtacaacat tcatgctgta ttagacacac
     2941 tacttgcttc ttctagtctt agaacctttg ttgtagataa gtctttgtca attgaggagt
     3001 ttgctgacgt agtaaaggaa caagtctcag acttgcttgt taaattactg cgtggaatgc
     3061 cgattccaga ttttgattta gacgatttta ttgatgcacc atgctattgc tttaacgctg
     3121 agggtgatgc atcttggtct tctactatga tcttctctct tcaccccgtc gagtgtgacg
     3181 aggagtgttc tgaagtagag gcttcagatt tagaagaagg tgaatcagag tgcatttctg
     3241 agacttcaac tgaacaagtt gacgtttctc atgaggtttc tgacgacgag tgggctgctg
     3301 cagttgatga agcgttcccc ctcgatgaag cagaagatgt tactgaatct gtgcaagaag
     3361 aagcacaacc agtagaagta cctgttgaag atattgcgca ggttgtcata gctgacacct
     3421 tacaggaaac tcctgttgtg tctgatactg ttgaagtccc accgcaagtg gtgaaacttc
     3481 cgtctgaacc tcagactatc cagcccgagg taaaagaagt tgcacctgtc tatgaggctg
     3541 ataccgaaca gacacagagt gttactgtta aacctaagag gttacgcaaa aagcgtaatg
     3601 ttgacccttt gtccaatttt gaacataagg ttattacaga gtgcgttacc atagttttag
     3661 gtgacgcaat tcaagtagcc aagtgctatg gggagtctgt gttagttaat gctgctaaca
     3721 cacatcttaa gcatggcggt ggtatcgctg gtgctattaa tgcggcttca aaaggggctg
     3781 tccaaaaaga gtcagatgag tatattctgg ctaaagggcc gttacaagta ggagattcag
     3841 ttctcttgca aggccattct ctagctaaga atatcctgca tgtcgtaggc ccagatgccc
     3901 gcgctaaaca ggatgtttct ctccttagta agtgctataa ggctatgaat gcatatcctc
     3961 ttgtagtcac tcctcttgtt tcaacaggca tatttggtgt aaaaccagct gtgtcttttg
     4021 attatcttat tagagaggct aagactagag ttttagtcgt cgttaattcc caagatgtct
     4081 ataagagtct taccatagtt gacattccac agagtttgac tttttcatat gatgggttac
     4141 gtggcgcaat acgtaaagct aaagattatg gttttactgt ttttgtgtgc acagacaact
     4201 ctgctaacac taaagttctt aggaacaagg gtgttgatta tactaagaag tttcttacag
     4261 ttgacggtgt gcaatattat tgctacacgt ctaaggacac tttagatgat atcttacaac
     4321 aggctaataa gtctgttggt attatatcta tgcctttggg atatgtgtct catggtttag
     4381 acttaattca agcagggagt gtcgtgcgta gagttaacgt gccctacgtg tgtctcctag
     4441 ctaataaaga gcaagaagct attttgatgt ctgaagacgt taagttaaac ccttcagaag
     4501 attttataaa gcacgtccgc actaatggtg gttacaattc ttggcattta gtcgagggtg
     4561 aactattggt gcaagactta cgcttaaata agctcctgca ttggtctgat caaaccatat
     4621 gctacaagga tagtgtgttt tatgttgtaa agaatagtac agcttttcca tttgaaacac
     4681 tttcagcatg tcgtgcgtat ttggattcac gcacgacaca gcagttaaca atcgaagtct
     4741 tagtgactgt cgatggtgta aattttagaa cagtcgttct aaataataag aacacttata
     4801 gatcacagct tggatgcgtt ttctttaatg gtgctgatat ttctgatacc attcctgatg
     4861 agaaacagaa tggtcacagt ttatatctag cagacaattt gactgctgat gaaacaaagg
     4921 cgcttaaaga gttatatggc cccgttgatc ctactttctt acacagattc tattcactta
     4981 aggctgcagt ccataagtgg aagatggttg tgtgtgataa ggtacgttct ctcaaattga
     5041 gtgataataa ttgttatctt aatgcagtta ttatgacact tgatttattg aaggacatta
     5101 aatttgttat acctgctcta cagcatgcat ttatgaaaca taagggcggt gattcaactg
     5161 acttcatagc cctcattatg gcttatggca attgcacatt tggtgctcca gatgatgcct
     5221 ctcggttact tcataccgtg cttgcaaagg ctgagttatg ctgttctgca cgcatggttt
     5281 ggagagagtg gtgcaatgtc tgtggcataa aagatgttgt tctacaaggc ttaaaagctt
     5341 gttgttacgt gggtgtgcaa actgttgaag atctgcgtgc tcgcatgaca tatgtatgcc
     5401 agtgtggtgg tgaacgtcat cggcaaatag tcgaacacac caccccctgg ttgctgctct
     5461 caggcacacc aaatgaaaaa ttggtgacaa cctccacggc gcctgatttt gtagcgttta
     5521 atgtctttca gggcattgaa acggctgttg gccattatgt tcatgctcgc ctgaagggtg
     5581 gtcttatttt aaagtttgac tctggcaccg ttagcaagac ttcagactgg aagtgcaagg
     5641 tgacagatgt acttttcccc ggccaaaaat acagtagcga ttgtaatgtc gtacggtatt
     5701 ctttggacgg taatttcaga acagaggttg atcccgacct atctgctttc tatgttaagg
     5761 atggtaaata ctttacaagt gaaccacccg taacatattc accagctaca attttagctg
     5821 gtagtgtcta cactaatagc tgccttgtat cgtctgatgg acaacctggc ggtgatgcta
     5881 ttagtttgag ttttaataac cttttagggt ttgattctag taaaccagtc actaagaaat
     5941 acacttactc cttcttgcct aaagaagacg gcgatgtgtt gttggctgag tttgacactt
     6001 atgaccctat ttataagaat ggtgccatgt ataaaggcaa accaattctt tgggtcaaca
     6061 aagcatctta tgatactaat cttaataagt tcaatagagc tagtttgcgt caaatttttg
     6121 acgtagcccc cattgaactc gaaaataaat tcacaccttt gagtgtggcg tccacaccag
     6181 ttgaacctcc aactgtagat gtggtagcac ttcaacagga aatgacaatt gtcaaatgta
     6241 agggtttaaa taaacctttc gtgaaggaca atgtcagttt cgttgttgat gactcaggta
     6301 ctcccgttgt tgagtatctg tctaaagaag atctacatac attgtatgta gaccctaagt
     6361 atcaagtcat tgtcttaaaa gacaatgtac tttcttctat gcttagattg cacaccgttg
     6421 agtcaggtga tattaacgtt gttgcagctt ccggatcttt gacacgtaaa gtgaagttac
     6481 tatttagggc ttcattttat ttcaaagaat ttgctacccg cactttcact gctaccactg
     6541 ctgtaggtag ttgtataaag agtgtagtgc ggcatctagg tgttactaaa ggcatattga
     6601 caggctgttt tagttttgtc aagatgttat ttattcttcc actagcttac tttagtgatt
     6661 caaaactcgg caccacagag gttaaagtga gtgctttgaa aacagctggc gttgtgacag
     6721 gtaatgttgt aaaacagtgt tgcactgctg ctgttgattt aagtatggat aagttgcgcc
     6781 gtgtggattg gaaatcaacc ctacggttgt tacttatgtt atgcacaact atggtattgt
     6841 tgtcttctgt gtatcacttg tatgtcttca atcaggtctt atcaagtgat gttatgtttg
     6901 aagatgccca aggtttgaaa aagttctaca aagaagttag agcttaccta ggaatctctt
     6961 ctgcttgtga cggtcttgct tcagcttata gggcgaattc atttgatgta cctacattct
     7021 gcgcaaaccg ttctgcaatg tgtaattggt gcttgattag ccaagattcc ataactcact
     7081 acccagctct taagatggtt caaacacatc ttagccacta tgttcttaac atagattggt
     7141 tgtggtttgc atttgagact ggtttggcat acatgctcta tacctcggcc ttcaactggt
     7201 tgttgttggc aggtacattg cattatttct ttgcacagac ttccatattt gtagactggc
     7261 ggtcatacaa ttatgctgtg tctagtgcct tctggttatt cacccacatt ccaatggcgg
     7321 gtttggtacg aatgtataat ttgttagcat gcctttggct tttacgcaag ttttatcagc
     7381 atgtaatcaa tggttgcaaa gatacggcat gcttgctctg ctataagagg aaccgactta
     7441 ctagagttga agcttctacc gttgtctgtg gtggaaaacg tacgttttat atcacagcaa
     7501 atggcggtat ttcattctgt cgtaggcata attggaattg tgtggattgt gacattgcag
     7561 gtgtggggaa taccttcatc tgtgaagaag tcgcaaatga cctcactacc gccctacgca
     7621 ggcctattaa cgctacggat agatcacatt attatgtgga ttccgttaca gttaaagaga
     7681 ctgttgttca gtttaattat cgtagagacg gtcaaccatt ctacgagcgg tttcccctct
     7741 gcgcttttac aaatctagat aagttgaagt tcaaagaggt ctgtaaaact actactggta
     7801 tacctgaata caactttatc atctacgact catcagatcg tggccaggaa agtttagcta
     7861 ggtctgcatg tgtttattat tctcaagtct tgtgtaaatc aattcttttg gttgactcaa
     7921 gtttggttac ttctgttggt gattctagtg aaatcgccac taaaatgttt gattcctttg
     7981 ttaatagttt cgtctcgctg tataatgtca cacgcgataa gttggaaaaa cttatctcta
     8041 ctgctcgtga tggcgtaagg cgaggcgata acttccatag tgtcttaaca acattcattg
     8101 acgcagcacg aggccccgca ggtgtggagt ctgatgttga gaccaatgaa attgttgact
     8161 ctgtgcagta tgctcataaa catgacatac aaattactaa tgagagttac aataattatg
     8221 taccctcata tgttaaacct gatagtgtgt ctaccagtga tttaggtagt ctcattgatt
     8281 gtaatgcggc ttcagttaac caaattgtct tgcgtaattc taatggtgct tgtatttgga
     8341 acgctgctgc atatatgaaa ctctcggatg cacttaaacg acagattcgc attgcatgcc
     8401 ataagtgtaa tttagctttc cggttaacca cctcaaagct acgcgctaat gataatatct
     8461 tatcagttag attcactgct aacaaaattg ttggtggtgc tcctacatgg tttaatgtgt
     8521 tgcgtgactt tacgttaaag ggttacgttc ttgctaccat tattgtgttt ctgtgtgctg
     8581 tactgatgta tttgtgttta cctacatttt ctatggtacc tgttgaattt tatgaagacc
     8641 gcatcttgga ctttaaagtt cttgataatg gtatcattag ggatgtaaat cctgatgata
     8701 agtgctttgc taataagcac cggtccttca cacaatggta tcatgagcat gttggtggtg
     8761 tctatgacaa ctctatcaca tgcccattga cagttgcagt aattgctgga gttgctggtg
     8821 ctcgcattcc agacgtacct actacattgg cttgggtgaa caatcagata attttctttg
     8881 tttctcgagt ctttgctaat acaggcagtg tttgctacac tcctatagat gagataccct
     8941 ataagagttt ctctgatagt ggttgcattc ttccatctga gtgcactatg tttagggatg
     9001 cagagggccg tatgacacca tactgccatg atcctactgt tttgcctggg gcttttgcgt
     9061 acagtcagat gaggcctcat gttcgttacg acttgtatga tggtaacatg tttattaaat
     9121 ttcctgaagt agtatttgaa agtacactta ggattactag aactctgtca actcagtact
     9181 gccggttcgg tagttgtgag tatgcacaag agggtgtttg tattaccaca aatggctcgt
     9241 gggccatttt taatgaccac catcttaata gacctggtgt ctattgtggc tctgatttta
     9301 ttgacattgt caggcggtta gcagtatcac tgttccagcc tattacttat ttccaattga
     9361 ctacctcatt ggtcttgggt ataggtttgt gtgcattcct gactttgctc ttctattata
     9421 ttaataaagt aaaacgtgct tttgcagatt acacccagtg tgctgtaatt gctgttgttg
     9481 ctgctgttct taatagcttg tgcatctgct ttgttgcctc tataccattg tgtatagtac
     9541 cttacactgc attgtactat tatgctacat tctattttac taatgagcct gcatttatta
     9601 tgcatgtttc ttggtacatt atgttcgggc ctatcgttcc catatggatg acctgcgtct
     9661 atacagttgc aatgtgcttt agacacttct tctgggtttt agcttatttt agtaagaaac
     9721 atgtagaagt ttttactgat ggtaagctta attgtagttt ccaggacgct gcctctaata
     9781 tctttgttat taacaaggac acttatgcag ctcttagaaa ctctttaact aatgatgcct
     9841 attcacgatt tttggggttg tttaacaagt ataagtactt ctctggtgct atggaaacag
     9901 ccgcttatcg tgaagctgca gcatgtcatc ttgctaaagc cttacaaaca tacagcgaga
     9961 ctggtagtga tcttctttac caaccaccca actgtagcat aacctctggc gtgttgcaaa
    10021 gcggtttggt gaaaatgtca catcccagtg gagatgttga ggcttgtatg gttcaggtta
    10081 cctgcggtag catgactctt aatggtcttt ggcttgacaa cacagtctgg tgcccacgac
    10141 acgtaatgtg cccggctgac cagttgtctg atcctaatta tgatgccttg ttgatttcta
    10201 tgactaatca tagtttcagt gtgcaaaaac acattggcgc tccagcaaac ttgcgtgttg
    10261 ttggtcatgc catgcaaggc actcttttga agttgactgt cgatgttgct aaccctagca
    10321 ctccagccta cacttttaca acagtgaaac ctggcgcagc atttagtgtg ttagcatgct
    10381 ataatggtcg tccgactggt acattcactg ttgtaatgcg ccctaactac acaattaagg
    10441 gttcctttct gtgtggttct tgtggtagtg ttggttacac caaggagggt agtgtgatca
    10501 atttttgtta catgcatcaa atggaacttg ctaatggtac acataccggt tcagcatttg
    10561 atggtactat gtatggtgcc tttatggata aacaagtgca ccaagttcag ttaacagaca
    10621 aatactgcag tgttaatgta gtagcttggc tttacgcagc aatacttaat ggttgcgctt
    10681 ggtttgtaaa acctaatcgc actagtgttg tttcttttaa tgaatgggct cttgccaacc
    10741 aattcactga atttgttggc actcaatccg ttgacatgtt agctgtcaaa acaggcgttg
    10801 ctattgaaca gctgctttat gcgatccaac aactttatac tgggttccag ggaaagcaaa
    10861 tccttggcag tactatgttg gaagatgaat tcacacctga ggatgttaat atgcagatta
    10921 tgggtgtggt tatgcagagt ggtgtgagaa aagttacata tggtactgcg cattggttgt
    10981 tcgcgaccct tgtctcaacc tatgtgataa tcttacaagc cactaaattt actttgtgga
    11041 actacttgtt tgagactatt cccacacagt tgttcccact cttatttgtg actatggcct
    11101 tcgttatgtt gttggttaaa cacaaacaca cctttttgac acttttcttg ttgcctgtgg
    11161 ctatttgttt gacttatgca aacatagtct acgagcccac tactcccatt tcgtcagcgc
    11221 tgattgcagt tgcaaattgg cttgccccca ctaatgctta tatgcgcact acacatactg
    11281 atattggtgt ctacattagt atgtcacttg tattagtcat tgtagtgaag agattgtaca
    11341 acccatcact ttctaacttt gcgttagcat tgtgcagtgg tgtaatgtgg ttgtacactt
    11401 atagcattgg agaagcctca agccccattg cctatctggt ttttgtcact acactcacta
    11461 gtgattatac gattacagtc tttgttactg tcaaccttgc aaaagtttgc acttatgcca
    11521 tctttgctta ctcaccacag cttacacttg tgtttccgga agtgaagatg atacttttat
    11581 tatacacatg tttaggtttc atgtgtactt gctattttgg tgtcttctct cttttgaacc
    11641 ttaagcttag agcacctatg ggtgtctatg actttaaggt ctcaacacaa gagttcagat
    11701 tcatgactgc taacaatcta actgcaccta gaaattcttg ggaggctatg gctctgaact
    11761 ttaagttaat aggtattggc ggtacacctt gtataaaggt tgctgctatt cagtctaaac
    11821 ttacagatct taaatgcaca tctgtggttc tcctctctgt gctccaacag ttacacttag
    11881 aggctaatag tagggcctgg gctttctgtg ttaaatgcca taatgatata ttggcagcaa
    11941 cagaccccag tgaggctttc gagaaattcg taagtctctt tgccacttta atgacttttt
    12001 ctggtaatgt agatcttgat gcgttagcta gtgatatttt tgacactcct agcgtacttc
    12061 aagctactct ttctgagttt tcacacttag ctacctttgc tgagttggaa gctgcgcaga
    12121 aagcctatca ggaagctatg gactctggtg acacctcacc acaagttctt aaggctttgc
    12181 agaaggctgt taatatagct aaaaacgcct atgagaagga taaggcagtg gcccgtaagt
    12241 tagaacgtat ggctgatcag gctatgactt ctatgtataa gcaagcacgt gctgaagaca
    12301 agaaagcaaa aattgtcagt gctatgcaaa ctatgttgtt tggtatgatt aagaagctcg
    12361 acaacgatgt tcttaatggt atcatttcta acgctaggaa tggttgtata cctcttagtg
    12421 tcattccact gtgtgcttca aataaacttc gcgttgtaat tcctgacttc accgtctgga
    12481 atcaggtagt cacatatccc tcgcttaact acgctggggc tttgtgggac attacagtta
    12541 taaacaatgt ggacaatgaa attgttaagt cttcagatgt tgtagacagc aatgaaaatt
    12601 taacatggcc acttgtttta gaatgcacta gggcatccac ttctgccgtt aagttgcaaa
    12661 ataatgagat caaaccttca ggtttaaaaa ccatggttgt gtctgcaggt caagagcaaa
    12721 ctaactgtaa tactagttcc ttagcttatt acgaacctgt gcagggtcgt aaaatgctga
    12781 tggctcttct ttctgataat gcctatctca aatgggcgcg tgttgaaggt aaggacggat
    12841 ttgttagtgt agagctacaa cctccttgca aattcttgat tgcgggacca aaaggacctg
    12901 aaatccgata tctctatttt gttaaaaatc ttaacaacct tcatcgcggg caagtgttag
    12961 ggcacattgc tgcgactgtt agattgcaag ctggttctaa caccgagttt gcctctaatt
    13021 cttcggtgtt gtcacttgtt aacttcaccg ttgatcctca aaaagcttat ctcgatttcg
    13081 tcaatgcggg aggtgcccca ttgacaaatt gtgttaagat gcttactcct aaaactggta
    13141 caggtatagc tatatctgtt aaaccagaga gtacagctga tcaagagact tatggtggag
    13201 cttcagtgtg tctctattgc cgtgcgcata tagaacatcc tgatgtctct ggtgtttgta
    13261 aatataaggg taagtttgtc caaatccctg ctcagtgtgt ccgtgaccct gtgggatttt
    13321 gtttgtcaaa taccccctgt aatgtctgtc aatattggat tggatatggg tgcaattgtg
    13381 actcgcttag gcaagtagca ctgccccaat ctaaagattc caatttttta aacgagtccg
    13441 gggttctatt gtaaatgccc gaatagaacc ctgttcaagt ggtttgtcca ctgatgtcgt
    13501 ctttagggca tttgacatct gcaactataa ggctaaggtt gctggtattg gaaaatacta
    13561 caagactaat acttgtaggt ttgtagaatt agatgaccaa gggcatcatt tagactccta
    13621 ttttgtcgtt aagaggcata ctatggagaa ttatgaacta gagaagcact gttacgattt
    13681 gttacgtgac tgtgatgctg tagctcccca tgatttcttc atctttgatg tagacaaagt
    13741 taaaacacct catattgtac gtcagcgttt aactgagtac actatgatgg atcttgtata
    13801 tgccctgagg cactttgatc aaaatagcga agtgcttaag gctatcttag tgaagtatgg
    13861 ttgctgtgat gttacctact ttgaaaataa actctggttt gattttgttg aaaatcccag
    13921 tgttattggt gtttatcata aacttggaga acgtgtacgc caagctatct taaacactgt
    13981 taaattttgt gaccacatgg tcaaggctgg tttagtcggt gtgctcacac tagacaacca
    14041 ggaccttaat ggcaagtggt atgattttgg tgacttcgta atcactcaac ctggttcagg
    14101 agtagctata gttgatagct actattctta tttgatgcct gtgctctcaa tgaccgattg
    14161 tctggccgct gagacacata gggattgtga ttttaataaa ccactcattg agtggccact
    14221 tactgagtat gattttactg attataaggt acaactcttt gagaagtact ttaaatattg
    14281 ggatcagacg tatcacgcaa attgcgttaa ttgtactgat gaccgttgtg tgttacattg
    14341 tgctaatttc aatgtattgt ttgctatgac catgcctaag acttgtttcg gacccatagt
    14401 ccgaaagatc tttgttgatg gcgtgccatt tgtagtatct tgtggttatc actacaaaga
    14461 attaggttta gtcatgaata tggatgttag tctccataga cataggctct ctcttaagga
    14521 gttgatgatg tatgccgctg atccagccat gcacattgcc tcctctaacg cttttcttga
    14581 tttgaggaca tcatgtttta gtgtcgctgc acttacaact ggtttgactt ttcaaactgt
    14641 gcggcctggc aattttaacc aagacttcta tgatttcgtg gtatctaaag gtttctttaa
    14701 ggagggctct tcagttacgc tcaaacattt tttctttgct caagatggta atgctgctat
    14761 tacagattat aattactatt cttataatct gcctactatg tgtgacatca aacaaatgtt
    14821 gttctgcatg gaagttgtaa acaagtactt cgaaatctat gacggtggtt gtcttaatgc
    14881 ttctgaagtg gttgttaata atttagacaa gagtgctggc catcctttta ataagtttgg
    14941 caaagctcgt gtctattatg agagcatgtc ttaccaggag caagatgaac tctttgccat
    15001 gacaaagcgt aacgtcattc ctaccatgac tcaaatgaat ctaaaatatg ctattagtgc
    15061 taagaataga gctcgcactg ttgcaggcgt gtccatactt agcacaatga ctaatcgcca
    15121 gtaccatcag aaaatgctta agtccatggc tgcaactcgt ggagcgactt gcgtcattgg
    15181 tactacaaag ttctatggtg gctgggattt catgcttaaa acattgtaca aagatgttga
    15241 taatccgcat cttatgggtt gggattaccc taagtgtgat agagctatgc ctaatatgtg
    15301 tagaatcttc gcttcactca tattagctcg taaacatggc acttgttgta ctacaaggga
    15361 cagattttat cgcttggcaa atgagtgtgc tcaggtgcta agcgaatatg ttctatgtgg
    15421 tggtggttac tacgtcaaac ctggaggtac cagtagcgga gatgccacca ctgcatatgc
    15481 caatagtgtc tttaacattt tgcaggcgac aactgctaat gtcagtgcac ttatgggtgc
    15541 taatggcaac aagattgttg acaaagaagt taaagacatg cagtttgatt tgtatgtcaa
    15601 tgtttacagg agcactagcc cagaccccaa atttgttgat aaatactatg cttttcttaa
    15661 taagcacttt tctatgatga tactgtctga tgacggtgtc gtttgctata atagtgatta
    15721 tgcagctaag ggttacattg ctggaataca gaattttaag gaaacgctgt attatcagaa
    15781 caatgtcttt atgtctgaag ctaaatgctg ggtggaaacc gatctgaaga aagggccaca
    15841 tgaattctgt tcacagcata cgctttatat taaggatggc gacgatggtt acttccttcc
    15901 ttatccagac ccttcaagaa ttttgtctgc cggttgcttt gtagatgata tcgttaagac
    15961 tgacggtaca ctcatggtag agcggtttgt gtctttggct atagatgctt accctctcac
    16021 aaagcatgaa gatatagaat accagaatgt attctgggtc tacttacagt atatagaaaa
    16081 actgtataaa gaccttacag gacacatgct tgacagttat tctgtcatgc tatgtggtga
    16141 taattctgct aagttttggg aagaggcatt ctacagagat ctctatagtt cgcctaccac
    16201 tttgcaggct gtcggttcat gcgttgtatg ccattcacag acttctctac gctgtgggac
    16261 atgcatccgt agaccatttc tctgctgtaa atgctgctat gatcatgtta tagcaactcc
    16321 acataagatg gttttgtctg tttctcctta cgtttgtaat gcccctggtt gtggcgtttc
    16381 agacgttact aagctatatt taggtggtat gagctacttt tgtgtagatc atagacctgt
    16441 gtgtagtttt ccactttgcg ctaatggtct tgtattcggc ttatacaaga atatgtgcac
    16501 aggtagtcct tctatagttg aatttaatag gttggctacc tgtgactgga ctgaaagtgg
    16561 tgattacacc cttgccaata ctacaacaga accactcaaa ctttttgctg ctgagacttt
    16621 acgtgccact gaagaggcgt ctaagcagtc ttatgctatt gccaccatca aagaaattgt
    16681 tggtgagcgc caactattac ttgtgtggga ggctggcaag tccaaaccac cactcaatcg
    16741 taattatgtt tttactggtt atcatataac caaaaatagt aaagtgcagc tcggtgagta
    16801 catcttcgag cgcattgatt atagtgatgc tgtatcctac aagtctagta caacgtataa
    16861 actgactgta ggtgacatct tcgtacttac ctctcactct gtggctacct tgacggcgcc
    16921 cacaattgtg aatcaagaga ggtatgttaa aattactggg ttgtacccaa ccattacggt
    16981 acctgaagag ttcgcaagtc atgttgccaa cttccaaaaa tcaggttata gtaaatatgt
    17041 cactgttcag ggaccacctg gcactggcaa aagtcatttt gctatagggt tagcgattta
    17101 ctaccctaca gcacgtgttg tttatacagc atgttcacac gcagctgttg atgctttgtg
    17161 tgaaaaagct tttaaatatt tgaacattgc taaatgttcc cgtatcattc ctgcaaaggc
    17221 acgtgttgag tgctatgaca ggtttaaagt taatgagaca aattctcaat atttgtttag
    17281 tactattaat gctctaccag aaacttctgc cgatattctg gtggttgatg aggttagtat
    17341 gtgcactaat tatgatcttt caattattaa tgcacgtatt aaagctaagc acattgtcta
    17401 tgtaggagat ccagcacagt tgccagctcc taggactttg ttgactagag gcacattgga
    17461 accagaaaat ttcaatagtg tcactagatt gatgtgtaac ttaggtcctg acatattttt
    17521 aagtatgtgc tacaggtgtc ctaaggaaat agtaagcact gtgagcgctc ttgtctacaa
    17581 taataaattg ttagccaaga aggagctttc aggccagtgc tttaaaatac tctataaggg
    17641 caatgtgacg catgatgcta gctctgccat taatagacca caactcacat ttgtgaagaa
    17701 ttttattact gccaatccgg catggagtaa ggcagtcttt atttcgcctt ataattcaca
    17761 gaatgctgtg gctcgttcaa tgctgggtct tactactcag actgttgatt cctcacaggg
    17821 ttcagaatac cagtacgtta tcttctgtca aacagcagat acggcacatg ctaacaacat
    17881 taacagattt aatgttgcaa tcactcgtgc ccaaaaaggt attctttgtg ttatgacatc
    17941 tcaggcactc tttgagtcct tagagtttac tgaattgtct tttactaatt acaagctcca
    18001 gtctcagatt gtaactggcc tttttaaaga ttgctctaga gaaacttctg gcctctcacc
    18061 tgcttatgca ccaacatacg ttagtgttga tgacaagtat aagacgagtg atgagctttg
    18121 cgtgaatctt aatttacccg caaatatccc atactctcgt gttatttcca ggatgggctt
    18181 taaactcgat gcaacagttc ctggatatcc taagcttttc attactcgtg aagaggctgt
    18241 aaggcaagtt cgaagctgga taggcttcga tgttgagggt gctcatgctt cccgtaatgc
    18301 atgtggcacc aatgtgcctc tacaattagg attttcaact ggtgtgaact ttgttgttca
    18361 gccagttggt gttgtagaca ctgagtgggg taacatgtta acgggcattg ctgcccgtcc
    18421 tccaccaggt gaacagttta agcacctcgt gcctcttatg cataaggggg ctgcgtggcc
    18481 tattgttaga cgacgtatag tgcaaatgtt gtcagacact ttagacaaat tgtctgatta
    18541 ctgtacgttt gtttgttggg ctcatggctt tgaattaacg tctgcatcat acttttgcaa
    18601 gataggtaag gaacagaagt gttgcatgtg caatagacgc gctgcagcgt actcttcacc
    18661 tctgcaatct tatgcctgct ggactcattc ctgcggttat gattatgtct acaacccttt
    18721 ctttgtcgat gttcaacagt ggggttatgt aggcaatctt gctactaatc acgatcgtta
    18781 ttgctctgtc catcaaggag ctcatgtggc ttctaatgat gcaataatga ctcgttgttt
    18841 agctattcat tcttgtttta tagaacgtgt ggattgggat atagagtatc cttatatctc
    18901 acatgaaaag aaattgaatt cctgttgtag aatcgttgag cgcaacgtcg tacgtgctgc
    18961 tcttcttgcc ggttcatttg acaaagtcta tgatattggc aatcctaaag gaattcctat
    19021 tgttgatgac cctgtggttg attggcatta ttttgatgca cagcccttga ccagaaaggt
    19081 acaacagctt ttctatacag aggacatggc ctcaagattt gctgatgggc tctgcttatt
    19141 ttggaactgt aatgtaccaa aatatcctaa taatgcaatt gtatgcaggt ttgacacacg
    19201 tgtgcattct gagttcaatt tgccaggttg tgatggcggt agtttgtatg ttaacaagca
    19261 cgcttttcat acaccagcat atgatgtgag tgcattccgt gatctgaaac ctttaccatt
    19321 cttttattat tctactacac catgtgaagt gcatggtaat ggtagtatga tagaggatat
    19381 tgattatgta cccctaaaat ctgcagtctg tattacagct tgtaatttag ggggcgctgt
    19441 ttgtaggaag catgctacag agtacagaga gtatatggaa gcatataatc ttgtctctgc
    19501 atcaggtttc cgcctttggt gttataagac ctttgatatt tataatctct ggtctacttt
    19561 tacaaaagtt caaggtttgg aaaacattgc ttttaatgtt gttaaacaag gccattttat
    19621 tggtgttgag ggtgaactac ctgtagctgt agtcaatgat aagatcttca ccaagagtgg
    19681 cgttaatgac atttgtatgt ttgagaataa aaccactttg cctactaata tagcttttga
    19741 actctatgct aagcgtgctg tacgctcgca tcccgatttc aaattgctac acaatttaca
    19801 agcagacatt tgctacaagt tcgtcctttg ggattatgaa cgtagcaata tttatggtac
    19861 tgctactatt ggtgtatgta agtacactga tattgatgtt aattcagctt tgaatatatg
    19921 ttttgacata cgcgataatg gttcattgga gaagttcatg tctactccca atgccatctt
    19981 tatttctgat agaaaaatta agaaataccc ttgtattgta ggtcctgatt atgcttactt
    20041 caatggtgct atcatccgtg atagtgatgt tgttaaacaa ccagtgaagt tctacttgta
    20101 taagaaagtc aataatgagt ttattgatcc tactgagtgt atttacactc agagtcgctc
    20161 ttgtagtgac ttcctacccc tgtctgacat ggagaaagac tttctatctt ttgatagtga
    20221 tgttttcatt aagaagtatg gcttggaaaa ctatgctttt gagcacgtag tctatggaga
    20281 cttctctcat actacgttag gcggtcttca cttgcttatt ggtttataca agaagcaaca
    20341 ggaaggtcat attattatgg aagaaatgct aaaaggtagc tcaactattc ataactattt
    20401 tattactgag actaacacag cggcttttaa ggcggtgtgt tctgttatag atttaaagct
    20461 tgacgacttt gttatgattt taaagagtca agaccttggc gtagtatcca aggttgtcaa
    20521 ggttcctatt gacttaacaa tgattgagtt tatgttatgg tgtaaggatg gacaggttca
    20581 aaccttctac cctcgactcc aggcttctgc agattggaaa cctggtcatg caatgccatc
    20641 cctctttaaa gttcaaaatg taaaccttga acgttgtgag cttgctaatt acaagcaatc
    20701 tattcctatg cctcgcggtg tgcacatgaa catcgctaaa tatatgcaat tgtgccagta
    20761 tttaaatact tgcacattag ccgtgcctgc caatatgcgt gttatacatt ttggcgctgg
    20821 ttctgataaa ggtatcgctc ctggtacatc agttttacga cagtggcttc ctacagatgc
    20881 cattattata gataatgatt taaatgagtt cgtgtcagat gctgacataa ctttatttgg
    20941 agattgtgta actgtacgtg tcggccaaca agtggatctt gttatttccg acatgtatga
    21001 tcctactact aagaatgtaa caggtagtaa tgagtcaaag gctttattct ttacttacct
    21061 gtgtaacctc attaataata atcttgctct tggtgggtct gttgctatta aaataacaga
    21121 acactcttgg agcgttgaac tttatgaact tatgggaaaa tttgcttggt ggactgtttt
    21181 ctgcaccaat gcaaatgcat cctcatctga aggattcctc ttaggtatta attacttggg
    21241 tactattaaa gaaaatatag atggtggtgc tatgcacgcc aactatatat tttggagaaa
    21301 ttccactcct atgaatctga gtacttactc actttttgat ttatccaagt ttcaattaaa
    21361 attaaaagga acaccagttc ttcaattaaa ggagagtcaa attaacgaac tcgtaatatc
    21421 tctcctgtcg cagggtaagt tacttatccg tgacaatgat acactcagtg tttctactga
    21481 tgttcttgtt aacacctaca gaaagttacg ttgatgtagg gccagattct gttaagtctg
    21541 cttgtattga ggttgatata caacagactt tctttgataa aacttggcct aggccaattg
    21601 atgtttctaa ggctgacggt attatatacc ctcaaggccg tacatattct aacataacta
    21661 tcacttatca aggtcttttt ccctatcagg gagaccatgg tgatatgtat gtctactctg
    21721 caggacatgc tacaggcaca actccacaaa agttgtttgt agctaactat tctcaggacg
    21781 tcaaacagtt tgctaatggg tttgtcgtcc gtataggagc agctgccaat tccactggca
    21841 ctgttattat tagcccatct accagcgcta ctatacgaaa aatttaccct gcttttatgc
    21901 tgggttcttc agttggtaat ttctcagatg gtaaaatggg ccgcttcttc aatcatactc
    21961 tagttctttt gcccgatgga tgtggcactt tacttagagc tttttattgt attctagagc
    22021 ctcgctctgg aaatcattgt cctgctggca attcctatac ttcttttgcc acttatcaca
    22081 ctcctgcaac agattgttct gatggcaatt acaatcgtaa tgccagtctg aactctttta
    22141 aggagtattt taatttacgt aactgcacct ttatgtacac ttataacatt accgaagatg
    22201 agattttaga gtggtttggc attacacaaa ctgctcaagg tgttcacctc ttctcatctc
    22261 ggtatgttga tttgtacggc ggcaatatgt ttcaatttgc caccttgcct gtttatgata
    22321 ctattaagta ttattctatc attcctcaca gtattcgttc tatccaaagt gatagaaaag
    22381 cttgggctgc cttctacgta tataaacttc aaccgttaac tttcctgttg gatttttctg
    22441 ttgatggtta tatacgcaga gctatagact gtggttttaa tgatttgtca caactccact
    22501 gctcatatga atccttcgat gttgaatctg gagtttattc agtttcgtct ttcgaagcaa
    22561 aaccttctgg ctcagttgtg gaacaggctg aaggtgttga atgtgatttt tcacctcttc
    22621 tgtctggcac acctcctcag gtttataatt tcaagcgttt ggtttttacc aattgcaatt
    22681 ataatcttac caaattgctt tcactttttt ctgtgaatga ttttacttgt agtcaaatat
    22741 ctccagcagc aattgctagc aactgttatt cttcactgat tttggattat ttttcatacc
    22801 cacttagtat gaaatccgat ctcagtgtta gttctgctgg tccaatatcc cagtttaatt
    22861 ataaacagtc cttttctaat cccacatgtt tgattttagc gactgttcct cataacctta
    22921 ctactattac taagcctctt aagtacagct atattaacaa gtgctctcgt cttctttctg
    22981 atgatcgtac tgaagtacct cagttagtga acgctaatca atactcaccc tgtgtatcca
    23041 ttgtcccatc cactgtgtgg gaagacggtg attattatag gaaacaacta tctccacttg
    23101 aaggtggtgg ctggcttgtt gctagtggct caactgttgc catgactgag caattacaga
    23161 tgggctttgg tattacagtt caatatggta cagacaccaa tagtgtttgc cccaagcttg
    23221 aatttgctaa tgacacaaaa attgcctctc aattaggcaa ttgcgtggaa tattccctct
    23281 atggtgtttc gggccgtggt gtttttcaga attgcacagc tgtaggtgtt cgacagcagc
    23341 gctttgttta tgatgcgtac cagaatttag ttggctatta ttctgatgat ggcaactact
    23401 actgtttgcg tgcttgtgtt agtgttcctg tttctgtcat ctatgataaa gaaactaaaa
    23461 cccacgctac tctatttggt agtgttgcat gtgaacacat ttcctctacc atgtctcaat
    23521 actcccgttc tacgcgatca atgcttaaac ggcgagattc tacatatggt ccccttcaga
    23581 cacctgttgg ttgtgtccta ggacttgtta attcctcttt gttcgtagag gactgcaagt
    23641 tgcctcttgg tcaatctctc tgtgctcttc ctgacacacc tagtactctc acacctcgca
    23701 gtgtgcgctc tgttccaggt gaaatgcgct tggcatccat tgcttttaat catcctattc
    23761 aggttgatca acttaatagt agttatttta aattaagtat acctactaat ttttcctttg
    23821 gtgtgactca ggagtacatt cagacaacca ttcagaaagt tactgttgat tgtaaacagt
    23881 acgtttgcaa tggtttccag aagtgtgagc aattactgcg cgagtatggc cagttttgtt
    23941 ccaaaataaa ccaggctctc catggtgcca atttacgcca ggatgattct gtacgtaatt
    24001 tgtttgcgag cgtgaaaagc tctcaatcat ctcctatcat accaggtttt ggaggtgact
    24061 ttaatttgac acttctagaa cctgtttcta tatctactgg cagtcgtagt gcacgtagtg
    24121 ctattgagga tttgctattt gacaaagtca ctatagctga tcctggttat atgcaaggtt
    24181 acgatgattg tatgcagcaa ggtccagcat cagctcgtga tcttatttgt gctcaatatg
    24241 tggctggtta taaagtatta cctcctctta tggatgttaa tatggaagcc gcgtacactt
    24301 catctttgct tggcagcata gcaggtgttg gctggactgc tggcttatcc tcctttgctg
    24361 ctattccatt tgcacagagt attttttata ggttaaacgg tgttggcatt actcaacagg
    24421 ttctttcaga gaaccaaaag cttattgcca ataagtttaa tcaggctctg ggagctatgc
    24481 aaacaggctt cactacaact aatgaagctt ttcggaaggt tcaggatgct gtgaacaaca
    24541 atgcacaggc tctatccaaa ttagctagcg agctatctaa tacttttggt gctatttccg
    24601 cctctattgg agacatcata caacgtcttg atgttctcga acaggacgcc caaatagaca
    24661 gacttattaa tggccgtttg acaacactaa atgcttttgt tgcacagcag cttgttcgtt
    24721 ccgaatcagc tgctctttcc gctcaattgg ctaaagataa agtcaatgag tgtgtcaagg
    24781 cacaatccaa gcgttctgga ttttgcggtc aaggcacaca tatagtgtcc tttgttgtaa
    24841 atgcccctaa tggcctttac tttatgcatg ttggttatta ccctagcaac cacattgagg
    24901 ttgtttctgc ttatggtctt tgcgatgcag ctaaccctac taattgtata gcccctgtta
    24961 atggctactt tattaaaact aataacacta ggattgttga tgagtggtca tatactggct
    25021 cgtccttcta tgcacctgag cccatcacct ctcttaatac taagtatgtt gcaccacagg
    25081 tgacatacca aaacatttct actaacctcc ctcctcctct tctcggcaat tccaccggga
    25141 ttgacttcca agatgagttg gatgagtttt tcaaaaatgt tagcaccagt atacctaatt
    25201 ttggttctct aacacagatt aatactacat tactcgatct tacctacgag atgttgtctc
    25261 ttcaacaagt tgttaaagcc cttaatgagt cttacataga ccttaaagag cttggcaatt
    25321 atacttatta caacaaatgg ccgtggtaca tttggcttgg tttcattgct gggcttgttg
    25381 ccttagctct atgcgtcttc ttcatactgt gctgcactgg ttgtggcaca aactgtatgg
    25441 gaaaacttaa gtttaatcgt tgttgtgata gatacgagga atacgacctc gagccgcata
    25501 aggttcatgt tcactaatta acgaactatc aatgagagtt caaagaccac ccactctctt
    25561 gttagtgttc tcactctctt ttttggtcac tgcattttca aaacctctct atgtacctga
    25621 gcattgtcag aattattctg gttgcatgct tagggcttgt attaaaactg cccaagctga
    25681 tacagctggt ctttatacaa attttcgaat tgacgtccca tctgcagaat caactggtac
    25741 tcaatcagtt tctgtcgatc gtgagtctac ttcaactcat gatggtctta ccgaacatgt
    25801 tactagtgtg aatctttttg acgttggtta ctcagttaat taacgaactc tatggattac
    25861 gtgtctctgc ttaatcaaat ttggcagaag taccttaatt caccgtatac tacttgtttg
    25921 tatatcccta aacccacagc taagtataca cctttagttg gcacttcatt gcaccctgtg
    25981 ctgtggaact gtcagctatc ctttgctggt tatactgaat ctgctgttaa ttctacaaaa
    26041 gctttggcca aacaggacgc agctcagcga atcgcttggt tgctacataa ggatggagga
    26101 atccctgacg gatgttccct ctacctccgg cactcaagtt tattcgcgca aagcgaggaa
    26161 gaggagtcat tctccaacta agaaactgcg ctacgttaag cgtagatttt ctcttctgcg
    26221 ccctgaagac cttagtgtta ttgtccaacc aacacactat gtcagggtta cattttcaga
    26281 ccccaacatg tggtatctac gttcgggtca tcatttacac tcagttcaca attggcttaa
    26341 accttatggc ggccaacctg tttctgagta ccatattact ctagctttgc taaatctcac
    26401 tgatgaagat ttagctagag atttttcacc cattgcgctc tttttgcgca atgtcagatt
    26461 tgagctacat gagttcgcct tgctgcgcaa aactcttgtt cttaatgcat cagagatcta
    26521 ctgtgctaac atacatagat ttaagcctgt gtatagagtt aacacggcaa tccctactat
    26581 taaggattgg cttctcgttc agggattttc cctttaccat agtggcctcc ctttacatat
    26641 gtcaatctct aaattgcatg cactggatga tgttactcgc aattacatca ttacaatgcc
    26701 atgctttaga acttatcctc aacaaatgtt tgttactcct ttggccgtag atgttgtctc
    26761 catacggtct tccaatcagg gtaataaaca aattgttcat tcttacccca ttttacatca
    26821 tccaggattt taacgaacta tggctttctc ggcgtcttta tttaaacccg tccagctagt
    26881 cccagtttct cctgcatttc atcgcattga gtctactgac tctattgttt tcacatacat
    26941 tcctgctagc ggctatgtag ctgctttagc tgtcaatgtg tgtctcattc ccctattatt
    27001 actgctacgt caagatactt gtcgtcgcag cattatcaga actatggttc tctatttcct
    27061 tgttctttat aactttttat tagccattgt actagtcaat ggtgtacatt atccaactgg
    27121 aagttgcctg atagccttct tagttatcct cataatactt tggtttgtag atagaattcg
    27181 tttctgtctc atgctgaatt cctacattcc actgtttgac atgcgttctc actttattcg
    27241 tgttagtaca gtttcttctc atggtatggt ccctgtcata cacaccaaac cattatttat
    27301 tagaaacttc gatcagcgtt gcagctgttc tcgttgtttt tatttgcact cttctactta
    27361 tatagagtgc acttatatta gccgttttag taagattagc ctagtttctg taactgactt
    27421 ctccttaaac ggcaatgttt ccactgtttt cgtgcctgca acgcgcgatt cagttcctct
    27481 tcacataatc gccccgagct cgcttatcgt ttaagcagct ctgcgctact atgggtcccg
    27541 tgtagaggct aatccattag tctctctttg gacatatgga aaacgaacta tgttaccctt
    27601 tgtccaagaa cgaatagggt tgttcatagt aaactttttc atttttaccg tagtatgtgc
    27661 tataacactc ttggtgtgta tggctttcct tacggctact agattatgtg tgcaatgtat
    27721 gacaggcttc aataccctgt tagttcagcc cgcattatac ttgtataata ctggacgttc
    27781 agtctatgta aaattccagg atagtaaacc ccctctacca cctgacgagt gggtttaacg
    27841 aactccttca taatgtctaa tatgacgcaa ctcactgagg cgcagattat tgccattatt
    27901 aaagactgga actttgcatg gtccctgatc tttctcttaa ttactatcgt actacagtat
    27961 ggatacccat cccgtagtat gactgtctat gtctttaaaa tgtttgtttt atggctccta
    28021 tggccatctt ccatggcgct atcaatattt agcgccattt atccaattga tctagcttcc
    28081 cagataatct ctggcattgt agcagctgtt tcagctatga tgtggatttc ctactttgtg
    28141 cagagtatcc ggctgtttat gagaactgga tcatggtggt cattcaatcc tgagactaat
    28201 tgccttttga acgttccaat tggtggtaca actgtcgtac gtccactcgt agaggactct
    28261 accagtgtaa ctgctgttgt aaccaatggt cacctcaaaa tggctggcat gcatttcggt
    28321 gcttgtgact acgacagact tcctaatgaa gtcaccgtgg ccaaacccaa tgtgctgatt
    28381 gctttaaaaa tggtgaagcg gcaaagctac ggaactaatt ccggcgttgc catttaccat
    28441 agatataagg caggtaatta caggagtccg cctattacgg cggatattga acttgcattg
    28501 cttcgagctt aggctcttta gtaagagtat cttaattgat tttaacgaat ctcaatttca
    28561 ttgttatggc atcccctgct gcacctcgtg ctgtttcctt tgccgataac aatgatataa
    28621 caaatacaaa cctgtctcga ggtagaggac gtaatccaaa accacgagct gcaccaaata
    28681 acactgtctc ttggtacact gggcttaccc aacacgggaa agtccctctt acctttccac
    28741 ctgggcaggg tgtacctctt aatgccaatt ccacccctgc gcaaaatgct gggtattggc
    28801 ggagacagga cagaaaaatt aataccggga atggaattaa gcaactggct cccaggtggt
    28861 acttctacta cactggaact ggacccgaag cagcactccc attccgggct gttaaggatg
    28921 gcatcgtttg ggtccatgaa gatggcgcca ctgatgctcc ttcaactttt gggacgcgga
    28981 accctaacaa tgattcagct attgttacac aattcgcgcc cggtactaag cttcctaaaa
    29041 acttccacat tgaggggact ggaggcaata gtcaatcatc ttcaagagcc tctagcgtaa
    29101 gcagaaactc ttccagatct agttcacaag gttcaagatc aggaaactct acccgcggca
    29161 cttctccagg tccatctgga atcggagcag taggaggtga tctactttac cttgatcttc
    29221 tgaacagact acaagccctt gagtctggca aagtaaagca atcgcagcca aaagtaatca
    29281 ctaagaaaga tgctgctgct gctaaaaata agatgcgcca caagcgcact tccaccaaaa
    29341 gtttcaacat ggtgcaagct tttggtcttc gcggaccagg agacctccag ggaaactttg
    29401 gtgatcttca attgaataaa ctcggcactg aggacccacg ttggccccaa attgctgagc
    29461 ttgctcctac agccagtgct tttatgggta tgtcgcaatt taaacttacc catcagaaca
    29521 atgatgatca tggcaaccct gtgtacttcc ttcggtacag tggagccatt aaacttgacc
    29581 caaagaatcc caactacaat aagtggttgg agcttcttga gcaaaatatt gatgcctaca
    29641 aaaccttccc taagaaggaa aagaaacaaa aggcaccaaa agaagaatca acagaccaaa
    29701 tgtctgaacc tccaaaggag cagcgtgtgc aaggtagcat cactcagcgc actcgcaccc
    29761 gtccaagtgt tcagcctggt ccaatgattg atgttaacac tgattagtgt cactcaaagt
    29821 aacaagatcg cggcaatcgt ttgtgtttgg taaccccatc tcaccatcgc ttgtccactc
    29881 ttgcacagaa tggaatcatg ttgtaattac agtgcaataa ggtaattata acccatttaa
    29941 ttgatagcta tgctttatta aagtgtgtag ctgtagagag aatgttaaag actgtcacct
    30001 ctgcgtgatt gcaagtgaac agtgcccccc gggaagagct ctacagtgtg aaatgtaaat
    30061 aaaaatagct attattcaat tagattaggc taattagatg atttgcaaaa aaaaaaaa

Share this post


Link to post
Share on other sites
LOCUS       KT368849               30117 bp    RNA     linear   VRL 17-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate
            camel/Jeddah/O23(b)/2014, complete genome.
ACCESSION   KT368849
VERSION     KT368849.1  GI:922058124
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 30117)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Co-circulation of three camel coronavirus species and recombination
            of MERS-CoVs in Saudi Arabia
  JOURNAL   Science (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 30117)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2015) Centre of Influenza Research & State Key
            Laboratory of Emerging Infectious Diseases, The University of Hong
            Kong, Laboratory Block, 21 Sassoon Road, Pokfulam, Hong Kong SAR,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..30117
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="camel/Jeddah/O23(b)/2014"
                     /host="camel"
                     /db_xref="taxon:1335626"
                     /country="Saudi Arabia"
                     /collection_date="Oct-2014"
     gene            279..21514
                     /gene="orf1ab"
     CDS             join(279..13433,13433..21514)
                     /gene="orf1ab"
                     /ribosomal_slippage
                     /codon_start=1
                     /product="polyprotein ORF1ab"
                     /protein_id="ALA49615.1"
                     /db_xref="GI:922058126"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLALAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINRDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
                     RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
                     RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
                     RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
                     KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
                     DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
                     VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
                     RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
                     VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
                     EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
                     MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
                     GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
                     LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
                     NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
                     AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
                     LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
                     YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
                     SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
                     FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
                     PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
                     ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
                     RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
                     RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
                     NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
                     PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
                     KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
                     SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
                     TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYS
                     RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
                     FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
                     MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
                     WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
                     CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
                     DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
                     VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
                     DIDYVPLKSAVCITTCNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
                     WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
                     TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
                     VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDV
                     VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
                     ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
                     AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
                     RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
                     TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
                     DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
                     TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
                     FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
                     LSVSTDVLVNTYRKLR"
     gene            279..13454
                     /gene="orf1a"
     CDS             279..13454
                     /gene="orf1a"
                     /codon_start=1
                     /product="polyprotein ORF1a"
                     /protein_id="ALA49614.1"
                     /db_xref="GI:922058125"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLALAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINRDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
     gene            21456..25517
                     /gene="S"
     CDS             21456..25517
                     /gene="S"
                     /codon_start=1
                     /product="spike protein"
                     /protein_id="ALA49616.1"
                     /db_xref="GI:922058127"
                     /translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
                     PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
                     ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
                     MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
                     YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
                     NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
                     RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
                     PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
                     SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
                     DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
                     LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
                     VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
                     SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
                     TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
                     IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
                     QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
                     QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
                     AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
                     QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
                     SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
                     IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
                     VAPQVTYQNISTNLPPPLLSNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
                     TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
                     TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
     gene            25532..25843
                     /gene="orf3"
     CDS             25532..25843
                     /gene="orf3"
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="ALA49617.1"
                     /db_xref="GI:922058128"
                     /translation="MRVQRPPTLLLVFSLSLLVTAFSKPLYVPEHCQNYSGCMLRACI
                     KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGPTEHVTSVNLFDVGYSV
                     N"
     gene            25852..26181
                     /gene="orf4a"
     CDS             25852..26181
                     /gene="orf4a"
                     /codon_start=1
                     /product="ORF4a"
                     /protein_id="ALA49618.1"
                     /db_xref="GI:922058129"
                     /translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
                     WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
                     EEESFSN"
     gene            26093..26833
                     /gene="orf4b"
     CDS             26093..26833
                     /gene="orf4b"
                     /codon_start=1
                     /product="ORF4b"
                     /protein_id="ALA49619.1"
                     /db_xref="GI:922058130"
                     /translation="MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
                     EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
                     TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
                     PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
                     VDVVSIRSSNQGNKQIVHSYPILHHPGF"
     gene            26840..27514
                     /gene="orf5"
     CDS             26840..27514
                     /gene="orf5"
                     /codon_start=1
                     /product="ORF5"
                     /protein_id="ALA49620.1"
                     /db_xref="GI:922058131"
                     /translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
                     VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
                     ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
                     CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
                     PSSLIV"
     gene            27590..27838
                     /gene="E"
     CDS             27590..27838
                     /gene="E"
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ALA49621.1"
                     /db_xref="GI:922058132"
                     /translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
                     TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
     gene            27853..28512
                     /gene="M"
     CDS             27853..28512
                     /gene="M"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="ALA49622.1"
                     /db_xref="GI:922058133"
                     /translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
                     VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
                     MRTGSWWSFNPETNCLLNVPFGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
                     DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
                     A"
     gene            28566..29807
                     /gene="N"
     CDS             28566..29807
                     /gene="N"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="ALA49623.1"
                     /db_xref="GI:922058134"
                     /translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
                     TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
                     TGTGPEAALPFRAVKDGIVWVHEHGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
                     HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
                     LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
                     NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
                     IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
                     TQRTRTRPSVQPGPMIDVNTD"
     gene            28762..29100
                     /gene="orf8b"
     CDS             28762..29100
                     /gene="orf8b"
                     /codon_start=1
                     /product="ORF8b"
                     /protein_id="ALA49624.1"
                     /db_xref="GI:922058135"
                     /translation="MPIPPQRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLEPDPKQ
                     HSHSGLLRMASFGSMNMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
                     IVNHLQEPLA"
ORIGIN      
        1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
       61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
      121 gtggcactaa tttgcctgct catctaggca gtggacatat gctcaacact gggtataatt
      181 ctaattgaat actatttttc agttagagcg tcgtgtctct tgtacgtctc ggtcacaata
      241 cacggtttcg tccggtgcgt ggcaattcgg ggcacatcat gtctttcgtg gctggtgtga
      301 tcgcgcaagg tgcgcgcggt acgtatcgag cagcgctcaa ctctgaaaaa catcaagacc
      361 atgtgtctct aactgtgcca ctctgtggtt caggaaacct ggttgaaaaa ctttcaccat
      421 ggttcatgga tggcgaaaat gcctatgaag tggtgaaggc catgttactt aaaaaagagc
      481 cacttctcta tgtgcccatc cggctggctg gacacactag acacctccca ggtcctcgtg
      541 tgtacctggt tgagaggctc attgcttgtg aaaatccatt catggttaac caattggctt
      601 atagctctag tgcaaatggc agcctggttg gcacaacttt gcagggcaag cctattggta
      661 tgttcttccc ttatgacatc gaacttgtca caggaaagca aaatattctc ctgcgcaagt
      721 atggccgtgg tggttatcac tacaccccat tccactatga gcgagacaac acctcttgcc
      781 ctgagtggat ggacgatttt gaggcggatc ctaaaggcaa atatgcccag aatctgctta
      841 agaagttgat tggcggtgat gtcactccag ttgaccaata catgtgtggc gttgatggaa
      901 aacccattag tgcctacgca tttttaatgg ccaaggatgg aataaccaaa ctggctgatg
      961 ttgaagcgga cgtcgcagca cgtgctgatg acgaaggctt catcacatta aagaacaatc
     1021 tatatagatt ggtttggcat gttgagcgta aagacgttcc atatcctaag caatctattt
     1081 ttactattaa tagtgtggtc caaaaggatg gtgttgaaaa cactcctcct cactatttta
     1141 ctcttggatg caaaatttta acgctcaccc cacgcaacaa gtggagtggc gtttctgact
     1201 tgtccctcaa acaaaaactc ctttacacct tctatggtaa ggagtcactt gagaacccaa
     1261 cctacattta ccactccgca ttcattgagt gtggaagttg tggtaatgat tcctggctta
     1321 cagggaatgc tatccaaggg tttgcctgtg gatgtggggc atcatataca gctaatgatg
     1381 tcgaagtcca atcatctggc atgattaagc caaatgctct tctttgtgct acttgcccct
     1441 ttgctaaggg tgacagctgt tcttctaatt gcaaacattc agttgctcag ttggttagtt
     1501 acctttctga acgctgtaat gttattgctg attctaagtc cttcacactt atctttggtg
     1561 gcgtagctta cgcctacttt ggatgtgagg aaggtactat gtactttgtg cctagagcta
     1621 agtctgttgt ctcaaggatt ggagactcca tctttacagg ctgtactggc tcttggaaca
     1681 aggtcactca aattgctaac atgttcttgg aacagactca gcattccctt aactttgtgg
     1741 gagagttcgt tgtcaacgat gttgtcctcg caattctctc tggaaccaca actaatgttg
     1801 acaaaatacg ccagcttctc aaaggtgtca ccattgacaa gttgcgtgat tatttagctg
     1861 actatgacgt agcagtcact gccggcccat tcatggataa tgctattaat gttggtggta
     1921 caggattaca gtatgccgcc attactgcac cttatgtagt tctcactggc ttaggtgagt
     1981 cctttaagaa agttgcaacc ataccgtaca aggtttgcaa ctctgttaag gatactctga
     2041 cttattatgc tcacagcgtg ttgtacagag tttttcctta tgacatggat tctggtgtgt
     2101 catcctttag tgaactactt tttgattgcg ttgatctttc agtagcttct acctattttt
     2161 tagtccgcct cttgcaagat aagactggcg actttatgtc tacaattatt acttcctgcc
     2221 aaactgctgt tagtaagctt ctagatacat gttttgaagc tacagaagca acatttaact
     2281 tcttgttaga tttggcagga ttgttcagaa tctttcttcg caatgcctat gtgtacactt
     2341 cacaagggtt tgtggtggtc aatggcaaag tttctacact tgtcaaacaa gtgttagact
     2401 tgcttaataa gggtatgcaa cttttgcata caaaggtctc ctgggctggt tctaatatca
     2461 gtgctgttat ctacagcggc agggagtctc taatattccc atcgggaacc tattactgtg
     2521 tcaccactaa ggctaagtcc gttcaacaag atcttgacgt tattttgcct ggtgagtttt
     2581 ccaagaagca gttaggactg ctccaaccta ctgacaattc tacaactgtt agtgttactg
     2641 tatccagtaa catggttgaa actgttgtgg gtcaacttga gcaaactaat atgcatagtc
     2701 ctgatgttat agtaggtgac tatgtcatta ttagtgaaaa attgtttgtg cgtagtaagg
     2761 aagaagacgg atttgccttc taccctgctt gcactaatgg tcatgctgta ccgactctct
     2821 ttagacttaa gggaggtgca cctgtaaaaa aagtagcctt tggcggtgat caagtacatg
     2881 aggttgctgc tgtaagaagt gttactgtcg agtacaacat tcatgctgta ttagacacac
     2941 tacttgcttc ttctagtctt agaacctttg ttgtagataa gtctttgtca attgaggagt
     3001 ttgctgacgt agtaaaggaa caagtctcag acttgcttgt taaattactg cgtggaatgc
     3061 cgattccaga ttttgattta gacgatttta ttgacgcacc atgctattgc tttaacgctg
     3121 agggtgatgc atcttggtct tctactatga tcttctctct tcaccccgtc gagtgtgacg
     3181 aggagtgttc tgaagtagag gcttcagatt tagaagaagg tgaatcagag tgcatttctg
     3241 agacttcaac tgaacaagtt gacgtttctc atgaggtttc tgacgacgag tgggctgctg
     3301 cagttgatga agcgttcccc ctcgatgaag cagaagatgt tactgaatct gtgcaagaag
     3361 aagcacaacc agtagaagta cctgttgaag atattgcgca ggttgtcata gctgacacct
     3421 tacaggaaac tcctgttgtg tttgatactg ttgaagtccc accgcaagtg gtgaaacttc
     3481 cgtctgaacc tcagactatc cagcccgagg taaaagaagt tgcacctgtc tatgaggctg
     3541 ataccgaaca gacacagagt gttactgtta aacctaagag gttacgcaaa aagcgtaatg
     3601 ttgacccttt gtccaatttt gaacataagg ttattacaga gtgcgttacc atagttttag
     3661 gtgacgcaat tcaagtagcc aagtgctatg gggagtctgt gttagttaat gctgctaaca
     3721 cacatcttaa gcatggcggt ggtatcgctg gtgctattaa tgcggcttca aaaggggctg
     3781 tccaaaaaga gtcagatgag tatattctgg ctaaagggcc gttacaagta ggagattcag
     3841 ttctcttgca aggccattct ctagctaaga atatcctgca tgtcgtaggc ccagatgccc
     3901 gcgctaaaca ggatgtttct ctccttagta agtgctataa ggctatgaat gcatatcctc
     3961 ttgtagtcac tcctcttgtt tcagcaggca tatttggtgt aaaaccagct gtgtcttttg
     4021 attatcttat tagagaggct aagactagag ttttagtcgt cgttaattcc caagatgtct
     4081 ataagagtct taccatagtt gacattccac agagtttgac tttttcatat gatgggttac
     4141 gtggcgcaat acgtaaagct aaagattatg gttttactgt ttttgtgtgc acagacaact
     4201 ctgctaacac taaagttctt aggaacaagg gtgttgatta tactaagaag tttcttacag
     4261 ttgacggtgt gcaatattat tgctacacgt ctaaggacac tttagatgat atcttacaac
     4321 aggctaataa gtctgttggt attatatcta tgcctttggg atatgtgtct catggtttag
     4381 acttaattca agcagggagt gtcgtgcgta gagttaacgt gccctacgtg tgtctcctag
     4441 ctaataaaga gcaagaagct attttgatgt ctgaagacgt taagttaaac ccttcagaag
     4501 attttataaa gcacgtccgc actaatggtg gttacaattc ttggcattta gtcgagggtg
     4561 aactattggt gcaagactta cgcttaaata agctcctgca ttggtctgat caaaccatat
     4621 gctacaagga tagtgtgttt tatgttgtaa agaatagtac agcttttcca tttgaaacac
     4681 tttcagcatg tcgtgcgtat ttggattcac gcacgacaca gcagttaaca atcgaagtct
     4741 tagtgactgt cgatggtgta aattttagaa cagtcgttct aaataataag aacacttata
     4801 gatcacagct tggatgcgtt ttctttaatg gtgctgatat ttctgatacc attcctgatg
     4861 agaaacagaa tggtcacagt ttatatctag cagacaattt gactgctgat gaaacaaagg
     4921 cgcttaaaga gttatatggc cccgttgatc ctactttctt acacagattc tattcactta
     4981 aggcagcagt ccatgggtgg aagatggttg tgtgtgataa ggtacgttct ctcaaattga
     5041 gtgataataa ttgttatctt aatgcagtta ttatgacact tgatttattg aaggacatta
     5101 aatttgttat acctgctcta cagcatgcat ttatgaaaca taagggcggt gattcaactg
     5161 acttcatagc cctcattatg gcttatggca attgcacatt tggtgctcca gatgatgcct
     5221 ctcggttact tcacaccgtg cttgcaaagg ctgagttatg ctgttctgca cgcatggttt
     5281 ggagagagtg gtgcaatgtc tgtggcataa aagatgttgt tctacaaggc ttaagagctt
     5341 gttgttacgt gggtgtgcaa actgttgaag atctgcgtgc tcgcatgaca tatgtatgcc
     5401 agtgtggtgg tgaacgtcat cggcaaatag tcgaacacac cactccctgg ttgctgctct
     5461 caggcacacc aaatgaaaaa ttggtgacaa ccttcacggc gcctgatttt gtagcgttta
     5521 atgtctttca gggcattgaa acggctgttg gccattatgt tcatgctcgc ctgaagggtg
     5581 gtcttatttt aaagtttgac tctggcaccg ttagcaagac ttcagactgg aagtgcaagg
     5641 tgacagatgt acttttcccc ggccaaaaat acagtagcga ttgtaatgtc gtacggtatt
     5701 ctttggacgg taatttcaga acagaggttg atcccgacct atctgctttc tatgttaagg
     5761 atggtaaata ctttacaagt gaaccacccg taacatattc accagctaca attttagctg
     5821 gtagtgtcta cactaatagc tgccttgtat cgtctgatgg acaacctggc ggtgatgcta
     5881 ttagtttgag ttttaataac cttttagggt ttgattctag taaaccagtc actaagaaat
     5941 acacttactc cttcttgcct aaagaagacg gcgatgtgtt gttggctgag tttgacactt
     6001 atgaccctat ttataagaat ggtgccatgt ataaaggcaa accaattctt tgggtcaaca
     6061 aagcatctta tgatattaat cttaataagt tcaatagagc tagtttgcgt caaatttttg
     6121 acgtagcccc cattgaactc gaaaataaat tcacaccttt gagtgtggcg tctacaccag
     6181 ttgaacctcc aactgtagat gtggtagcac ttcaacagga aatgacaatt gtcaaatgta
     6241 agggtttaaa taaacctttc gtgaaggaca atgtcagttt cgttgttgat gactcaggta
     6301 ctcccgttgt tgagtatctg tctaaagaag atctacatac attgtatgta gaccctaagt
     6361 atcaagtcat tgtcttaaaa gacaatgtac tttcttctat gcttagattg cacaccgttg
     6421 agtcaggtga tattaacgtt gttgcagctt ccggatcttt gacacgtaaa gtgaagttac
     6481 tatttagggc ttcattttat ttcaaagaat ttgctacccg cactttcact gctaccactg
     6541 ctgtaggtag ttgtataaag agtgtagtgc ggcatctagg tgttactaaa ggcatattga
     6601 caggctgttt tagttttgtc aagatgttat ttatgcttcc actagcttac tttagtgatt
     6661 caaaactcgg caccacagag gttaaagtga gtgctttgaa aacagctggc gttgtgacag
     6721 gtaatgttgt aaaacagtgt tgcactgctg ctgttgattt aagtatggat aagttgcgcc
     6781 gtgtggattg gaaatcaacc ctacggttgt tacttatgtt atgcacaact atggtattgt
     6841 tgtcttctgt gtatcacttg tatgtcttca atcaggtctt atcaagtgat gttatgtttg
     6901 aagatgccca aggtttgaaa aagttctaca aagaagttag agcttaccta ggaatctctt
     6961 ctgcttgtga cggtcttgct ttagcttata gggcgaattc atttgatgta cctacattct
     7021 gcgcaaaccg ttctgcaatg tgtaattggt gcttgattag ccaagattcc ataactcact
     7081 acccagctct taagatggtt caaacacatc ttagccacta tgttcttaac atagattggt
     7141 tgtggtttgc atttgagact ggtttggcat acatgctcta tacctcggcc ttcaactggt
     7201 tgttgttggc aggtacattg cattatttct ttgcacaaac ttccatattt gtagactggc
     7261 ggtcatacaa ttatgctgtg tctagtgcct tctggttatt cacccacatt ccaatggcgg
     7321 gtttggtacg aatgtataat ttgttagcat gcctttggct tttacgcaag ttttatcagc
     7381 atgtaatcaa tggttgcaaa gatacggcat gcttgctctg ctataagagg aaccgactta
     7441 ctagagttga agcttctacc gttgtctgtg gtggaaaacg tacgttttat atcacagcaa
     7501 atggcggtat ttcattctgt cgtaggcata attggaattg tgtggattgt gacattgcag
     7561 gtgtggggaa taccttcatc tgtgaagaag tcgcaaatga cctcactacc gccctacgca
     7621 ggcctattaa cgctacggat agatcacatt attatgtgga ttccgttaca gttaaagaga
     7681 ctgttgttca gtttaattat cgtagagacg gtcaaccatt ctacgagcgg tttcccctct
     7741 gcgcttttac aaatctagat aagttgaagt tcaaagaggt ctgtaaaact actactggta
     7801 tacctgaata caactttatc atctacgact catcagatcg tggccaggaa agtttagcta
     7861 ggtctgcatg tgtttattat tctcaagtct tgtgtaaatc aattcttttg gttgactcaa
     7921 gtttggttac ttctgttggt gattctagtg aaatcgccac taaaatgttt gattcctttg
     7981 ttaatagttt cgtctcgctg tataatgtca cacgcgataa gttggaaaaa cttatctcta
     8041 ctgctcgtga tggcgtaagg cgaggcgata acttccatag tgtcttaaca acattcattg
     8101 acgcagcacg aggccccgca ggtgtggagt ctgatgttga gaccaatgaa attgttgact
     8161 ctgtgcagta tgctcataaa catgacatac aaattactaa tgagagttac aataattatg
     8221 taccctcata tgttaaacct gatagtgtgt ctaccagtga tttaggtagt ctcattgatt
     8281 gtaatgcggc ttcagttaac caaattgtct tgcgtaattc taatggtgct tgtatttgga
     8341 acgctgctgc atatatgaaa ctctcggatg cacttaaacg acagattcgc attgcatgcc
     8401 gtaagtgtaa tttagctttc cggttaacca cctcaaagct acgcgctaat gataatatct
     8461 tatcagttag attcactgct aacaaaattg ttggtggtgc tcctacatgg tttaatgtgt
     8521 tgcgtgactt tacgttaaag ggttacgttc ttgctaccat tattgtgttt ctgtgtgctg
     8581 tactgatgta tttgtgttta cctacatttt ctatggtacc tgttgaattt tatgaagacc
     8641 gcatcttgga ctttaaagtt cttgataatg gtatcattag ggatgtaaat cctgatgata
     8701 agtgctttgc taataagcac cggtccttca cacaatggta tcatgagcat gttggtggtg
     8761 tctatgacaa ctctatcaca tgcccattga cagttgcagt aattgctgga gttgctggtg
     8821 ctcgcattcc agacgtacct actacattgg cttgggtgaa caatcagata attttctttg
     8881 tttctcgagt ctttgctaat acaggcagtg tttgctacac tcctatagat gagataccct
     8941 ataagagttt ctctgatagt ggttgcattc ttccatctga gtgcactatg tttagggatg
     9001 cagagggccg tatgacacca tactgccatg atcctactgt tttgcctggg gcttttgcgt
     9061 acagtcagat gaggcctcat gttcgttacg acttgtatga tggtaacatg tttattaaat
     9121 ttcctgaagt agtatttgaa agtacactta ggattactag aactctgtca actcagtact
     9181 gccggttcgg tagttgtgag tatgcacaag agggtgtttg tattaccaca aatggctcgt
     9241 gggccatttt taatgaccac catcttaata gacctggtgt ctattgtggt tctgatttta
     9301 ttgacattgt caggcggtta gcagtatcac tgttccagcc tattacttat ttccaattga
     9361 ctacctcatt ggtcttgggt ataggtttgt gtgcattcct gactttgctc ttttattata
     9421 ttaataaagt aaaacgtgct tttgcagatt acacccagtg tgctgtaatt gctgttgttg
     9481 ctgctgttct taatagcttg tgcatctgct ttgttgcctc tataccattg tgtatagtac
     9541 cttacactgc attgtactat tatgctacat tctattttac taatgagcct gcatttatta
     9601 tgcatgtttc ttggtacatt atgttcgggc ctatcgttcc catatggatg acctgcgtct
     9661 atacagttgc aatgtgcttt agacacttct tctgggtttt agcttatttt agtaagaaac
     9721 atgtagaagt ttttactgat ggtaagctta attgtagttt ccaggacgct gcctctaata
     9781 tctttgttat taacagggac acttatgcag ctcttagaaa ctctttaact aatgatgcct
     9841 attcacgatt tttggggttg tttaacaagt ataagtactt ctctggtgct atggaaacag
     9901 ccgcttatcg tgaagctgca gcatgtcatc ttgctaaagc cttacaaaca tacagcgaga
     9961 ctggtagtga tcttctttac caaccaccca actgtagcat aacctctggc gtgttgcaaa
    10021 gcggtttggt gaaaatgtca catcccagtg gagatgttga ggcttgtatg gttcaggtta
    10081 cctgcggtag catgactctt aatggtcttt ggcttgacaa cacagtctgg tgcccacgac
    10141 acgtaatgtg cccggctgac cagttgtctg atcctaatta tgatgccttg ttgatttcta
    10201 tgactaatca tagtttcagt gtgcaaaaac acattggcgc tccagcaaac ttgcgtgttg
    10261 ttggtcatgc catgcaaggc actcttttga agttgactgt cgatgttgct aaccctagca
    10321 ctccagccta cacttttaca acagtgaaac ctggcgcagc atttagtgtg ttagcatgct
    10381 ataatggtcg tccgactggt acattcactg ttgtaatgcg ccctaactac acaattaagg
    10441 gttcctttct gtgtggttct tgtggtagtg ttggttacac caaggagggt agtgtgatca
    10501 atttttgtta catgcatcaa atggaacttg ctaatggtac acataccggt tcagcatttg
    10561 atggtactat gtatggtgcc tttatggata aacaagtgca ccaagttcag ttaacagaca
    10621 aatactgcag tgttaatgta gtagcttggc tttacgcagc aatacttaat ggttgcgctt
    10681 ggtttgtaaa acctaatcgc actagtgttg tttcttttaa tgaatgggct cttgccaacc
    10741 aattcactga atttgttggc actcaatccg ttgacatgtt agctgtcaaa acaggcgttg
    10801 ctattgaaca gctgctttat gcgatccaac aactttatac tgggttccag ggaaagcaaa
    10861 tccttggcag tactatgttg gaagatgaat tcacacctga ggatgttaat atgcagatta
    10921 tgggtgtggt tatgcagagt ggtgtgagaa aagttacata tggtactgcg cattggttgt
    10981 tcgcgaccct tgtctcaacc tatgtgataa tcttacaagc cactaaattt actttgtgga
    11041 actacttgtt tgagactatt cccacacagt tgttcccact cttatttgtg actatggcct
    11101 tcgttatgtt gttggttaaa cacaaacaca cctttttgac acttttcttg ttgcctgtgg
    11161 ctatttgttt gacttatgca aacatagtct acgagcccac tactcccatt tcgtcagcgc
    11221 tgattgcagt tgcaaattgg cttgccccca ctaatgctta tatgcgcact acacatactg
    11281 atattggtgt ctacattagt atgtcacttg tattagtcat tgtagtgaag agattgtaca
    11341 acccatcact ttctaacttt gcgttagcat tgtgcagtgg tgtaatgtgg ttgtacactt
    11401 atagcattgg agaagcctca agccccattg cctatctggt ttttgtcact acactcacta
    11461 gtgattatac gattacagtc tttgttactg tcaaccttgc aaaagtttgc acttatgcca
    11521 tctttgctta ctcaccacag cttacacttg tgtttccgga agtgaagatg atacttttat
    11581 tatacacatg tttaggtttc atgtgtactt gctattttgg tgtcttctct cttttgaacc
    11641 ttaagcttag agcacctatg ggtgtctatg actttaaggt ctcaacacaa gagttcagat
    11701 tcatgactgc taacaatcta actgcaccta gaaattcttg ggaggctatg gctctgaact
    11761 ttaagttaat aggtattggc ggtacacctt gtataaaggt tgctgctatg cagtctaaac
    11821 ttacagatct taaatgcaca tctgtggttc tcctctctgt gctccaacag ttacacttag
    11881 aggctaatag tagggcctgg gctttctgtg ttaaatgcca taatgatata ttggcagcaa
    11941 cagaccccag tgaggctttc gagaaattcg taagtctctt tgccacttta atgacttttt
    12001 ctggtaatgt agatcttgat gcgttagcta gtgatatttt tgacactcct agcgtacttc
    12061 aagctactct ttctgagttt tcacacttag ctacctttgc tgagttggaa gctgcgcaga
    12121 aagcctatca ggaagctatg gactctggtg acacctcacc acaagttctt aaggctttgc
    12181 agaaggctgt taatatagct aaaaacgcct atgagaagga taaggcagtg gcccgtaagt
    12241 tagaacgtat ggctgatcag gctatgactt ctatgtataa gcaagcacgt gctgaagaca
    12301 agaaagcaaa aattgtcagt gctatgcaaa ctatgttgtt tggtatgatt aagaagctcg
    12361 acaacgatgt tcttaatggt atcatttcta acgctaggaa tggttgtata cctcttagtg
    12421 tcattccact gtgtgcttca aataaacttc gcgttgtaat tcctgacttc accgtctgga
    12481 atcaggtagt cacatatccc tcgcttaact acgctggggc tttgtgggac attacagtta
    12541 taaacaatgt ggacaatgaa attgttaagt cttcagatgt tgtagacagc aatgaaaatt
    12601 taacatggcc acttgtttta gaatgcacta gggcatccac ttctgccgtt aagttgcaaa
    12661 ataatgagat caaaccttca ggtttaaaaa ccatggttgt gtctgcaggt caagagcaaa
    12721 ctaactgtaa tactagttcc ttagcttatt acgaacctgt gcagggtcgt aaaatgctga
    12781 tggctcttct ttctgataat gcctatctca aatgggcgcg tgttgaaggt aaggacggat
    12841 ttgttagtgt agagctacaa cctccttgca aattcttgat tgcgggacca aaaggacctg
    12901 aaatccgata tctctatttt gttaaaaatc ttaacaacct tcatcgcggg caagtgttag
    12961 ggcacattgc tgcgactgtt agattgcaag ctggttctaa caccgagttt gcctctaatt
    13021 cttcggtgtt gtcacttgtt aacttcaccg ttgatcctca aaaagcttat ctcgatttcg
    13081 tcaatgcggg aggtgcccca ttgacaaatt gtgttaagat gcttactcct aaaactggta
    13141 caggtatagc tatatctgtt aaaccagaga gtacagctga tcaagagact tatggtggag
    13201 cttcagtgtg tctctattgc cgtgcgcata tagaacatcc tgatgtctct ggtgtttgta
    13261 aatataaggg taagtttgtc caaatccctg ctcagtgtgt ccgtgaccct gtgggatttt
    13321 gtttgtcaaa taccccctgt aatgtctgtc aatattggat tggatatggg tgcaattgtg
    13381 actcgcttag gcaagtagca ctgccccaat ctaaagattc caatttttta aacgagtccg
    13441 gggttctatt gtaaatgccc gaatagaacc ctgttcaagt ggtttgtcca ctgatgtcgt
    13501 ctttagggca tttgacatct gcaactataa ggctaaggtt gctggtattg gaaaatacta
    13561 caagactaat acttgtaggt ttgtagaatt agatgaccaa gggcatcatt tagactccta
    13621 ttttgtcgtt aagaggcata ctatggagaa ttatgaacta gagaagcact gttacgattt
    13681 gttacgtgac tgtgatgctg tagctcccca tgatttcttc atctttgatg tagacaaagt
    13741 taaaacacct catattgtac gtcagcgttt aactgagtac actatgatgg atcttgtata
    13801 tgccctgagg cactttgatc aaaatagcga agtgcttaag gctatcttag tgaagtatgg
    13861 ttgctgtgat gttacctact ttgaaaataa actctggttt gattttgttg aaaatcccag
    13921 tgttattggt gtttatcata aacttggaga acgtgtacgc caagctatct taaacactgt
    13981 taaattttgt gaccacatgg tcaaggctgg tttagtcggt gtgctcacac tagacaacca
    14041 ggaccttaat ggcaagtggt atgattttgg tgacttcgta atcactcaac ctggttcagg
    14101 agtagctata gttgatagct actattctta tttgatgcct gtgctctcaa tgaccgattg
    14161 tctggccgct gagacacata gggattgtga ttttaataaa ccactcattg agtggccact
    14221 tactgagtat gattttactg attataaggt acaactcttt gagaagtact ttaaatattg
    14281 ggatcagacg tatcacgcaa attgcgttaa ttgtactgat gaccgttgtg tgttacattg
    14341 tgctaatttc aatgtattgt ttgctatgac catgcctaag acttgtttcg gacccatagt
    14401 ccgaaagatc tttgttgatg gcgtgccatt tgtagtatct tgtggttatc actacaaaga
    14461 attaggttta gtcatgaata tggatgttag tctccataga cataggctct ctcttaagga
    14521 gttgatgatg tatgccgctg atccagccat gcacattgcc tcctctaacg cttttcttga
    14581 tttgaggaca tcatgtttta gtgtcgctgc acttacaact ggtttgactt ttcaaactgt
    14641 gcggcctggc aattttaacc aagacttcta tgatttcgtg gtatctaaag gtttctttaa
    14701 ggagggctct tcagttacgc tcaaacattt tttctttgct caagatggta atgctgctat
    14761 tacagattat aattactatt cttataatct gcctactatg tgtgacatca aacaaatgtt
    14821 gttctgcatg gaagttgtaa acaagtactt cgaaatctat gacggtggtt gtcttaatgc
    14881 ttctgaagtg gttgttaata atttagacaa gagtgctggc catcctttta ataagtttgg
    14941 caaagctcgt gtctattatg agagcatgtc ttaccaggag caagatgaac tctttgccat
    15001 gacaaagcgt aacgtcattc ctaccatgac tcaaatgaat ctaaaatatg ctattagtgc
    15061 taagaataga gctcgcactg ttgcaggcgt gtccatactt agcacaatga ctaatcgtca
    15121 gtaccatcag aaaatgctta agtccatggc tgcaactcgt ggagcgactt gcgtcattgg
    15181 tactacaaag ttctatggtg gctgggattt catgcttaaa acattgtaca aagatgttga
    15241 taatccgcat cttatgggtt gggattaccc taagtgtgat agagctatgc ctaatatgtg
    15301 tagaatcttt gcttcactca tattagctcg taaacatggc acttgttgta ctacaaggga
    15361 cagattttat cgcttggcaa atgagtgtgc tcaggtgcta agcgaatatg ttctatgtgg
    15421 tggtggttac tacgtcaaac ctggaggtac cagtagcgga gacgccacca ctgcatatgc
    15481 caatagtgtc tttaacattt tgcaggcgac aactgctaat gtcagtgcac ttatgggtgc
    15541 taatggcaac aagattgttg acaaagaagt taaagacatg cagtttgatt tgtatgtcaa
    15601 tgtttacagg agcactagcc cagaccccaa atttgttgat aaatactatg cttttcttaa
    15661 taagcacttt tctatgatga tactgtctga tgacggtgtc gtttgctata atagtgatta
    15721 tgcagctaag ggttacattg ctggaataca gaattttaag gaaacgctgt attatcagaa
    15781 caatgtcttt atgtctgaag ctaaatgctg ggtggaaacc gatctgaaga aagggccaca
    15841 tgaattctgt tcacagcata cgctttatat taaggatggc gacgatggtt acttccttcc
    15901 ttatccagac ccttcaagaa ttttgtctgc cggttgcttt gtagatgata tcgttaagac
    15961 tgacggtaca ctcatggtag agcggtttgt gtctttggct atagatgctt accctctcac
    16021 aaagcatgaa gatatagaat accagaatgt attctgggtc tacttacagt atatagaaaa
    16081 actgtataaa gaccttacag gacacatgct tgacagttat tctgtcatgc tatgtggtga
    16141 taattctgct aagttttggg aagaggcatt ctatagagat ctctatagtt cgcctaccac
    16201 tttgcaggct gtcggttcat gcgttgtatg ccattcacag acttccctac gctgtgggac
    16261 atgcatccgt agaccatttc tctgctgtaa atgctgctat gatcatgtta tagcaactcc
    16321 acataagatg gttttgtctg tttctcctta cgtttgtaat gcccctggtt gtggcgtttc
    16381 agacgttact aagctatatt taggtggtat gagctacttt tgtgtagatc atagacctgt
    16441 gtgtagtttt ccactttgcg ctaatggtct tgtattcggc ttatacaaga atatgtgcac
    16501 aggtagtcct tctatagttg aatttaatag gttggctacc tgtgactgga ctgaaagtgg
    16561 tgattacacc cttgccaata ctacaacaga accactcaaa ctttttgctg ctgagacttt
    16621 acgtgccact gaagaggcgt ctaagcagtc ttatgctatt gccaccatca aagaaattgt
    16681 tggtgagcgc caactattac ttgtgtggga ggctggcaag tccaaaccac cactcaatcg
    16741 taattatgtt tttactggtt atcatataac caaaaatagt aaagtgcagc tcggtgagta
    16801 catcttcgag cgcattgatt atagtgatgc tgtatcctac aagtctagta caacgtataa
    16861 actgactgta ggtgacatct tcgtacttac ctcccactct gtggctacct tgacggcgcc
    16921 cacaattgtg aatcaagaga ggtatgttaa aattactggg ttgtacccaa ccattacggt
    16981 acctgaagag ttcgcaagtc atgttgccaa cttccaaaaa tcaggttata gtaaatatgt
    17041 cactgttcag ggaccacctg gcactggcaa aagtcatttt gctatagggt tagcgattta
    17101 ctaccctaca gcacgtgttg tttatacagc atgttcacac gcagctgttg atgctttgtg
    17161 tgaaaaagct tttaaatatt tgaacattgc taaatgttcc cgtatcattc ctgcaaaggc
    17221 acgtgttgag tgctatgaca ggtttaaagt taatgagaca aattctcaat atttgtttag
    17281 tactattaat gctctaccag aaacttctgc cgatattctg gtggttgatg aggttagtat
    17341 gtgcactaat tatgatcttt caattattaa tgcacgtatt aaagctaagc acattgtcta
    17401 tgtaggagat ccagcacagt tgccagctcc taggactttg ttgactagag gcacattgga
    17461 accagaaaat ttcaatagtg tcactagatt gatgtgtaac ttaggtcctg acatattttt
    17521 aagtatgtgc tacaggtgtc ctaaggaaat agtaagcact gtgagcgctc ttgtctacaa
    17581 taataaattg ttagccaaga aggagctttc aggccagtgc tttaaaatac tctataaggg
    17641 caatgtgacg catgatgcta gctctgccat taatagacca caactcacat ttgtgaagaa
    17701 ttttattact gccaatccgg catggagtaa ggcagtcttt atttcgcctt ataattcaca
    17761 gaatgctgtg gctcgttcaa tgctgggcct tactactcag actgttgatt cctcacaggg
    17821 ttcagaatac cagtacgtta tcttctgtca aacagcagat acggcacatg ctaacaacat
    17881 taacagattt aatgttgcaa tcactcgtgc ccaaaaaggt attctttgtg ttatgacatc
    17941 tcaggcactc tttgagtcct tagagtttac tgaattgtct tttactaatt acaagctcca
    18001 gtctcagatt gtaactggcc tttttaaaga ttgctctaga gaaacttctg gcctctcacc
    18061 tgcttatgca ccaacatacg ttagtgttga tgacaagtat aagacgagtg atgagctttg
    18121 cgtgaatctt aatttacccg caaatgtccc atactctcgt gttatttcca ggatgggctt
    18181 taaactcgat gcaacagttc ctggatatcc taagcttttc attactcgtg aagaggctgt
    18241 aaggcaagtt cgaagctgga taggcttcga tgttgagggt gctcatgctt cccgtaatgc
    18301 atgtggcacc aatgtgcctc tacaattagg attttcaact ggtgtgaact ttgttgttca
    18361 gccagttggt gttgtagaca ctgagtgggg taacatgtta acgggcattg ctgcccgtcc
    18421 tccaccaggt gaacagttta agcacctcgt gcctcttatg cataaggggg ctgcatggcc
    18481 tattgttaga cgacgtatag tgcaaatgtt gtcagacact ttagacaaat tgtctgatta
    18541 ctgtacgttt gtttgttggg ctcatggctt tgaattaacg tctgcatcat acttttgcaa
    18601 gataggtaag gaacagaagt gttgcatgtg caatagacgc gctgcagcgt actcttcacc
    18661 tctgcaatct tatgcctgtt ggactcattc ctgcggttat gattatgtct acaacccttt
    18721 ctttgtcgat gttcaacagt ggggttatgt aggcaatctt gctactaatc acgatcgtta
    18781 ttgctctgtc catcaaggag ctcatgtggc ttctaatgat gcaataatga ctcgttgttt
    18841 agctattcat tcttgtttta tagaacgtgt ggattgggat atagagtatc cttatatctc
    18901 acatgaaaag aaattgaatt cctgttgtag aatcgttgag cgcaacgtcg tacgtgctgc
    18961 tcttcttgcc ggttcatttg acaaagtcta tgatattggc aatcctaaag gaattcctat
    19021 tgttgatgac cctgttgttg attggcatta ttttgatgca cagcccttga ccaggaaggt
    19081 acaacagctt ttctatacag aggacatggc ctcaagattt gctgatgggc tctgcttatt
    19141 ttggaactgt aatgtaccaa aatatcctaa taatgcaatt gtatgcaggt ttgacacacg
    19201 tgtgcattct gagttcaatt tgccaggttg tgatggcggt agtttgtatg ttaacaagca
    19261 cgcttttcat acaccagcat atgatgtgag tgcattccgt gatctgaaac ctttaccatt
    19321 cttttattat tctactacac catgtgaagt gcatggtaat ggtagtatga tagaggatat
    19381 tgattatgta cccctaaaat ctgcagtctg tattacaact tgtaatttag ggggcgctgt
    19441 ttgtaggaag catgctacag agtacagaga gtatatggaa gcatataatc ttgtctctgc
    19501 atcaggtttc cgcctttggt gttataagac ctttgatatt tataatctct ggtctacttt
    19561 tacaaaagtt caaggtttgg aaaacattgc ttttaatgtt gttaaacaag gccattttat
    19621 tggtgttgag ggtgaactac ctgtagctgt agtcaatgat aagatcttca ccaagagtgg
    19681 cgttaatgac atttgtatgt ttgagaataa aaccactttg cctactaata tagcttttga
    19741 actctatgct aagcgtgctg tacgctcgca tcccgatttc aaattgctac acaatttaca
    19801 agcagacatt tgctacaagt tcgtcctttg ggattatgaa cgtagcaata tttatggtac
    19861 tgctactatt ggtgtatgta agtacactga tattgatgtt aattcagctt tgaatatatg
    19921 ttttgacata cgcgataatg gttcattgga gaagttcatg tctactccca atgccatctt
    19981 tatttctgat agaaaaatca agaaataccc ttgtatggta ggtcctgatt atgcttactt
    20041 caatggtgct atcatccgtg atagtgatgt tgttaaacaa ccagtgaagt tctacttgta
    20101 taagaaagtc aataatgagt ttattgatcc tactgagtgt atttacactc agagtcgctc
    20161 ttgtagtgac ttcctacccc tgtctgacat ggagaaagac tttctatctt ttgatagtga
    20221 tgttttcatt aagaagtatg gcttggaaaa ctatgctttt gagcacgtag tctatggaga
    20281 cttctctcat actacgttag gcggtcttca cttgcttatt ggtttataca agaagcaaca
    20341 ggaaggtcat attattatgg aagaaatgct aaaaggtagc tcaactattc ataactattt
    20401 tattactgag actaacacag cggcttttaa ggcggtgtgt tctgttatag atttaaagct
    20461 tgacgacttt gttatgattt taaagagtca agaccttggc gtagtatcca aggttgtcaa
    20521 ggttcctatt gacttaacaa tgattgagtt tatgttatgg tgtaaggatg gacaggttca
    20581 aaccttctac cctcgactcc aggcttctgc agattggaaa cctggtcatg caatgccatc
    20641 cctctttaaa gttcaaaatg taaaccttga acgttgtgag cttgctaatt acaagcaatc
    20701 tattcctatg cctcgcggtg tgcacatgaa catcgctaaa tatatgcaat tgtgccagta
    20761 tttaaatact tgcacattag ccgtgcctgc caatatgcgt gttatacatt ttggcgctgg
    20821 ttctgataaa ggtatcgctc ctggtacatc agttttacga cagtggcttc ctacagatgc
    20881 cattattata gataatgatt taaatgagtt cgtgtcagat gctgacataa ctttatttgg
    20941 agattgtgta actgtacgtg tcggccaaca agtggatctt gttatttccg acatgtatga
    21001 tcctactact aagaatgtaa caggtagtaa tgagtcaaag gctttattct ttacttacct
    21061 gtgtaacctc attaataata atcttgctct tggtggttct gttgctatta aaataacaga
    21121 acactcttgg agcgttgaac tttatgaact tatgggaaaa tttgcttggt ggactgtttt
    21181 ctgcaccaat gcaaatgcat cctcatctga aggattcctt ttaggtatta attacttggg
    21241 tactattaaa gaaaatatag atggtggtgc tatgcacgcc aactatatat tttggagaaa
    21301 ttccactcct atgaatctga gtacttactc actttttgat ttatccaagt ttcaattaaa
    21361 attaaaagga acaccagttc ttcaattaaa ggagagtcaa attaacgaac tcgtaatatc
    21421 tctcctgtcg cagggtaagt tacttatccg tgacaatgat acactcagtg tttctactga
    21481 tgttcttgtt aacacctaca gaaagttacg ttgatgtagg gccagattct gttaagtctg
    21541 cttgtattga ggttgatata caacagacct tctttgataa aacttggcct aggccaattg
    21601 atgtttctaa ggctgacggt attatatacc ctcaaggccg tacatattct aacataacta
    21661 tcacttatca aggtcttttt ccctatcagg gagaccatgg tgatatgtat gtttactctg
    21721 caggacatgc tacaggcaca actccacaaa agttgtttgt agctaactat tctcaggacg
    21781 tcaaacagtt tgctaatggg tttgtcgtcc gtataggagc agctgccaat tccactggca
    21841 ctgttattat tagcccatct accagcgcta ctatacgaaa aatttaccct gcttttatgc
    21901 tgggttcttc agttggtaat ttctcagatg gtaaaatggg ccgcttcttc aatcatactc
    21961 tagttctttt gcccgatgga tgtggcactt tacttagagc tttttattgt attctagagc
    22021 ctcgctctgg aaatcattgt cctgctggca attcctatac ttcttttgcc acttatcaca
    22081 ctcctgcaac agattgttct gatggcaatt acaatcgtaa tgccagtctg aactctttta
    22141 aggagtattt taatttacgt aactgcacct ttatgtacac ttataacatt accgaagatg
    22201 agattttaga gtggtttggc attacacaaa ctgctcaagg tgttcacctc ttctcatctc
    22261 ggtatgttga tttgtacggc ggcaatatgt ttcaatttgc caccttgcct gtttatgata
    22321 ctattaagta ttattctatc attcctcaca gtattcgttc tatccaaagt gatagaaaag
    22381 cttgggctgc cttctacgta tataaacttc aaccgttaac tttcctgttg gatttttctg
    22441 ttgatggtta tatacgcaga gctatagact gtggttttaa tgatttgtca caactccact
    22501 gctcatatga atccttcgat gttgaatctg gagtttattc agtttcgtct ttcgaagcaa
    22561 aaccttctgg ctcagttgtg gaacaggctg aaggtgttga atgtgatttt tcacctcttc
    22621 tgtctggcac acctcctcag gtttataatt tcaagcgttt ggtttttacc aattgcaatt
    22681 ataatcttac caaattgctt tcactttttt ctgtgaatga ttttacttgt agtcaaatat
    22741 ctccagcagc aattgctagc aactgttatt cttcactgat tttggattat ttttcatacc
    22801 cacttagtat gaaatccgat ctcagtgtta gttctgctgg tccaatatcc cagtttaatt
    22861 ataaacagtc cttttctaat cccacatgtt tgatcttagc gactgttcct cataacctta
    22921 ctactattac taagcctctt aagtacagct atattaacaa gtgctctcgt cttctttctg
    22981 atgatcgtac tgaagtacct cagttagtga acgctaatca atactcaccc tgtgtatcca
    23041 ttgtcccatc cactgtgtgg gaagacggtg attattatag gaaacaacta tctccacttg
    23101 aaggtggtgg ctggcttgtt gctagtggct caactgttgc catgactgag caattacaga
    23161 tgggctttgg tattacagtt caatatggta cagacaccaa tagtgtttgc cccaagcttg
    23221 aatttgctaa tgacacaaaa attgcctctc aattaggcaa ttgcgtggaa tattccctct
    23281 atggtgtttc gggccgtggt gtttttcaga attgcacagc tgtaggtgtt cgacagcagc
    23341 gctttgttta tgatgcgtac cagaatttag ttggctatta ttctgatgat ggcaactact
    23401 actgtctgcg tgcttgtgtt agtgttcctg tttctgtcat ctatgataaa gaaactaaaa
    23461 cccacgctac tctatttggt agtgttgcat gtgaacacat ttcttctacc atgtctcaat
    23521 actcccgttc tacgcgatca atgcttaaac ggcgagattc tacatatggc ccccttcaga
    23581 cacctgttgg ttgtgtccta ggacttgtta attcctcttt gttcgtagag gactgcaagt
    23641 tgcctctcgg tcaatctctc tgtgctcttc ctgacacacc tagtactctc acacctcgca
    23701 gtgtgcgctc tgtgccaggt gaaatgcgct tggcatccat tgcttttaat catcccattc
    23761 aggttgatca acttaatagt agttatttta aattaagtat acccactaat ttttcctttg
    23821 gtgtgactca ggagtacatt cagacaacca ttcagaaagt tactgttgat tgtaaacagt
    23881 acgtttgcaa tggtttccag aagtgtgagc aattactgcg cgagtatggc cagttttgtt
    23941 ccaaaataaa ccaggctctc catggtgcca atttacgcca ggatgattct gtacgtaatt
    24001 tgtttgcgag cgtgaaaagc tctcaatcat ctcctatcat accaggtttt ggaggtgact
    24061 ttaatttgac acttctagaa cctgtttcta tatctactgg cagtcgtagt gcacgtagtg
    24121 ctattgagga tttgctattt gacaaagtca ctatagctga tcctggttat atgcaaggtt
    24181 acgatgattg tatgcagcaa ggtccagcat cagctcgtga tcttatttgt gctcaatatg
    24241 tggctggtta taaagtatta cctcctctta tggatgttaa tatggaagcc gcgtatactt
    24301 catctttgct tggcagcata gcaggtgttg gctggactgc tggcttatcc tcctttgctg
    24361 ctattccatt tgcacagagt attttttata ggttaaacgg tgttggcatt actcaacagg
    24421 ttctttcaga gaaccaaaag cttattgcca ataagtttaa tcaggctctg ggagctatgc
    24481 aaacaggctt cactacaact aatgaagctt ttcggaaggt tcaggatgct gtgaacaaca
    24541 atgcacaggc tctatccaaa ttagctagcg agctatctaa tacttttggt gctatttccg
    24601 cctctattgg agacatcata caacgtcttg atgttctcga acaggacgcc caaatagaca
    24661 gacttattaa tggccgtttg acaacactaa atgcttttgt tgcacagcag cttgttcgtt
    24721 ccgaatcagc tgctctttcc gctcaattgg ctaaagataa agtcaatgag tgtgtcaagg
    24781 cacaatccaa gcgttctgga ttttgcggtc aaggcacaca tatagtgtcc tttgttgtaa
    24841 atgcccctaa tggcctttac tttatgcatg ttggttatta ccctagcaac cacattgagg
    24901 ttgtttctgc ttatggtctt tgcgatgcag ctaaccctac taattgtata gcccctgtta
    24961 atggctactt tattaaaact aataacacta ggattgttga tgagtggtca tatactggct
    25021 cgtccttcta tgcacctgag cccatcacct ctcttaatac taagtatgtt gcaccacagg
    25081 tgacatacca aaacatttct actaacctcc ctcctcctct tctcagcaat tccaccggga
    25141 ttgacttcca agatgagttg gatgagtttt tcaaaaatgt tagcaccagt atacctaatt
    25201 ttggttctct aacacagatt aatactacat tactcgatct tacctacgag atgttgtctc
    25261 ttcaacaagt tgttaaagcc cttaatgagt cttatataga ccttaaagag cttggcaatt
    25321 atacttatta caacaaatgg ccgtggtaca tttggcttgg tttcattgct gggcttgttg
    25381 ccttagctct atgcgtcttc ttcatactgt gctgcactgg ttgtggcaca aactgtatgg
    25441 gaaaacttaa gtgtaatcgt tgttgtgata gatacgagga atacgacctc gagccgcata
    25501 aggttcatgt tcactaatta acgaactatc aatgagagtt caaagaccac ccactctctt
    25561 gttagtgttc tcactctctc ttttggtcac tgcattttca aaacctctct atgtacctga
    25621 gcattgtcag aattattctg gttgcatgct tagggcttgt attaaaactg cccaagctga
    25681 tacagctggt ctttatacaa attttcgaat tgacgtccca tctgcagaat caactggtac
    25741 tcaatcagtt tctgtcgatc gtgagtcaac ttcaactcat gatggtccta ccgaacatgt
    25801 tactagtgtg aatctttttg acgttggtta ctcagttaat taacgaactc tatggattac
    25861 gtgtctctgc ttaatcaaat ttggcagaag taccttaatt caccgtatac tacttgtttg
    25921 tatatcccta aacccacagc taagtataca cctttagttg gcacttcatt gcaccctgtg
    25981 ctgtggaact gtcagctatc ctttgctggt tatactgaat ctgctgttaa ttctacaaaa
    26041 gctttggcca aacaggacgc agctcagcga atcgcttggt tgctacataa ggatggagga
    26101 atccctgatg gatgttccct ctacctccgg cactcaagtt tattcgcgca aagcgaggaa
    26161 gaggagtcat tctccaacta agaaactgcg ctacgttaag cgtagatttt ctcttctgcg
    26221 ccctgaagac cttagtgtta ttgtccaacc aacacactat gtcagggtta cattttcaga
    26281 ccccaacatg tggtatctac gttcgggtca tcatttacac tcagttcaca attggcttaa
    26341 accttatggc ggccaacctg tttctgagta ccatattact ctagctttgc taaatctcac
    26401 tgatgaagat ttagctagag atttttcacc cattgcgctc tttttgcgca atgtcagatt
    26461 tgagctacat gagttcgcct tgctgcgcaa aactcttgtt cttaatgcat cagagatcta
    26521 ctgtgctaac atacatagat ttaagcctgt gtatagagtt aacacggcaa tccctactat
    26581 taaggattgg cttctcgttc agggattttc cctttaccat agtggcctcc ctttacatat
    26641 gtcaatctct aaattgcatg cactggatga tgttactcgc aattacatca ttacaatgcc
    26701 atgctttaga acttatcctc aacaaatgtt tgttactcct ttggccgtag atgttgtctc
    26761 catacggtct tccaatcagg gtaataaaca aattgttcat tcttacccca ttttacatca
    26821 tccaggattt taacgaacta tggctttctc ggcgtcttta tttaaacccg tccagctagt
    26881 cccagtttct cctgcatttc atcgcattga gtctactgac tctattgttt tcacatacat
    26941 tcctgctagc ggctatgtag ctgctttagc tgtcaatgtg tgtctcattc ccctattatt
    27001 actgctacgt caagatactt gtcgtcgcag cattatcaga actatggttc tctatttcct
    27061 tgttctgtat aactttttat tagccattgt actagtcaat ggtgtacatt atccaactgg
    27121 aagttgcctg atagccttct tagttatcct cataatactt tggtttgtag atagaattcg
    27181 tttctgtctc atgctgaatt cctacattcc actgtttgac atgcgttctc actttattcg
    27241 tgttagtaca gtttcttctc atggtatggt ccctgtcata cacaccaaac cattatttat
    27301 tagaaacttc gatcagcgtt gcagctgttc tcgttgtttt tatttgcact cttccactta
    27361 tatagagtgc acttatatta gccgttttag taagattagc ctagtttctg taactgactt
    27421 ctccttaaac ggcaatgttt ccactgtttt cgtgcctgca acgcgcgatt cagttcctct
    27481 tcacataatc gccccgagct cgcttatcgt ttaagcagct ctgcgctact atgggtcccg
    27541 tgtagaggct aatccattag tctctctttg gacatatgga aaacgaacta tgttaccctt
    27601 tgtccaagaa cgaatagggt tgttcatagt aaactttttc atttttaccg tagtatgtgc
    27661 tataacactc ttggtgtgta tggctttcct tacggctact agattatgtg tgcaatgtat
    27721 gacaggcttc aataccctgt tagttcagcc cgcattatac ttgtataata ctggacgttc
    27781 agtctatgta aaattccagg atagtaaacc ccctctacca cctgacgagt gggtttaacg
    27841 aactccttca taatgtctaa tatgacgcaa ctcactgagg cgcagattat tgccattatt
    27901 aaagactgga actttgcatg gtccctgatc tttctcttaa ttactatcgt actacagtat
    27961 ggatacccat cccgtagtat gactgtctat gtctttaaaa tgtttgtttt atggctccta
    28021 tggccatctt ccatggcgct atcaatattt agcgccattt atccaattga tctagcttcc
    28081 cagataatct ctggcattgt agcagctgtt tcagctatga tgtggatttc ctactttgtg
    28141 cagagtatcc ggctgtttat gagaactgga tcatggtggt cattcaatcc tgagactaat
    28201 tgccttttga acgttccatt tggtggtaca actgtcgtac gtccactcgt agaggactct
    28261 accagtgtaa ctgctgttgt aaccaatggc cacctcaaaa tggctggcat gcatttcggt
    28321 gcttgtgact acgacagact tcctaatgaa gtcaccgtgg ccaaacccaa tgtgctgatt
    28381 gctttaaaaa tggtgaagcg gcaaagctac ggaactaatt ccggcgttgc catttaccat
    28441 agatataagg caggtaatta caggagtccg cctattacgg cggatattga acttgcattg
    28501 cttcgagctt aggctcttta gtaagagtat cttaattgat tttaacgaat ctcaatttca
    28561 ttgttatggc atcccctgct gcacctcgtg ctgtttcctt tgccgataac aatgatataa
    28621 caaatacaaa cctgtctcga ggtagaggac gtaatccaaa accacgagct gcaccaaata
    28681 acactgtctc ttggtacact gggcttaccc aacacgggaa agtccctctt acctttccac
    28741 ctgggcaggg tgtacctctt aatgccaatt ccaccccagc gcaaaatgct gggtattggc
    28801 ggagacagga cagaaaaatt aataccggga atggaattaa gcaactggct cccaggtggt
    28861 acttctacta cactggaacc ggacccgaag cagcactccc attccgggct gttaaggatg
    28921 gcatcgtttg ggtccatgaa catggcgcca ctgatgctcc ttcaactttt gggacgcgga
    28981 accctaacaa tgattcagct attgttacac aattcgcgcc cggtactaag cttcctaaaa
    29041 acttccacat tgaggggact ggaggcaata gtcaatcatc ttcaagagcc tctagcgtaa
    29101 gcagaaactc ttccagatct agttcacaag gttcaagatc aggaaactct acccgcggca
    29161 cttctccagg tccatctgga atcggagcag taggaggtga tctactttac cttgatcttc
    29221 tgaacagact acaagccctt gagtctggca aagtaaagca atcgcagcca aaagtaatca
    29281 ctaagaaaga tgctgctgct gctaaaaata agatgcgcca caagcgcact tccaccaaaa
    29341 gtttcaacat ggtgcaagct tttggtcttc gcggaccagg agacctccag ggaaactttg
    29401 gtgatcttca attgaataaa ctcggcactg aggacccacg ttggccccaa attgctgagc
    29461 ttgctcctac agccagtgct tttatgggta tgtcgcaatt taaacttacc catcagaaca
    29521 atgatgatca tggcaaccct gtgtacttcc ttcggtacag tggagccatt aaacttgacc
    29581 caaagaatcc caactacaat aagtggttgg agcttcttga gcaaaatatt gatgcctaca
    29641 aaaccttccc taagaaggaa aagaaacaaa aggcaccaaa agaagaatca acagaccaaa
    29701 tgtctgaacc tcctaaggag cagcgtgtgc aaggtagcat cactcagcgc actcgcaccc
    29761 gtccaagtgt tcagcctggt ccaatgattg atgttaacac tgattagtgt cactcaaagt
    29821 aacaagatcg cggcaatcgt ttgtgtttgg taaccccatc tcaccatcgc ttgtccactc
    29881 ttgcacagaa tggaatcatg ttgtaattac agtgcaataa ggtaattata acccatttaa
    29941 ttgatagcta tgctttatta aagtgtgtag ctgtagagag aatgttaaag actgtcacct
    30001 ctgcctgatt gcaagtgaac agtgcccccc gggaagagct ctacagtgtg aaatgtaaat
    30061 aaaaatagct attattcaat tagattaggc taattagatg atttgcaaaa aaaaaaa

Share this post


Link to post
Share on other sites
LOCUS       KT368850               30118 bp    RNA     linear   VRL 17-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate
            camel/Jeddah/O24/2014, complete genome.
ACCESSION   KT368850
VERSION     KT368850.1  GI:922058136
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 30118)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Co-circulation of three camel coronavirus species and recombination
            of MERS-CoVs in Saudi Arabia
  JOURNAL   Science (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 30118)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2015) Centre of Influenza Research & State Key
            Laboratory of Emerging Infectious Diseases, The University of Hong
            Kong, Laboratory Block, 21 Sassoon Road, Pokfulam, Hong Kong SAR,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..30118
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="camel/Jeddah/O24/2014"
                     /host="camel"
                     /db_xref="taxon:1335626"
                     /country="Saudi Arabia"
                     /collection_date="Oct-2014"
     gene            279..21514
                     /gene="orf1ab"
     CDS             join(279..13433,13433..21514)
                     /gene="orf1ab"
                     /ribosomal_slippage
                     /codon_start=1
                     /product="polyprotein ORF1ab"
                     /protein_id="ALA49626.1"
                     /db_xref="GI:922058138"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLALAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINRDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
                     RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
                     RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
                     RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
                     KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
                     DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
                     VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
                     RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
                     VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
                     EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
                     MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
                     GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
                     LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
                     NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
                     AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
                     LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
                     YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
                     SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
                     FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
                     PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
                     ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
                     RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
                     RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
                     NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
                     PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
                     KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
                     SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
                     TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYS
                     RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
                     FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
                     MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
                     WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
                     CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
                     DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
                     VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
                     DIDYVPLKSAVCITTCNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
                     WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
                     TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
                     VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDV
                     VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
                     ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
                     AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
                     RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
                     TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
                     DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
                     TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
                     FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
                     LSVSTDVLVNTYRKLR"
     gene            279..13454
                     /gene="orf1a"
     CDS             279..13454
                     /gene="orf1a"
                     /codon_start=1
                     /product="polyprotein ORF1a"
                     /protein_id="ALA49625.1"
                     /db_xref="GI:922058137"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLALAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINRDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
     gene            21456..25517
                     /gene="S"
     CDS             21456..25517
                     /gene="S"
                     /codon_start=1
                     /product="spike protein"
                     /protein_id="ALA49627.1"
                     /db_xref="GI:922058139"
                     /translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
                     PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
                     ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
                     MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
                     YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
                     NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
                     RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
                     PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
                     SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
                     DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
                     LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
                     VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
                     SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
                     TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
                     IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
                     QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
                     QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
                     AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
                     QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
                     SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
                     IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
                     VAPQVTYQNISTNLPPPLLSNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
                     TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
                     TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
     gene            25532..25843
                     /gene="orf3"
     CDS             25532..25843
                     /gene="orf3"
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="ALA49628.1"
                     /db_xref="GI:922058140"
                     /translation="MRVQRPPTLLLVFSLSLLVTAFSKPLYVPEHCQNYSGCMLRACI
                     KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGPTEHVTSVNLFDVGYSV
                     N"
     gene            25852..26181
                     /gene="orf4a"
     CDS             25852..26181
                     /gene="orf4a"
                     /codon_start=1
                     /product="ORF4a"
                     /protein_id="ALA49629.1"
                     /db_xref="GI:922058141"
                     /translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
                     WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
                     EEESFSN"
     gene            26093..26833
                     /gene="orf4b"
     CDS             26093..26833
                     /gene="orf4b"
                     /codon_start=1
                     /product="ORF4b"
                     /protein_id="ALA49630.1"
                     /db_xref="GI:922058142"
                     /translation="MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
                     EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
                     TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
                     PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
                     VDVVSIRSSNQGNKQIVHSYPILHHPGF"
     gene            26840..27514
                     /gene="orf5"
     CDS             26840..27514
                     /gene="orf5"
                     /codon_start=1
                     /product="ORF5"
                     /protein_id="ALA49631.1"
                     /db_xref="GI:922058143"
                     /translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
                     VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
                     ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
                     CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
                     PSSLIV"
     gene            27590..27838
                     /gene="E"
     CDS             27590..27838
                     /gene="E"
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ALA49632.1"
                     /db_xref="GI:922058144"
                     /translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
                     TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
     gene            27853..28512
                     /gene="M"
     CDS             27853..28512
                     /gene="M"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="ALA49633.1"
                     /db_xref="GI:922058145"
                     /translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
                     VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
                     MRTGSWWSFNPETNCLLNVPFGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
                     DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
                     A"
     gene            28566..29807
                     /gene="N"
     CDS             28566..29807
                     /gene="N"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="ALA49634.1"
                     /db_xref="GI:922058146"
                     /translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
                     TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
                     TGTGPEAALPFRAVKDGIVWVHEHGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
                     HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
                     LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
                     NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
                     IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
                     TQRTRTRPSVQPGPMIDVNTD"
     gene            28762..29100
                     /gene="orf8b"
     CDS             28762..29100
                     /gene="orf8b"
                     /codon_start=1
                     /product="ORF8b"
                     /protein_id="ALA49635.1"
                     /db_xref="GI:922058147"
                     /translation="MPIPPQRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLEPDPKQ
                     HSHSGLLRMASFGSMNMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
                     IVNHLQEPLA"
ORIGIN      
        1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
       61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
      121 gtggcactaa tttgcctgct catctaggca gtggacatat gctcaacact gggtataatt
      181 ctaattgaat actatttttc agttagagcg tcgtgtctct tgtacgtctc ggtcacaata
      241 cacggtttcg tccggtgcgt ggcaattcgg ggcacatcat gtctttcgtg gctggtgtga
      301 tcgcgcaagg tgcgcgcggt acgtatcgag cagcgctcaa ctctgaaaaa catcaagacc
      361 atgtgtctct aactgtgcca ctctgtggtt caggaaacct ggttgaaaaa ctttcaccat
      421 ggttcatgga tggcgaaaat gcctatgaag tggtgaaggc catgttactt aaaaaagagc
      481 cacttctcta tgtgcccatc cggctggctg gacacactag acacctccca ggtcctcgtg
      541 tgtacctggt tgagaggctc attgcttgtg aaaatccatt catggttaac caattggctt
      601 atagctctag tgcaaatggc agcctggttg gcacaacttt gcagggcaag cctattggta
      661 tgttcttccc ttatgacatc gaacttgtca caggaaagca aaatattctc ctgcgcaagt
      721 atggccgtgg tggttatcac tacaccccat tccactatga gcgagacaac acctcttgcc
      781 ctgagtggat ggacgatttt gaggcggatc ctaaaggcaa atatgcccag aatctgctta
      841 agaagttgat tggcggtgat gtcactccag ttgaccaata catgtgtggc gttgatggaa
      901 aacccattag tgcctacgca tttttaatgg ccaaggatgg aataaccaaa ctggctgatg
      961 ttgaagcgga cgtcgcagca cgtgctgatg acgaaggctt catcacatta aagaacaatc
     1021 tatatagatt ggtttggcat gttgagcgta aagacgttcc atatcctaag caatctattt
     1081 ttactattaa tagtgtggtc caaaaggatg gtgttgaaaa cactcctcct cactatttta
     1141 ctcttggatg caaaatttta acgctcaccc cacgcaacaa gtggagtggc gtttctgact
     1201 tgtccctcaa acaaaaactc ctttacacct tctatggtaa ggagtcactt gagaacccaa
     1261 cctacattta ccactccgca ttcattgagt gtggaagttg tggtaatgat tcctggctta
     1321 cagggaatgc tatccaaggg tttgcctgtg gatgtggggc atcatataca gctaatgatg
     1381 tcgaagtcca atcatctggc atgattaagc caaatgctct tctttgtgct acttgcccct
     1441 ttgctaaggg tgacagctgt tcttctaatt gcaaacattc agttgctcag ttggttagtt
     1501 acctttctga acgctgtaat gttattgctg attctaagtc cttcacactt atctttggtg
     1561 gcgtagctta cgcctacttt ggatgtgagg aaggtactat gtactttgtg cctagagcta
     1621 agtctgttgt ctcaaggatt ggagactcca tctttacagg ctgtactggc tcttggaaca
     1681 aggtcactca aattgctaac atgttcttgg aacagactca gcattccctt aactttgtgg
     1741 gagagttcgt tgtcaacgat gttgtcctcg caattctctc tggaaccaca actaatgttg
     1801 acaaaatacg ccagcttctc aaaggtgtca ccattgacaa gttgcgtgat tatttagctg
     1861 actatgacgt agcagtcact gccggcccat tcatggataa tgctattaat gttggtggta
     1921 caggattaca gtatgccgcc attactgcac cttatgtagt tctcactggc ttaggtgagt
     1981 cctttaagaa agttgcaacc ataccgtaca aggtttgcaa ctctgttaag gatactctga
     2041 cttattatgc tcacagcgtg ttgtacagag tttttcctta tgacatggat tctggtgtgt
     2101 catcctttag tgaactactt tttgattgcg ttgatctttc agtagcttct acctattttt
     2161 tagtccgcct cttgcaagat aagactggcg actttatgtc tacaattatt acttcctgcc
     2221 aaactgctgt tagtaagctt ctagatacat gttttgaagc tacagaagca acatttaact
     2281 tcttgttaga tttggcagga ttgttcagaa tctttcttcg caatgcctat gtgtacactt
     2341 cacaagggtt tgtggtggtc aatggcaaag tttctacact tgtcaaacaa gtgttagact
     2401 tgcttaataa gggtatgcaa cttttgcata caaaggtctc ctgggctggt tctaatatca
     2461 gtgctgttat ctacagcggc agggagtctc taatattccc atcgggaacc tattactgtg
     2521 tcaccactaa ggctaagtcc gttcaacaag atcttgacgt tattttgcct ggtgagtttt
     2581 ccaagaagca gttaggactg ctccaaccta ctgacaattc tacaactgtt agtgttactg
     2641 tatccagtaa catggttgaa actgttgtgg gtcaacttga gcaaactaat atgcatagtc
     2701 ctgatgttat agtaggtgac tatgtcatta ttagtgaaaa attgtttgtg cgtagtaagg
     2761 aagaagacgg atttgccttc taccctgctt gcactaatgg tcatgctgta ccgactctct
     2821 ttagacttaa gggaggtgca cctgtaaaaa aagtagcctt tggcggtgat caagtacatg
     2881 aggttgctgc tgtaagaagt gttactgtcg agtacaacat tcatgctgta ttagacacac
     2941 tacttgcttc ttctagtctt agaacctttg ttgtagataa gtctttgtca attgaggagt
     3001 ttgctgacgt agtaaaggaa caagtctcag acttgcttgt taaattactg cgtggaatgc
     3061 cgattccaga ttttgattta gacgatttta ttgacgcacc atgctattgc tttaacgctg
     3121 agggtgatgc atcttggtct tctactatga tcttctctct tcaccccgtc gagtgtgacg
     3181 aggagtgttc tgaagtagag gcttcagatt tagaagaagg tgaatcagag tgcatttctg
     3241 agacttcaac tgaacaagtt gacgtttctc atgaggtttc tgacgacgag tgggctgctg
     3301 cagttgatga agcgttcccc ctcgatgaag cagaagatgt tactgaatct gtgcaagaag
     3361 aagcacaacc agtagaagta cctgttgaag atattgcgca ggttgtcata gctgacacct
     3421 tacaggaaac tcctgttgtg tttgatactg ttgaagtccc accgcaagtg gtgaaacttc
     3481 cgtctgaacc tcagactatc cagcccgagg taaaagaagt tgcacctgtc tatgaggctg
     3541 ataccgaaca gacacagagt gttactgtta aacctaagag gttacgcaaa aagcgtaatg
     3601 ttgacccttt gtccaatttt gaacataagg ttattacaga gtgcgttacc atagttttag
     3661 gtgacgcaat tcaagtagcc aagtgctatg gggagtctgt gttagttaat gctgctaaca
     3721 cacatcttaa gcatggcggt ggtatcgctg gtgctattaa tgcggcttca aaaggggctg
     3781 tccaaaaaga gtcagatgag tatattctgg ctaaagggcc gttacaagta ggagattcag
     3841 ttctcttgca aggccattct ctagctaaga atatcctgca tgtcgtaggc ccagatgccc
     3901 gcgctaaaca ggatgtttct ctccttagta agtgctataa ggctatgaat gcatatcctc
     3961 ttgtagtcac tcctcttgtt tcagcaggca tatttggtgt aaaaccagct gtgtcttttg
     4021 attatcttat tagagaggct aagactagag ttttagtcgt cgttaattcc caagatgtct
     4081 ataagagtct taccatagtt gacattccac agagtttgac tttttcatat gatgggttac
     4141 gtggcgcaat acgtaaagct aaagattatg gttttactgt ttttgtgtgc acagacaact
     4201 ctgctaacac taaagttctt aggaacaagg gtgttgatta tactaagaag tttcttacag
     4261 ttgacggtgt gcaatattat tgctacacgt ctaaggacac tttagatgat atcttacaac
     4321 aggctaataa gtctgttggt attatatcta tgcctttggg atatgtgtct catggtttag
     4381 acttaattca agcagggagt gtcgtgcgta gagttaacgt gccctacgtg tgtctcctag
     4441 ctaataaaga gcaagaagct attttgatgt ctgaagacgt taagttaaac ccttcagaag
     4501 attttataaa gcacgtccgc actaatggtg gttacaattc ttggcattta gtcgagggtg
     4561 aactattggt gcaagactta cgcttaaata agctcctgca ttggtctgat caaaccatat
     4621 gctacaagga tagtgtgttt tatgttgtaa agaatagtac agcttttcca tttgaaacac
     4681 tttcagcatg tcgtgcgtat ttggattcac gcacgacaca gcagttaaca atcgaagtct
     4741 tagtgactgt cgatggtgta aattttagaa cagtcgttct aaataataag aacacttata
     4801 gatcacagct tggatgcgtt ttctttaatg gtgctgatat ttctgatacc attcctgatg
     4861 agaaacagaa tggtcacagt ttatatctag cagacaattt gactgctgat gaaacaaagg
     4921 cgcttaaaga gttatatggc cccgttgatc ctactttctt acacagattc tattcactta
     4981 aggcagcagt ccatgggtgg aagatggttg tgtgtgataa ggtacgttct ctcaaattga
     5041 gtgataataa ttgttatctt aatgcagtta ttatgacact tgatttattg aaggacatta
     5101 aatttgttat acctgctcta cagcatgcat ttatgaaaca taagggcggt gattcaactg
     5161 acttcatagc cctcattatg gcttatggca attgcacatt tggtgctcca gatgatgcct
     5221 ctcggttact tcacaccgtg cttgcaaagg ctgagttatg ctgttctgca cgcatggttt
     5281 ggagagagtg gtgcaatgtc tgtggcataa aagatgttgt tctacaaggc ttaagagctt
     5341 gttgttacgt gggtgtgcaa actgttgaag atctgcgtgc tcgcatgaca tatgtatgcc
     5401 agtgtggtgg tgaacgtcat cggcaaatag tcgaacacac cactccctgg ttgctgctct
     5461 caggcacacc aaatgaaaaa ttggtgacaa ccttcacggc gcctgatttt gtagcgttta
     5521 atgtctttca gggcattgaa acggctgttg gccattatgt tcatgctcgc ctgaagggtg
     5581 gtcttatttt aaagtttgac tctggcaccg ttagcaagac ttcagactgg aagtgcaagg
     5641 tgacagatgt acttttcccc ggccaaaaat acagtagcga ttgtaatgtc gtacggtatt
     5701 ctttggacgg taatttcaga acagaggttg atcccgacct atctgctttc tatgttaagg
     5761 atggtaaata ctttacaagt gaaccacccg taacatattc accagctaca attttagctg
     5821 gtagtgtcta cactaatagc tgccttgtat cgtctgatgg acaacctggc ggtgatgcta
     5881 ttagtttgag ttttaataac cttttagggt ttgattctag taaaccagtc actaagaaat
     5941 acacttactc cttcttgcct aaagaagacg gcgatgtgtt gttggctgag tttgacactt
     6001 atgaccctat ttataagaat ggtgccatgt ataaaggcaa accaattctt tgggtcaaca
     6061 aagcatctta tgatattaat cttaataagt tcaatagagc tagtttgcgt caaatttttg
     6121 acgtagcccc cattgaactc gaaaataaat tcacaccttt gagtgtggcg tctacaccag
     6181 ttgaacctcc aactgtagat gtggtagcac ttcaacagga aatgacaatt gtcaaatgta
     6241 agggtttaaa taaacctttc gtgaaggaca atgtcagttt cgttgttgat gactcaggta
     6301 ctcccgttgt tgagtatctg tctaaagaag atctacatac attgtatgta gaccctaagt
     6361 atcaagtcat tgtcttaaaa gacaatgtac tttcttctat gcttagattg cacaccgttg
     6421 agtcaggtga tattaacgtt gttgcagctt ccggatcttt gacacgtaaa gtgaagttac
     6481 tatttagggc ttcattttat ttcaaagaat ttgctacccg cactttcact gctaccactg
     6541 ctgtaggtag ttgtataaag agtgtagtgc ggcatctagg tgttactaaa ggcatattga
     6601 caggctgttt tagttttgtc aagatgttat ttatgcttcc actagcttac tttagtgatt
     6661 caaaactcgg caccacagag gttaaagtga gtgctttgaa aacagctggc gttgtgacag
     6721 gtaatgttgt aaaacagtgt tgcactgctg ctgttgattt aagtatggat aagttgcgcc
     6781 gtgtggattg gaaatcaacc ctacggttgt tacttatgtt atgcacaact atggtattgt
     6841 tgtcttctgt gtatcacttg tatgtcttca atcaggtctt atcaagtgat gttatgtttg
     6901 aagatgccca aggtttgaaa aagttctaca aagaagttag agcttaccta ggaatctctt
     6961 ctgcttgtga cggtcttgct ttagcttata gggcgaattc atttgatgta cctacattct
     7021 gcgcaaaccg ttctgcaatg tgtaattggt gcttgattag ccaagattcc ataactcact
     7081 acccagctct taagatggtt caaacacatc ttagccacta tgttcttaac atagattggt
     7141 tgtggtttgc atttgagact ggtttggcat acatgctcta tacctcggcc ttcaactggt
     7201 tgttgttggc aggtacattg cattatttct ttgcacaaac ttccatattt gtagactggc
     7261 ggtcatacaa ttatgctgtg tctagtgcct tctggttatt cacccacatt ccaatggcgg
     7321 gtttggtacg aatgtataat ttgttagcat gcctttggct tttacgcaag ttttatcagc
     7381 atgtaatcaa tggttgcaaa gatacggcat gcttgctctg ctataagagg aaccgactta
     7441 ctagagttga agcttctacc gttgtctgtg gtggaaaacg tacgttttat atcacagcaa
     7501 atggcggtat ttcattctgt cgtaggcata attggaattg tgtggattgt gacattgcag
     7561 gtgtggggaa taccttcatc tgtgaagaag tcgcaaatga cctcactacc gccctacgca
     7621 ggcctattaa cgctacggat agatcacatt attatgtgga ttccgttaca gttaaagaga
     7681 ctgttgttca gtttaattat cgtagagacg gtcaaccatt ctacgagcgg tttcccctct
     7741 gcgcttttac aaatctagat aagttgaagt tcaaagaggt ctgtaaaact actactggta
     7801 tacctgaata caactttatc atctacgact catcagatcg tggccaggaa agtttagcta
     7861 ggtctgcatg tgtttattat tctcaagtct tgtgtaaatc aattcttttg gttgactcaa
     7921 gtttggttac ttctgttggt gattctagtg aaatcgccac taaaatgttt gattcctttg
     7981 ttaatagttt cgtctcgctg tataatgtca cacgcgataa gttggaaaaa cttatctcta
     8041 ctgctcgtga tggcgtaagg cgaggcgata acttccatag tgtcttaaca acattcattg
     8101 acgcagcacg aggccccgca ggtgtggagt ctgatgttga gaccaatgaa attgttgact
     8161 ctgtgcagta tgctcataaa catgacatac aaattactaa tgagagttac aataattatg
     8221 taccctcata tgttaaacct gatagtgtgt ctaccagtga tttaggtagt ctcattgatt
     8281 gtaatgcggc ttcagttaac caaattgtct tgcgtaattc taatggtgct tgtatttgga
     8341 acgctgctgc atatatgaaa ctctcggatg cacttaaacg acagattcgc attgcatgcc
     8401 gtaagtgtaa tttagctttc cggttaacca cctcaaagct acgcgctaat gataatatct
     8461 tatcagttag attcactgct aacaaaattg ttggtggtgc tcctacatgg tttaatgtgt
     8521 tgcgtgactt tacgttaaag ggttacgttc ttgctaccat tattgtgttt ctgtgtgctg
     8581 tactgatgta tttgtgttta cctacatttt ctatggtacc tgttgaattt tatgaagacc
     8641 gcatcttgga ctttaaagtt cttgataatg gtatcattag ggatgtaaat cctgatgata
     8701 agtgctttgc taataagcac cggtccttca cacaatggta tcatgagcat gttggtggtg
     8761 tctatgacaa ctctatcaca tgcccattga cagttgcagt aattgctgga gttgctggtg
     8821 ctcgcattcc agacgtacct actacattgg cttgggtgaa caatcagata attttctttg
     8881 tttctcgagt ctttgctaat acaggcagtg tttgctacac tcctatagat gagataccct
     8941 ataagagttt ctctgatagt ggttgcattc ttccatctga gtgcactatg tttagggatg
     9001 cagagggccg tatgacacca tactgccatg atcctactgt tttgcctggg gcttttgcgt
     9061 acagtcagat gaggcctcat gttcgttacg acttgtatga tggtaacatg tttattaaat
     9121 ttcctgaagt agtatttgaa agtacactta ggattactag aactctgtca actcagtact
     9181 gccggttcgg tagttgtgag tatgcacaag agggtgtttg tattaccaca aatggctcgt
     9241 gggccatttt taatgaccac catcttaata gacctggtgt ctattgtggt tctgatttta
     9301 ttgacattgt caggcggtta gcagtatcac tgttccagcc tattacttat ttccaattga
     9361 ctacctcatt ggtcttgggt ataggtttgt gtgcattcct gactttgctc ttttattata
     9421 ttaataaagt aaaacgtgct tttgcagatt acacccagtg tgctgtaatt gctgttgttg
     9481 ctgctgttct taatagcttg tgcatctgct ttgttgcctc tataccattg tgtatagtac
     9541 cttacactgc attgtactat tatgctacat tctattttac taatgagcct gcatttatta
     9601 tgcatgtttc ttggtacatt atgttcgggc ctatcgttcc catatggatg acctgcgtct
     9661 atacagttgc aatgtgcttt agacacttct tctgggtttt agcttatttt agtaagaaac
     9721 atgtagaagt ttttactgat ggtaagctta attgtagttt ccaggacgct gcctctaata
     9781 tctttgttat taacagggac acttatgcag ctcttagaaa ctctttaact aatgatgcct
     9841 attcacgatt tttggggttg tttaacaagt ataagtactt ctctggtgct atggaaacag
     9901 ccgcttatcg tgaagctgca gcatgtcatc ttgctaaagc cttacaaaca tacagcgaga
     9961 ctggtagtga tcttctttac caaccaccca actgtagcat aacctctggc gtgttgcaaa
    10021 gcggtttggt gaaaatgtca catcccagtg gagatgttga ggcttgtatg gttcaggtta
    10081 cctgcggtag catgactctt aatggtcttt ggcttgacaa cacagtctgg tgcccacgac
    10141 acgtaatgtg cccggctgac cagttgtctg atcctaatta tgatgccttg ttgatttcta
    10201 tgactaatca tagtttcagt gtgcaaaaac acattggcgc tccagcaaac ttgcgtgttg
    10261 ttggtcatgc catgcaaggc actcttttga agttgactgt cgatgttgct aaccctagca
    10321 ctccagccta cacttttaca acagtgaaac ctggcgcagc atttagtgtg ttagcatgct
    10381 ataatggtcg tccgactggt acattcactg ttgtaatgcg ccctaactac acaattaagg
    10441 gttcctttct gtgtggttct tgtggtagtg ttggttacac caaggagggt agtgtgatca
    10501 atttttgtta catgcatcaa atggaacttg ctaatggtac acataccggt tcagcatttg
    10561 atggtactat gtatggtgcc tttatggata aacaagtgca ccaagttcag ttaacagaca
    10621 aatactgcag tgttaatgta gtagcttggc tttacgcagc aatacttaat ggttgcgctt
    10681 ggtttgtaaa acctaatcgc actagtgttg tttcttttaa tgaatgggct cttgccaacc
    10741 aattcactga atttgttggc actcaatccg ttgacatgtt agctgtcaaa acaggcgttg
    10801 ctattgaaca gctgctttat gcgatccaac aactttatac tgggttccag ggaaagcaaa
    10861 tccttggcag tactatgttg gaagatgaat tcacacctga ggatgttaat atgcagatta
    10921 tgggtgtggt tatgcagagt ggtgtgagaa aagttacata tggtactgcg cattggttgt
    10981 tcgcgaccct tgtctcaacc tatgtgataa tcttacaagc cactaaattt actttgtgga
    11041 actacttgtt tgagactatt cccacacagt tgttcccact cttatttgtg actatggcct
    11101 tcgttatgtt gttggttaaa cacaaacaca cctttttgac acttttcttg ttgcctgtgg
    11161 ctatttgttt gacttatgca aacatagtct acgagcccac tactcccatt tcgtcagcgc
    11221 tgattgcagt tgcaaattgg cttgccccca ctaatgctta tatgcgcact acacatactg
    11281 atattggtgt ctacattagt atgtcacttg tattagtcat tgtagtgaag agattgtaca
    11341 acccatcact ttctaacttt gcgttagcat tgtgcagtgg tgtaatgtgg ttgtacactt
    11401 atagcattgg agaagcctca agccccattg cctatctggt ttttgtcact acactcacta
    11461 gtgattatac gattacagtc tttgttactg tcaaccttgc aaaagtttgc acttatgcca
    11521 tctttgctta ctcaccacag cttacacttg tgtttccgga agtgaagatg atacttttat
    11581 tatacacatg tttaggtttc atgtgtactt gctattttgg tgtcttctct cttttgaacc
    11641 ttaagcttag agcacctatg ggtgtctatg actttaaggt ctcaacacaa gagttcagat
    11701 tcatgactgc taacaatcta actgcaccta gaaattcttg ggaggctatg gctctgaact
    11761 ttaagttaat aggtattggc ggtacacctt gtataaaggt tgctgctatg cagtctaaac
    11821 ttacagatct taaatgcaca tctgtggttc tcctctctgt gctccaacag ttacacttag
    11881 aggctaatag tagggcctgg gctttctgtg ttaaatgcca taatgatata ttggcagcaa
    11941 cagaccccag tgaggctttc gagaaattcg taagtctctt tgccacttta atgacttttt
    12001 ctggtaatgt agatcttgat gcgttagcta gtgatatttt tgacactcct agcgtacttc
    12061 aagctactct ttctgagttt tcacacttag ctacctttgc tgagttggaa gctgcgcaga
    12121 aagcctatca ggaagctatg gactctggtg acacctcacc acaagttctt aaggctttgc
    12181 agaaggctgt taatatagct aaaaacgcct atgagaagga taaggcagtg gcccgtaagt
    12241 tagaacgtat ggctgatcag gctatgactt ctatgtataa gcaagcacgt gctgaagaca
    12301 agaaagcaaa aattgtcagt gctatgcaaa ctatgttgtt tggtatgatt aagaagctcg
    12361 acaacgatgt tcttaatggt atcatttcta acgctaggaa tggttgtata cctcttagtg
    12421 tcattccact gtgtgcttca aataaacttc gcgttgtaat tcctgacttc accgtctgga
    12481 atcaggtagt cacatatccc tcgcttaact acgctggggc tttgtgggac attacagtta
    12541 taaacaatgt ggacaatgaa attgttaagt cttcagatgt tgtagacagc aatgaaaatt
    12601 taacatggcc acttgtttta gaatgcacta gggcatccac ttctgccgtt aagttgcaaa
    12661 ataatgagat caaaccttca ggtttaaaaa ccatggttgt gtctgcaggt caagagcaaa
    12721 ctaactgtaa tactagttcc ttagcttatt acgaacctgt gcagggtcgt aaaatgctga
    12781 tggctcttct ttctgataat gcctatctca aatgggcgcg tgttgaaggt aaggacggat
    12841 ttgttagtgt agagctacaa cctccttgca aattcttgat tgcgggacca aaaggacctg
    12901 aaatccgata tctctatttt gttaaaaatc ttaacaacct tcatcgcggg caagtgttag
    12961 ggcacattgc tgcgactgtt agattgcaag ctggttctaa caccgagttt gcctctaatt
    13021 cttcggtgtt gtcacttgtt aacttcaccg ttgatcctca aaaagcttat ctcgatttcg
    13081 tcaatgcggg aggtgcccca ttgacaaatt gtgttaagat gcttactcct aaaactggta
    13141 caggtatagc tatatctgtt aaaccagaga gtacagctga tcaagagact tatggtggag
    13201 cttcagtgtg tctctattgc cgtgcgcata tagaacatcc tgatgtctct ggtgtttgta
    13261 aatataaggg taagtttgtc caaatccctg ctcagtgtgt ccgtgaccct gtgggatttt
    13321 gtttgtcaaa taccccctgt aatgtctgtc aatattggat tggatatggg tgcaattgtg
    13381 actcgcttag gcaagtagca ctgccccaat ctaaagattc caatttttta aacgagtccg
    13441 gggttctatt gtaaatgccc gaatagaacc ctgttcaagt ggtttgtcca ctgatgtcgt
    13501 ctttagggca tttgacatct gcaactataa ggctaaggtt gctggtattg gaaaatacta
    13561 caagactaat acttgtaggt ttgtagaatt agatgaccaa gggcatcatt tagactccta
    13621 ttttgtcgtt aagaggcata ctatggagaa ttatgaacta gagaagcact gttacgattt
    13681 gttacgtgac tgtgatgctg tagctcccca tgatttcttc atctttgatg tagacaaagt
    13741 taaaacacct catattgtac gtcagcgttt aactgagtac actatgatgg atcttgtata
    13801 tgccctgagg cactttgatc aaaatagcga agtgcttaag gctatcttag tgaagtatgg
    13861 ttgctgtgat gttacctact ttgaaaataa actctggttt gattttgttg aaaatcccag
    13921 tgttattggt gtttatcata aacttggaga acgtgtacgc caagctatct taaacactgt
    13981 taaattttgt gaccacatgg tcaaggctgg tttagtcggt gtgctcacac tagacaacca
    14041 ggaccttaat ggcaagtggt atgattttgg tgacttcgta atcactcaac ctggttcagg
    14101 agtagctata gttgatagct actattctta tttgatgcct gtgctctcaa tgaccgattg
    14161 tctggccgct gagacacata gggattgtga ttttaataaa ccactcattg agtggccact
    14221 tactgagtat gattttactg attataaggt acaactcttt gagaagtact ttaaatattg
    14281 ggatcagacg tatcacgcaa attgcgttaa ttgtactgat gaccgttgtg tgttacattg
    14341 tgctaatttc aatgtattgt ttgctatgac catgcctaag acttgtttcg gacccatagt
    14401 ccgaaagatc tttgttgatg gcgtgccatt tgtagtatct tgtggttatc actacaaaga
    14461 attaggttta gtcatgaata tggatgttag tctccataga cataggctct ctcttaagga
    14521 gttgatgatg tatgccgctg atccagccat gcacattgcc tcctctaacg cttttcttga
    14581 tttgaggaca tcatgtttta gtgtcgctgc acttacaact ggtttgactt ttcaaactgt
    14641 gcggcctggc aattttaacc aagacttcta tgatttcgtg gtatctaaag gtttctttaa
    14701 ggagggctct tcagttacgc tcaaacattt tttctttgct caagatggta atgctgctat
    14761 tacagattat aattactatt cttataatct gcctactatg tgtgacatca aacaaatgtt
    14821 gttctgcatg gaagttgtaa acaagtactt cgaaatctat gacggtggtt gtcttaatgc
    14881 ttctgaagtg gttgttaata atttagacaa gagtgctggc catcctttta ataagtttgg
    14941 caaagctcgt gtctattatg agagcatgtc ttaccaggag caagatgaac tctttgccat
    15001 gacaaagcgt aacgtcattc ctaccatgac tcaaatgaat ctaaaatatg ctattagtgc
    15061 taagaataga gctcgcactg ttgcaggcgt gtccatactt agcacaatga ctaatcgtca
    15121 gtaccatcag aaaatgctta agtccatggc tgcaactcgt ggagcgactt gcgtcattgg
    15181 tactacaaag ttctatggtg gctgggattt catgcttaaa acattgtaca aagatgttga
    15241 taatccgcat cttatgggtt gggattaccc taagtgtgat agagctatgc ctaatatgtg
    15301 tagaatcttt gcttcactca tattagctcg taaacatggc acttgttgta ctacaaggga
    15361 cagattttat cgcttggcaa atgagtgtgc tcaggtgcta agcgaatatg ttctatgtgg
    15421 tggtggttac tacgtcaaac ctggaggtac cagtagcgga gacgccacca ctgcatatgc
    15481 caatagtgtc tttaacattt tgcaggcgac aactgctaat gtcagtgcac ttatgggtgc
    15541 taatggcaac aagattgttg acaaagaagt taaagacatg cagtttgatt tgtatgtcaa
    15601 tgtttacagg agcactagcc cagaccccaa atttgttgat aaatactatg cttttcttaa
    15661 taagcacttt tctatgatga tactgtctga tgacggtgtc gtttgctata atagtgatta
    15721 tgcagctaag ggttacattg ctggaataca gaattttaag gaaacgctgt attatcagaa
    15781 caatgtcttt atgtctgaag ctaaatgctg ggtggaaacc gatctgaaga aagggccaca
    15841 tgaattctgt tcacagcata cgctttatat taaggatggc gacgatggtt acttccttcc
    15901 ttatccagac ccttcaagaa ttttgtctgc cggttgcttt gtagatgata tcgttaagac
    15961 tgacggtaca ctcatggtag agcggtttgt gtctttggct atagatgctt accctctcac
    16021 aaagcatgaa gatatagaat accagaatgt attctgggtc tacttacagt atatagaaaa
    16081 actgtataaa gaccttacag gacacatgct tgacagttat tctgtcatgc tatgtggtga
    16141 taattctgct aagttttggg aagaggcatt ctatagagat ctctatagtt cgcctaccac
    16201 tttgcaggct gtcggttcat gcgttgtatg ccattcacag acttccctac gctgtgggac
    16261 atgcatccgt agaccatttc tctgctgtaa atgctgctat gatcatgtta tagcaactcc
    16321 acataagatg gttttgtctg tttctcctta cgtttgtaat gcccctggtt gtggcgtttc
    16381 agacgttact aagctatatt taggtggtat gagctacttt tgtgtagatc atagacctgt
    16441 gtgtagtttt ccactttgcg ctaatggtct tgtattcggc ttatacaaga atatgtgcac
    16501 aggtagtcct tctatagttg aatttaatag gttggctacc tgtgactgga ctgaaagtgg
    16561 tgattacacc cttgccaata ctacaacaga accactcaaa ctttttgctg ctgagacttt
    16621 acgtgccact gaagaggcgt ctaagcagtc ttatgctatt gccaccatca aagaaattgt
    16681 tggtgagcgc caactattac ttgtgtggga ggctggcaag tccaaaccac cactcaatcg
    16741 taattatgtt tttactggtt atcatataac caaaaatagt aaagtgcagc tcggtgagta
    16801 catcttcgag cgcattgatt atagtgatgc tgtatcctac aagtctagta caacgtataa
    16861 actgactgta ggtgacatct tcgtacttac ctcccactct gtggctacct tgacggcgcc
    16921 cacaattgtg aatcaagaga ggtatgttaa aattactggg ttgtacccaa ccattacggt
    16981 acctgaagag ttcgcaagtc atgttgccaa cttccaaaaa tcaggttata gtaaatatgt
    17041 cactgttcag ggaccacctg gcactggcaa aagtcatttt gctatagggt tagcgattta
    17101 ctaccctaca gcacgtgttg tttatacagc atgttcacac gcagctgttg atgctttgtg
    17161 tgaaaaagct tttaaatatt tgaacattgc taaatgttcc cgtatcattc ctgcaaaggc
    17221 acgtgttgag tgctatgaca ggtttaaagt taatgagaca aattctcaat atttgtttag
    17281 tactattaat gctctaccag aaacttctgc cgatattctg gtggttgatg aggttagtat
    17341 gtgcactaat tatgatcttt caattattaa tgcacgtatt aaagctaagc acattgtcta
    17401 tgtaggagat ccagcacagt tgccagctcc taggactttg ttgactagag gcacattgga
    17461 accagaaaat ttcaatagtg tcactagatt gatgtgtaac ttaggtcctg acatattttt
    17521 aagtatgtgc tacaggtgtc ctaaggaaat agtaagcact gtgagcgctc ttgtctacaa
    17581 taataaattg ttagccaaga aggagctttc aggccagtgc tttaaaatac tctataaggg
    17641 caatgtgacg catgatgcta gctctgccat taatagacca caactcacat ttgtgaagaa
    17701 ttttattact gccaatccgg catggagtaa ggcagtcttt atttcgcctt ataattcaca
    17761 gaatgctgtg gctcgttcaa tgctgggcct tactactcag actgttgatt cctcacaggg
    17821 ttcagaatac cagtacgtta tcttctgtca aacagcagat acggcacatg ctaacaacat
    17881 taacagattt aatgttgcaa tcactcgtgc ccaaaaaggt attctttgtg ttatgacatc
    17941 tcaggcactc tttgagtcct tagagtttac tgaattgtct tttactaatt acaagctcca
    18001 gtctcagatt gtaactggcc tttttaaaga ttgctctaga gaaacttctg gcctctcacc
    18061 tgcttatgca ccaacatacg ttagtgttga tgacaagtat aagacgagtg atgagctttg
    18121 cgtgaatctt aatttacccg caaatgtccc atactctcgt gttatttcca ggatgggctt
    18181 taaactcgat gcaacagttc ctggatatcc taagcttttc attactcgtg aagaggctgt
    18241 aaggcaagtt cgaagctgga taggcttcga tgttgagggt gctcatgctt cccgtaatgc
    18301 atgtggcacc aatgtgcctc tacaattagg attttcaact ggtgtgaact ttgttgttca
    18361 gccagttggt gttgtagaca ctgagtgggg taacatgtta acgggcattg ctgcccgtcc
    18421 tccaccaggt gaacagttta agcacctcgt gcctcttatg cataaggggg ctgcatggcc
    18481 tattgttaga cgacgtatag tgcaaatgtt gtcagacact ttagacaaat tgtctgatta
    18541 ctgtacgttt gtttgttggg ctcatggctt tgaattaacg tctgcatcat acttttgcaa
    18601 gataggtaag gaacagaagt gttgcatgtg caatagacgc gctgcagcgt actcttcacc
    18661 tctgcaatct tatgcctgtt ggactcattc ctgcggttat gattatgtct acaacccttt
    18721 ctttgtcgat gttcaacagt ggggttatgt aggcaatctt gctactaatc acgatcgtta
    18781 ttgctctgtc catcaaggag ctcatgtggc ttctaatgat gcaataatga ctcgttgttt
    18841 agctattcat tcttgtttta tagaacgtgt ggattgggat atagagtatc cttatatctc
    18901 acatgaaaag aaattgaatt cctgttgtag aatcgttgag cgcaacgtcg tacgtgctgc
    18961 tcttcttgcc ggttcatttg acaaagtcta tgatattggc aatcctaaag gaattcctat
    19021 tgttgatgac cctgttgttg attggcatta ttttgatgca cagcccttga ccaggaaggt
    19081 acaacagctt ttctatacag aggacatggc ctcaagattt gctgatgggc tctgcttatt
    19141 ttggaactgt aatgtaccaa aatatcctaa taatgcaatt gtatgcaggt ttgacacacg
    19201 tgtgcattct gagttcaatt tgccaggttg tgatggcggt agtttgtatg ttaacaagca
    19261 cgcttttcat acaccagcat atgatgtgag tgcattccgt gatctgaaac ctttaccatt
    19321 cttttattat tctactacac catgtgaagt gcatggtaat ggtagtatga tagaggatat
    19381 tgattatgta cccctaaaat ctgcagtctg tattacaact tgtaatttag ggggcgctgt
    19441 ttgtaggaag catgctacag agtacagaga gtatatggaa gcatataatc ttgtctctgc
    19501 atcaggtttc cgcctttggt gttataagac ctttgatatt tataatctct ggtctacttt
    19561 tacaaaagtt caaggtttgg aaaacattgc ttttaatgtt gttaaacaag gccattttat
    19621 tggtgttgag ggtgaactac ctgtagctgt agtcaatgat aagatcttca ccaagagtgg
    19681 cgttaatgac atttgtatgt ttgagaataa aaccactttg cctactaata tagcttttga
    19741 actctatgct aagcgtgctg tacgctcgca tcccgatttc aaattgctac acaatttaca
    19801 agcagacatt tgctacaagt tcgtcctttg ggattatgaa cgtagcaata tttatggtac
    19861 tgctactatt ggtgtatgta agtacactga tattgatgtt aattcagctt tgaatatatg
    19921 ttttgacata cgcgataatg gttcattgga gaagttcatg tctactccca atgccatctt
    19981 tatttctgat agaaaaatca agaaataccc ttgtatggta ggtcctgatt atgcttactt
    20041 caatggtgct atcatccgtg atagtgatgt tgttaaacaa ccagtgaagt tctacttgta
    20101 taagaaagtc aataatgagt ttattgatcc tactgagtgt atttacactc agagtcgctc
    20161 ttgtagtgac ttcctacccc tgtctgacat ggagaaagac tttctatctt ttgatagtga
    20221 tgttttcatt aagaagtatg gcttggaaaa ctatgctttt gagcacgtag tctatggaga
    20281 cttctctcat actacgttag gcggtcttca cttgcttatt ggtttataca agaagcaaca
    20341 ggaaggtcat attattatgg aagaaatgct aaaaggtagc tcaactattc ataactattt
    20401 tattactgag actaacacag cggcttttaa ggcggtgtgt tctgttatag atttaaagct
    20461 tgacgacttt gttatgattt taaagagtca agaccttggc gtagtatcca aggttgtcaa
    20521 ggttcctatt gacttaacaa tgattgagtt tatgttatgg tgtaaggatg gacaggttca
    20581 aaccttctac cctcgactcc aggcttctgc agattggaaa cctggtcatg caatgccatc
    20641 cctctttaaa gttcaaaatg taaaccttga acgttgtgag cttgctaatt acaagcaatc
    20701 tattcctatg cctcgcggtg tgcacatgaa catcgctaaa tatatgcaat tgtgccagta
    20761 tttaaatact tgcacattag ccgtgcctgc caatatgcgt gttatacatt ttggcgctgg
    20821 ttctgataaa ggtatcgctc ctggtacatc agttttacga cagtggcttc ctacagatgc
    20881 cattattata gataatgatt taaatgagtt cgtgtcagat gctgacataa ctttatttgg
    20941 agattgtgta actgtacgtg tcggccaaca agtggatctt gttatttccg acatgtatga
    21001 tcctactact aagaatgtaa caggtagtaa tgagtcaaag gctttattct ttacttacct
    21061 gtgtaacctc attaataata atcttgctct tggtggttct gttgctatta aaataacaga
    21121 acactcttgg agcgttgaac tttatgaact tatgggaaaa tttgcttggt ggactgtttt
    21181 ctgcaccaat gcaaatgcat cctcatctga aggattcctt ttaggtatta attacttggg
    21241 tactattaaa gaaaatatag atggtggtgc tatgcacgcc aactatatat tttggagaaa
    21301 ttccactcct atgaatctga gtacttactc actttttgat ttatccaagt ttcaattaaa
    21361 attaaaagga acaccagttc ttcaattaaa ggagagtcaa attaacgaac tcgtaatatc
    21421 tctcctgtcg cagggtaagt tacttatccg tgacaatgat acactcagtg tttctactga
    21481 tgttcttgtt aacacctaca gaaagttacg ttgatgtagg gccagattct gttaagtctg
    21541 cttgtattga ggttgatata caacagacct tctttgataa aacttggcct aggccaattg
    21601 atgtttctaa ggctgacggt attatatacc ctcaaggccg tacatattct aacataacta
    21661 tcacttatca aggtcttttt ccctatcagg gagaccatgg tgatatgtat gtttactctg
    21721 caggacatgc tacaggcaca actccacaaa agttgtttgt agctaactat tctcaggacg
    21781 tcaaacagtt tgctaatggg tttgtcgtcc gtataggagc agctgccaat tccactggca
    21841 ctgttattat tagcccatct accagcgcta ctatacgaaa aatttaccct gcttttatgc
    21901 tgggttcttc agttggtaat ttctcagatg gtaaaatggg ccgcttcttc aatcatactc
    21961 tagttctttt gcccgatgga tgtggcactt tacttagagc tttttattgt attctagagc
    22021 ctcgctctgg aaatcattgt cctgctggca attcctatac ttcttttgcc acttatcaca
    22081 ctcctgcaac agattgttct gatggcaatt acaatcgtaa tgccagtctg aactctttta
    22141 aggagtattt taatttacgt aactgcacct ttatgtacac ttataacatt accgaagatg
    22201 agattttaga gtggtttggc attacacaaa ctgctcaagg tgttcacctc ttctcatctc
    22261 ggtatgttga tttgtacggc ggcaatatgt ttcaatttgc caccttgcct gtttatgata
    22321 ctattaagta ttattctatc attcctcaca gtattcgttc tatccaaagt gatagaaaag
    22381 cttgggctgc cttctacgta tataaacttc aaccgttaac tttcctgttg gatttttctg
    22441 ttgatggtta tatacgcaga gctatagact gtggttttaa tgatttgtca caactccact
    22501 gctcatatga atccttcgat gttgaatctg gagtttattc agtttcgtct ttcgaagcaa
    22561 aaccttctgg ctcagttgtg gaacaggctg aaggtgttga atgtgatttt tcacctcttc
    22621 tgtctggcac acctcctcag gtttataatt tcaagcgttt ggtttttacc aattgcaatt
    22681 ataatcttac caaattgctt tcactttttt ctgtgaatga ttttacttgt agtcaaatat
    22741 ctccagcagc aattgctagc aactgttatt cttcactgat tttggattat ttttcatacc
    22801 cacttagtat gaaatccgat ctcagtgtta gttctgctgg tccaatatcc cagtttaatt
    22861 ataaacagtc cttttctaat cccacatgtt tgatcttagc gactgttcct cataacctta
    22921 ctactattac taagcctctt aagtacagct atattaacaa gtgctctcgt cttctttctg
    22981 atgatcgtac tgaagtacct cagttagtga acgctaatca atactcaccc tgtgtatcca
    23041 ttgtcccatc cactgtgtgg gaagacggtg attattatag gaaacaacta tctccacttg
    23101 aaggtggtgg ctggcttgtt gctagtggct caactgttgc catgactgag caattacaga
    23161 tgggctttgg tattacagtt caatatggta cagacaccaa tagtgtttgc cccaagcttg
    23221 aatttgctaa tgacacaaaa attgcctctc aattaggcaa ttgcgtggaa tattccctct
    23281 atggtgtttc gggccgtggt gtttttcaga attgcacagc tgtaggtgtt cgacagcagc
    23341 gctttgttta tgatgcgtac cagaatttag ttggctatta ttctgatgat ggcaactact
    23401 actgtctgcg tgcttgtgtt agtgttcctg tttctgtcat ctatgataaa gaaactaaaa
    23461 cccacgctac tctatttggt agtgttgcat gtgaacacat ttcttctacc atgtctcaat
    23521 actcccgttc tacgcgatca atgcttaaac ggcgagattc tacatatggc ccccttcaga
    23581 cacctgttgg ttgtgtccta ggacttgtta attcctcttt gttcgtagag gactgcaagt
    23641 tgcctctcgg tcaatctctc tgtgctcttc ctgacacacc tagtactctc acacctcgca
    23701 gtgtgcgctc tgtgccaggt gaaatgcgct tggcatccat tgcttttaat catcccattc
    23761 aggttgatca acttaatagt agttatttta aattaagtat acccactaat ttttcctttg
    23821 gtgtgactca ggagtacatt cagacaacca ttcagaaagt tactgttgat tgtaaacagt
    23881 acgtttgcaa tggtttccag aagtgtgagc aattactgcg cgagtatggc cagttttgtt
    23941 ccaaaataaa ccaggctctc catggtgcca atttacgcca ggatgattct gtacgtaatt
    24001 tgtttgcgag cgtgaaaagc tctcaatcat ctcctatcat accaggtttt ggaggtgact
    24061 ttaatttgac acttctagaa cctgtttcta tatctactgg cagtcgtagt gcacgtagtg
    24121 ctattgagga tttgctattt gacaaagtca ctatagctga tcctggttat atgcaaggtt
    24181 acgatgattg tatgcagcaa ggtccagcat cagctcgtga tcttatttgt gctcaatatg
    24241 tggctggtta taaagtatta cctcctctta tggatgttaa tatggaagcc gcgtatactt
    24301 catctttgct tggcagcata gcaggtgttg gctggactgc tggcttatcc tcctttgctg
    24361 ctattccatt tgcacagagt attttttata ggttaaacgg tgttggcatt actcaacagg
    24421 ttctttcaga gaaccaaaag cttattgcca ataagtttaa tcaggctctg ggagctatgc
    24481 aaacaggctt cactacaact aatgaagctt ttcggaaggt tcaggatgct gtgaacaaca
    24541 atgcacaggc tctatccaaa ttagctagcg agctatctaa tacttttggt gctatttccg
    24601 cctctattgg agacatcata caacgtcttg atgttctcga acaggacgcc caaatagaca
    24661 gacttattaa tggccgtttg acaacactaa atgcttttgt tgcacagcag cttgttcgtt
    24721 ccgaatcagc tgctctttcc gctcaattgg ctaaagataa agtcaatgag tgtgtcaagg
    24781 cacaatccaa gcgttctgga ttttgcggtc aaggcacaca tatagtgtcc tttgttgtaa
    24841 atgcccctaa tggcctttac tttatgcatg ttggttatta ccctagcaac cacattgagg
    24901 ttgtttctgc ttatggtctt tgcgatgcag ctaaccctac taattgtata gcccctgtta
    24961 atggctactt tattaaaact aataacacta ggattgttga tgagtggtca tatactggct
    25021 cgtccttcta tgcacctgag cccatcacct ctcttaatac taagtatgtt gcaccacagg
    25081 tgacatacca aaacatttct actaacctcc ctcctcctct tctcagcaat tccaccggga
    25141 ttgacttcca agatgagttg gatgagtttt tcaaaaatgt tagcaccagt atacctaatt
    25201 ttggttctct aacacagatt aatactacat tactcgatct tacctacgag atgttgtctc
    25261 ttcaacaagt tgttaaagcc cttaatgagt cttatataga ccttaaagag cttggcaatt
    25321 atacttatta caacaaatgg ccgtggtaca tttggcttgg tttcattgct gggcttgttg
    25381 ccttagctct atgcgtcttc ttcatactgt gctgcactgg ttgtggcaca aactgtatgg
    25441 gaaaacttaa gtgtaatcgt tgttgtgata gatacgagga atacgacctc gagccgcata
    25501 aggttcatgt tcactaatta acgaactatc aatgagagtt caaagaccac ccactctctt
    25561 gttagtgttc tcactctctc ttttggtcac tgcattttca aaacctctct atgtacctga
    25621 gcattgtcag aattattctg gttgcatgct tagggcttgt attaaaactg cccaagctga
    25681 tacagctggt ctttatacaa attttcgaat tgacgtccca tctgcagaat caactggtac
    25741 tcaatcagtt tctgtcgatc gtgagtcaac ttcaactcat gatggtccta ccgaacatgt
    25801 tactagtgtg aatctttttg acgttggtta ctcagttaat taacgaactc tatggattac
    25861 gtgtctctgc ttaatcaaat ttggcagaag taccttaatt caccgtatac tacttgtttg
    25921 tatatcccta aacccacagc taagtataca cctttagttg gcacttcatt gcaccctgtg
    25981 ctgtggaact gtcagctatc ctttgctggt tatactgaat ctgctgttaa ttctacaaaa
    26041 gctttggcca aacaggacgc agctcagcga atcgcttggt tgctacataa ggatggagga
    26101 atccctgatg gatgttccct ctacctccgg cactcaagtt tattcgcgca aagcgaggaa
    26161 gaggagtcat tctccaacta agaaactgcg ctacgttaag cgtagatttt ctcttctgcg
    26221 ccctgaagac cttagtgtta ttgtccaacc aacacactat gtcagggtta cattttcaga
    26281 ccccaacatg tggtatctac gttcgggtca tcatttacac tcagttcaca attggcttaa
    26341 accttatggc ggccaacctg tttctgagta ccatattact ctagctttgc taaatctcac
    26401 tgatgaagat ttagctagag atttttcacc cattgcgctc tttttgcgca atgtcagatt
    26461 tgagctacat gagttcgcct tgctgcgcaa aactcttgtt cttaatgcat cagagatcta
    26521 ctgtgctaac atacatagat ttaagcctgt gtatagagtt aacacggcaa tccctactat
    26581 taaggattgg cttctcgttc agggattttc cctttaccat agtggcctcc ctttacatat
    26641 gtcaatctct aaattgcatg cactggatga tgttactcgc aattacatca ttacaatgcc
    26701 atgctttaga acttatcctc aacaaatgtt tgttactcct ttggccgtag atgttgtctc
    26761 catacggtct tccaatcagg gtaataaaca aattgttcat tcttacccca ttttacatca
    26821 tccaggattt taacgaacta tggctttctc ggcgtcttta tttaaacccg tccagctagt
    26881 cccagtttct cctgcatttc atcgcattga gtctactgac tctattgttt tcacatacat
    26941 tcctgctagc ggctatgtag ctgctttagc tgtcaatgtg tgtctcattc ccctattatt
    27001 actgctacgt caagatactt gtcgtcgcag cattatcaga actatggttc tctatttcct
    27061 tgttctgtat aactttttat tagccattgt actagtcaat ggtgtacatt atccaactgg
    27121 aagttgcctg atagccttct tagttatcct cataatactt tggtttgtag atagaattcg
    27181 tttctgtctc atgctgaatt cctacattcc actgtttgac atgcgttctc actttattcg
    27241 tgttagtaca gtttcttctc atggtatggt ccctgtcata cacaccaaac cattatttat
    27301 tagaaacttc gatcagcgtt gcagctgttc tcgttgtttt tatttgcact cttccactta
    27361 tatagagtgc acttatatta gccgttttag taagattagc ctagtttctg taactgactt
    27421 ctccttaaac ggcaatgttt ccactgtttt cgtgcctgca acgcgcgatt cagttcctct
    27481 tcacataatc gccccgagct cgcttatcgt ttaagcagct ctgcgctact atgggtcccg
    27541 tgtagaggct aatccattag tctctctttg gacatatgga aaacgaacta tgttaccctt
    27601 tgtccaagaa cgaatagggt tgttcatagt aaactttttc atttttaccg tagtatgtgc
    27661 tataacactc ttggtgtgta tggctttcct tacggctact agattatgtg tgcaatgtat
    27721 gacaggcttc aataccctgt tagttcagcc cgcattatac ttgtataata ctggacgttc
    27781 agtctatgta aaattccagg atagtaaacc ccctctacca cctgacgagt gggtttaacg
    27841 aactccttca taatgtctaa tatgacgcaa ctcactgagg cgcagattat tgccattatt
    27901 aaagactgga actttgcatg gtccctgatc tttctcttaa ttactatcgt actacagtat
    27961 ggatacccat cccgtagtat gactgtctat gtctttaaaa tgtttgtttt atggctccta
    28021 tggccatctt ccatggcgct atcaatattt agcgccattt atccaattga tctagcttcc
    28081 cagataatct ctggcattgt agcagctgtt tcagctatga tgtggatttc ctactttgtg
    28141 cagagtatcc ggctgtttat gagaactgga tcatggtggt cattcaatcc tgagactaat
    28201 tgccttttga acgttccatt tggtggtaca actgtcgtac gtccactcgt agaggactct
    28261 accagtgtaa ctgctgttgt aaccaatggc cacctcaaaa tggctggcat gcatttcggt
    28321 gcttgtgact acgacagact tcctaatgaa gtcaccgtgg ccaaacccaa tgtgctgatt
    28381 gctttaaaaa tggtgaagcg gcaaagctac ggaactaatt ccggcgttgc catttaccat
    28441 agatataagg caggtaatta caggagtccg cctattacgg cggatattga acttgcattg
    28501 cttcgagctt aggctcttta gtaagagtat cttaattgat tttaacgaat ctcaatttca
    28561 ttgttatggc atcccctgct gcacctcgtg ctgtttcctt tgccgataac aatgatataa
    28621 caaatacaaa cctgtctcga ggtagaggac gtaatccaaa accacgagct gcaccaaata
    28681 acactgtctc ttggtacact gggcttaccc aacacgggaa agtccctctt acctttccac
    28741 ctgggcaggg tgtacctctt aatgccaatt ccaccccagc gcaaaatgct gggtattggc
    28801 ggagacagga cagaaaaatt aataccggga atggaattaa gcaactggct cccaggtggt
    28861 acttctacta cactggaacc ggacccgaag cagcactccc attccgggct gttaaggatg
    28921 gcatcgtttg ggtccatgaa catggcgcca ctgatgctcc ttcaactttt gggacgcgga
    28981 accctaacaa tgattcagct attgttacac aattcgcgcc cggtactaag cttcctaaaa
    29041 acttccacat tgaggggact ggaggcaata gtcaatcatc ttcaagagcc tctagcgtaa
    29101 gcagaaactc ttccagatct agttcacaag gttcaagatc aggaaactct acccgcggca
    29161 cttctccagg tccatctgga atcggagcag taggaggtga tctactttac cttgatcttc
    29221 tgaacagact acaagccctt gagtctggca aagtaaagca atcgcagcca aaagtaatca
    29281 ctaagaaaga tgctgctgct gctaaaaata agatgcgcca caagcgcact tccaccaaaa
    29341 gtttcaacat ggtgcaagct tttggtcttc gcggaccagg agacctccag ggaaactttg
    29401 gtgatcttca attgaataaa ctcggcactg aggacccacg ttggccccaa attgctgagc
    29461 ttgctcctac agccagtgct tttatgggta tgtcgcaatt taaacttacc catcagaaca
    29521 atgatgatca tggcaaccct gtgtacttcc ttcggtacag tggagccatt aaacttgacc
    29581 caaagaatcc caactacaat aagtggttgg agcttcttga gcaaaatatt gatgcctaca
    29641 aaaccttccc taagaaggaa aagaaacaaa aggcaccaaa agaagaatca acagaccaaa
    29701 tgtctgaacc tcctaaggag cagcgtgtgc aaggtagcat cactcagcgc actcgcaccc
    29761 gtccaagtgt tcagcctggt ccaatgattg atgttaacac tgattagtgt cactcaaagt
    29821 aacaagatcg cggcaatcgt ttgtgtttgg taaccccatc tcaccatcgc ttgtccactc
    29881 ttgcacagaa tggaatcatg ttgtaattac agtgcaataa ggtaattata acccatttaa
    29941 ttgatagcta tgctttatta aagtgtgtag ctgtagagag aatgttaaag actgtcacct
    30001 ctgcctgatt gcaagtgaac agtgcccccc gggaagagct ctacagtgtg aaatgtaaat
    30061 aaaaatagct attattcaat tagattaggc taattagatg atttgcaaaa aaaaaaaa

Share this post


Link to post
Share on other sites
LOCUS       KT368851               30119 bp    RNA     linear   VRL 17-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate
            camel/Jeddah/O30/2014, complete genome.
ACCESSION   KT368851
VERSION     KT368851.1  GI:922058148
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 30119)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Co-circulation of three camel coronavirus species and recombination
            of MERS-CoVs in Saudi Arabia
  JOURNAL   Science (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 30119)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2015) Centre of Influenza Research & State Key
            Laboratory of Emerging Infectious Diseases, The University of Hong
            Kong, Laboratory Block, 21 Sassoon Road, Pokfulam, Hong Kong SAR,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..30119
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="camel/Jeddah/O30/2014"
                     /host="camel"
                     /db_xref="taxon:1335626"
                     /country="Saudi Arabia"
                     /collection_date="Oct-2014"
     gene            279..21514
                     /gene="orf1ab"
     CDS             join(279..13433,13433..21514)
                     /gene="orf1ab"
                     /ribosomal_slippage
                     /codon_start=1
                     /product="polyprotein ORF1ab"
                     /protein_id="ALA49637.1"
                     /db_xref="GI:922058150"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLALAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINRDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
                     RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
                     RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
                     RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
                     KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
                     DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
                     VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
                     RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
                     VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
                     EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
                     MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
                     GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
                     LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
                     NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
                     AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
                     LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
                     YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
                     SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
                     FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
                     PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
                     ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
                     RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
                     RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
                     NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
                     PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
                     KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
                     SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
                     TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYS
                     RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
                     FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
                     MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
                     WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
                     CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
                     DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
                     VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
                     DIDYVPLKSAVCITTCNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
                     WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
                     TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
                     VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDV
                     VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
                     ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
                     AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
                     RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
                     TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
                     DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
                     TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
                     FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
                     LSVSTDVLVNTYRKLR"
     gene            279..13454
                     /gene="orf1a"
     CDS             279..13454
                     /gene="orf1a"
                     /codon_start=1
                     /product="polyprotein ORF1a"
                     /protein_id="ALA49636.1"
                     /db_xref="GI:922058149"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLALAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINRDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
     gene            21456..25517
                     /gene="S"
     CDS             21456..25517
                     /gene="S"
                     /codon_start=1
                     /product="spike protein"
                     /protein_id="ALA49638.1"
                     /db_xref="GI:922058151"
                     /translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
                     PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
                     ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
                     MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
                     YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
                     NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
                     RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
                     PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
                     SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
                     DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
                     LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
                     VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
                     SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
                     TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
                     IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
                     QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
                     QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
                     AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
                     QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
                     SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
                     IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
                     VAPQVTYQNISTNLPPPLLSNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
                     TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
                     TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
     gene            25532..25843
                     /gene="orf3"
     CDS             25532..25843
                     /gene="orf3"
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="ALA49639.1"
                     /db_xref="GI:922058152"
                     /translation="MRVQRPPTLLLVFSLSLLVTAFSKPLYVPEHCQNYSGCMLRACI
                     KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGPTEHVTSVNLFDVGYSV
                     N"
     gene            25852..26181
                     /gene="orf4a"
     CDS             25852..26181
                     /gene="orf4a"
                     /codon_start=1
                     /product="ORF4a"
                     /protein_id="ALA49640.1"
                     /db_xref="GI:922058153"
                     /translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
                     WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
                     EEESFSN"
     gene            26093..26833
                     /gene="orf4b"
     CDS             26093..26833
                     /gene="orf4b"
                     /codon_start=1
                     /product="ORF4b"
                     /protein_id="ALA49641.1"
                     /db_xref="GI:922058154"
                     /translation="MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
                     EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
                     TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
                     PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
                     VDVVSIRSSNQGNKQIVHSYPILHHPGF"
     gene            26840..27514
                     /gene="orf5"
     CDS             26840..27514
                     /gene="orf5"
                     /codon_start=1
                     /product="ORF5"
                     /protein_id="ALA49642.1"
                     /db_xref="GI:922058155"
                     /translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
                     VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
                     ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
                     CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
                     PSSLIV"
     gene            27590..27838
                     /gene="E"
     CDS             27590..27838
                     /gene="E"
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ALA49643.1"
                     /db_xref="GI:922058156"
                     /translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
                     TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
     gene            27853..28512
                     /gene="M"
     CDS             27853..28512
                     /gene="M"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="ALA49644.1"
                     /db_xref="GI:922058157"
                     /translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
                     VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
                     MRTGSWWSFNPETNCLLNVPFGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
                     DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
                     A"
     gene            28566..29807
                     /gene="N"
     CDS             28566..29807
                     /gene="N"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="ALA49645.1"
                     /db_xref="GI:922058158"
                     /translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
                     TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
                     TGTGPEAALPFRAVKDGIVWVHEHGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
                     HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
                     LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
                     NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
                     IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
                     TQRTRTRPSVQPGPMIDVNTD"
     gene            28762..29100
                     /gene="orf8b"
     CDS             28762..29100
                     /gene="orf8b"
                     /codon_start=1
                     /product="ORF8b"
                     /protein_id="ALA49646.1"
                     /db_xref="GI:922058159"
                     /translation="MPIPPQRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLEPDPKQ
                     HSHSGLLRMASFGSMNMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
                     IVNHLQEPLA"
ORIGIN      
        1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
       61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
      121 gtggcactaa tttgcctgct catctaggca gtggacatat gctcaacact gggtataatt
      181 ctaattgaat actatttttc agttagagcg tcgtgtctct tgtacgtctc ggtcacaata
      241 cacggtttcg tccggtgcgt ggcaattcgg ggcacatcat gtctttcgtg gctggtgtga
      301 tcgcgcaagg tgcgcgcggt acgtatcgag cagcgctcaa ctctgaaaaa catcaagacc
      361 atgtgtctct aactgtgcca ctctgtggtt caggaaacct ggttgaaaaa ctttcaccat
      421 ggttcatgga tggcgaaaat gcctatgaag tggtgaaggc catgttactt aaaaaagagc
      481 cacttctcta tgtgcccatc cggctggctg gacacactag acacctccca ggtcctcgtg
      541 tgtacctggt tgagaggctc attgcttgtg aaaatccatt catggttaac caattggctt
      601 atagctctag tgcaaatggc agcctggttg gcacaacttt gcagggcaag cctattggta
      661 tgttcttccc ttatgacatc gaacttgtca caggaaagca aaatattctc ctgcgcaagt
      721 atggccgtgg tggttatcac tacaccccat tccactatga gcgagacaac acctcttgcc
      781 ctgagtggat ggacgatttt gaggcggatc ctaaaggcaa atatgcccag aatctgctta
      841 agaagttgat tggcggtgat gtcactccag ttgaccaata catgtgtggc gttgatggaa
      901 aacccattag tgcctacgca tttttaatgg ccaaggatgg aataaccaaa ctggctgatg
      961 ttgaagcgga cgtcgcagca cgtgctgatg acgaaggctt catcacatta aagaacaatc
     1021 tatatagatt ggtttggcat gttgagcgta aagacgttcc atatcctaag caatctattt
     1081 ttactattaa tagtgtggtc caaaaggatg gtgttgaaaa cactcctcct cactatttta
     1141 ctcttggatg caaaatttta acgctcaccc cacgcaacaa gtggagtggc gtttctgact
     1201 tgtccctcaa acaaaaactc ctttacacct tctatggtaa ggagtcactt gagaacccaa
     1261 cctacattta ccactccgca ttcattgagt gtggaagttg tggtaatgat tcctggctta
     1321 cagggaatgc tatccaaggg tttgcctgtg gatgtggggc atcatataca gctaatgatg
     1381 tcgaagtcca atcatctggc atgattaagc caaatgctct tctttgtgct acttgcccct
     1441 ttgctaaggg tgacagctgt tcttctaatt gcaaacattc agttgctcag ttggttagtt
     1501 acctttctga acgctgtaat gttattgctg attctaagtc cttcacactt atctttggtg
     1561 gcgtagctta cgcctacttt ggatgtgagg aaggtactat gtactttgtg cctagagcta
     1621 agtctgttgt ctcaaggatt ggagactcca tctttacagg ctgtactggc tcttggaaca
     1681 aggtcactca aattgctaac atgttcttgg aacagactca gcattccctt aactttgtgg
     1741 gagagttcgt tgtcaacgat gttgtcctcg caattctctc tggaaccaca actaatgttg
     1801 acaaaatacg ccagcttctc aaaggtgtca ccattgacaa gttgcgtgat tatttagctg
     1861 actatgacgt agcagtcact gccggcccat tcatggataa tgctattaat gttggtggta
     1921 caggattaca gtatgccgcc attactgcac cttatgtagt tctcactggc ttaggtgagt
     1981 cctttaagaa agttgcaacc ataccgtaca aggtttgcaa ctctgttaag gatactctga
     2041 cttattatgc tcacagcgtg ttgtacagag tttttcctta tgacatggat tctggtgtgt
     2101 catcctttag tgaactactt tttgattgcg ttgatctttc agtagcttct acctattttt
     2161 tagtccgcct cttgcaagat aagactggcg actttatgtc tacaattatt acttcctgcc
     2221 aaactgctgt tagtaagctt ctagatacat gttttgaagc tacagaagca acatttaact
     2281 tcttgttaga tttggcagga ttgttcagaa tctttcttcg caatgcctat gtgtacactt
     2341 cacaagggtt tgtggtggtc aatggcaaag tttctacact tgtcaaacaa gtgttagact
     2401 tgcttaataa gggtatgcaa cttttgcata caaaggtctc ctgggctggt tctaatatca
     2461 gtgctgttat ctacagcggc agggagtctc taatattccc atcgggaacc tattactgtg
     2521 tcaccactaa ggctaagtcc gttcaacaag atcttgacgt tattttgcct ggtgagtttt
     2581 ccaagaagca gttaggactg ctccaaccta ctgacaattc tacaactgtt agtgttactg
     2641 tatccagtaa catggttgaa actgttgtgg gtcaacttga gcaaactaat atgcatagtc
     2701 ctgatgttat agtaggtgac tatgtcatta ttagtgaaaa attgtttgtg cgtagtaagg
     2761 aagaagacgg atttgccttc taccctgctt gcactaatgg tcatgctgta ccgactctct
     2821 ttagacttaa gggaggtgca cctgtaaaaa aagtagcctt tggcggtgat caagtacatg
     2881 aggttgctgc tgtaagaagt gttactgtcg agtacaacat tcatgctgta ttagacacac
     2941 tacttgcttc ttctagtctt agaacctttg ttgtagataa gtctttgtca attgaggagt
     3001 ttgctgacgt agtaaaggaa caagtctcag acttgcttgt taaattactg cgtggaatgc
     3061 cgattccaga ttttgattta gacgatttta ttgacgcacc atgctattgc tttaacgctg
     3121 agggtgatgc atcttggtct tctactatga tcttctctct tcaccccgtc gagtgtgacg
     3181 aggagtgttc tgaagtagag gcttcagatt tagaagaagg tgaatcagag tgcatttctg
     3241 agacttcaac tgaacaagtt gacgtttctc atgaggtttc tgacgacgag tgggctgctg
     3301 cagttgatga agcgttcccc ctcgatgaag cagaagatgt tactgaatct gtgcaagaag
     3361 aagcacaacc agtagaagta cctgttgaag atattgcgca ggttgtcata gctgacacct
     3421 tacaggaaac tcctgttgtg tttgatactg ttgaagtccc accgcaagtg gtgaaacttc
     3481 cgtctgaacc tcagactatc cagcccgagg taaaagaagt tgcacctgtc tatgaggctg
     3541 ataccgaaca gacacagagt gttactgtta aacctaagag gttacgcaaa aagcgtaatg
     3601 ttgacccttt gtccaatttt gaacataagg ttattacaga gtgcgttacc atagttttag
     3661 gtgacgcaat tcaagtagcc aagtgctatg gggagtctgt gttagttaat gctgctaaca
     3721 cacatcttaa gcatggcggt ggtatcgctg gtgctattaa tgcggcttca aaaggggctg
     3781 tccaaaaaga gtcagatgag tatattctgg ctaaagggcc gttacaagta ggagattcag
     3841 ttctcttgca aggccattct ctagctaaga atatcctgca tgtcgtaggc ccagatgccc
     3901 gcgctaaaca ggatgtttct ctccttagta agtgctataa ggctatgaat gcatatcctc
     3961 ttgtagtcac tcctcttgtt tcagcaggca tatttggtgt aaaaccagct gtgtcttttg
     4021 attatcttat tagagaggct aagactagag ttttagtcgt cgttaattcc caagatgtct
     4081 ataagagtct taccatagtt gacattccac agagtttgac tttttcatat gatgggttac
     4141 gtggcgcaat acgtaaagct aaagattatg gttttactgt ttttgtgtgc acagacaact
     4201 ctgctaacac taaagttctt aggaacaagg gtgttgatta tactaagaag tttcttacag
     4261 ttgacggtgt gcaatattat tgctacacgt ctaaggacac tttagatgat atcttacaac
     4321 aggctaataa gtctgttggt attatatcta tgcctttggg atatgtgtct catggtttag
     4381 acttaattca agcagggagt gtcgtgcgta gagttaacgt gccctacgtg tgtctcctag
     4441 ctaataaaga gcaagaagct attttgatgt ctgaagacgt taagttaaac ccttcagaag
     4501 attttataaa gcacgtccgc actaatggtg gttacaattc ttggcattta gtcgagggtg
     4561 aactattggt gcaagactta cgcttaaata agctcctgca ttggtctgat caaaccatat
     4621 gctacaagga tagtgtgttt tatgttgtaa agaatagtac agcttttcca tttgaaacac
     4681 tttcagcatg tcgtgcgtat ttggattcac gcacgacaca gcagttaaca atcgaagtct
     4741 tagtgactgt cgatggtgta aattttagaa cagtcgttct aaataataag aacacttata
     4801 gatcacagct tggatgcgtt ttctttaatg gtgctgatat ttctgatacc attcctgatg
     4861 agaaacagaa tggtcacagt ttatatctag cagacaattt gactgctgat gaaacaaagg
     4921 cgcttaaaga gttatatggc cccgttgatc ctactttctt acacagattc tattcactta
     4981 aggcagcagt ccatgggtgg aagatggttg tgtgtgataa ggtacgttct ctcaaattga
     5041 gtgataataa ttgttatctt aatgcagtta ttatgacact tgatttattg aaggacatta
     5101 aatttgttat acctgctcta cagcatgcat ttatgaaaca taagggcggt gattcaactg
     5161 acttcatagc cctcattatg gcttatggca attgcacatt tggtgctcca gatgatgcct
     5221 ctcggttact tcacaccgtg cttgcaaagg ctgagttatg ctgttctgca cgcatggttt
     5281 ggagagagtg gtgcaatgtc tgtggcataa aagatgttgt tctacaaggc ttaagagctt
     5341 gttgttacgt gggtgtgcaa actgttgaag atctgcgtgc tcgcatgaca tatgtatgcc
     5401 agtgtggtgg tgaacgtcat cggcaaatag tcgaacacac cactccctgg ttgctgctct
     5461 caggcacacc aaatgaaaaa ttggtgacaa ccttcacggc gcctgatttt gtagcgttta
     5521 atgtctttca gggcattgaa acggctgttg gccattatgt tcatgctcgc ctgaagggtg
     5581 gtcttatttt aaagtttgac tctggcaccg ttagcaagac ttcagactgg aagtgcaagg
     5641 tgacagatgt acttttcccc ggccaaaaat acagtagcga ttgtaatgtc gtacggtatt
     5701 ctttggacgg taatttcaga acagaggttg atcccgacct atctgctttc tatgttaagg
     5761 atggtaaata ctttacaagt gaaccacccg taacatattc accagctaca attttagctg
     5821 gtagtgtcta cactaatagc tgccttgtat cgtctgatgg acaacctggc ggtgatgcta
     5881 ttagtttgag ttttaataac cttttagggt ttgattctag taaaccagtc actaagaaat
     5941 acacttactc cttcttgcct aaagaagacg gcgatgtgtt gttggctgag tttgacactt
     6001 atgaccctat ttataagaat ggtgccatgt ataaaggcaa accaattctt tgggtcaaca
     6061 aagcatctta tgatattaat cttaataagt tcaatagagc tagtttgcgt caaatttttg
     6121 acgtagcccc cattgaactc gaaaataaat tcacaccttt gagtgtggcg tctacaccag
     6181 ttgaacctcc aactgtagat gtggtagcac ttcaacagga aatgacaatt gtcaaatgta
     6241 agggtttaaa taaacctttc gtgaaggaca atgtcagttt cgttgttgat gactcaggta
     6301 ctcccgttgt tgagtatctg tctaaagaag atctacatac attgtatgta gaccctaagt
     6361 atcaagtcat tgtcttaaaa gacaatgtac tttcttctat gcttagattg cacaccgttg
     6421 agtcaggtga tattaacgtt gttgcagctt ccggatcttt gacacgtaaa gtgaagttac
     6481 tatttagggc ttcattttat ttcaaagaat ttgctacccg cactttcact gctaccactg
     6541 ctgtaggtag ttgtataaag agtgtagtgc ggcatctagg tgttactaaa ggcatattga
     6601 caggctgttt tagttttgtc aagatgttat ttatgcttcc actagcttac tttagtgatt
     6661 caaaactcgg caccacagag gttaaagtga gtgctttgaa aacagctggc gttgtgacag
     6721 gtaatgttgt aaaacagtgt tgcactgctg ctgttgattt aagtatggat aagttgcgcc
     6781 gtgtggattg gaaatcaacc ctacggttgt tacttatgtt atgcacaact atggtattgt
     6841 tgtcttctgt gtatcacttg tatgtcttca atcaggtctt atcaagtgat gttatgtttg
     6901 aagatgccca aggtttgaaa aagttctaca aagaagttag agcttaccta ggaatctctt
     6961 ctgcttgtga cggtcttgct ttagcttata gggcgaattc atttgatgta cctacattct
     7021 gcgcaaaccg ttctgcaatg tgtaattggt gcttgattag ccaagattcc ataactcact
     7081 acccagctct taagatggtt caaacacatc ttagccacta tgttcttaac atagattggt
     7141 tgtggtttgc atttgagact ggtttggcat acatgctcta tacctcggcc ttcaactggt
     7201 tgttgttggc aggtacattg cattatttct ttgcacaaac ttccatattt gtagactggc
     7261 ggtcatacaa ttatgctgtg tctagtgcct tctggttatt cacccacatt ccaatggcgg
     7321 gtttggtacg aatgtataat ttgttagcat gcctttggct tttacgcaag ttttatcagc
     7381 atgtaatcaa tggttgcaaa gatacggcat gcttgctctg ctataagagg aaccgactta
     7441 ctagagttga agcttctacc gttgtctgtg gtggaaaacg tacgttttat atcacagcaa
     7501 atggcggtat ttcattctgt cgtaggcata attggaattg tgtggattgt gacattgcag
     7561 gtgtggggaa taccttcatc tgtgaagaag tcgcaaatga cctcactacc gccctacgca
     7621 ggcctattaa cgctacggat agatcacatt attatgtgga ttccgttaca gttaaagaga
     7681 ctgttgttca gtttaattat cgtagagacg gtcaaccatt ctacgagcgg tttcccctct
     7741 gcgcttttac aaatctagat aagttgaagt tcaaagaggt ctgtaaaact actactggta
     7801 tacctgaata caactttatc atctacgact catcagatcg tggccaggaa agtttagcta
     7861 ggtctgcatg tgtttattat tctcaagtct tgtgtaaatc aattcttttg gttgactcaa
     7921 gtttggttac ttctgttggt gattctagtg aaatcgccac taaaatgttt gattcctttg
     7981 ttaatagttt cgtctcgctg tataatgtca cacgcgataa gttggaaaaa cttatctcta
     8041 ctgctcgtga tggcgtaagg cgaggcgata acttccatag tgtcttaaca acattcattg
     8101 acgcagcacg aggccccgca ggtgtggagt ctgatgttga gaccaatgaa attgttgact
     8161 ctgtgcagta tgctcataaa catgacatac aaattactaa tgagagttac aataattatg
     8221 taccctcata tgttaaacct gatagtgtgt ctaccagtga tttaggtagt ctcattgatt
     8281 gtaatgcggc ttcagttaac caaattgtct tgcgtaattc taatggtgct tgtatttgga
     8341 acgctgctgc atatatgaaa ctctcggatg cacttaaacg acagattcgc attgcatgcc
     8401 gtaagtgtaa tttagctttc cggttaacca cctcaaagct acgcgctaat gataatatct
     8461 tatcagttag attcactgct aacaaaattg ttggtggtgc tcctacatgg tttaatgtgt
     8521 tgcgtgactt tacgttaaag ggttacgttc ttgctaccat tattgtgttt ctgtgtgctg
     8581 tactgatgta tttgtgttta cctacatttt ctatggtacc tgttgaattt tatgaagacc
     8641 gcatcttgga ctttaaagtt cttgataatg gtatcattag ggatgtaaat cctgatgata
     8701 agtgctttgc taataagcac cggtccttca cacaatggta tcatgagcat gttggtggtg
     8761 tctatgacaa ctctatcaca tgcccattga cagttgcagt aattgctgga gttgctggtg
     8821 ctcgcattcc agacgtacct actacattgg cttgggtgaa caatcagata attttctttg
     8881 tttctcgagt ctttgctaat acaggcagtg tttgctacac tcctatagat gagataccct
     8941 ataagagttt ctctgatagt ggttgcattc ttccatctga gtgcactatg tttagggatg
     9001 cagagggccg tatgacacca tactgccatg atcctactgt tttgcctggg gcttttgcgt
     9061 acagtcagat gaggcctcat gttcgttacg acttgtatga tggtaacatg tttattaaat
     9121 ttcctgaagt agtatttgaa agtacactta ggattactag aactctgtca actcagtact
     9181 gccggttcgg tagttgtgag tatgcacaag agggtgtttg tattaccaca aatggctcgt
     9241 gggccatttt taatgaccac catcttaata gacctggtgt ctattgtggt tctgatttta
     9301 ttgacattgt caggcggtta gcagtatcac tgttccagcc tattacttat ttccaattga
     9361 ctacctcatt ggtcttgggt ataggtttgt gtgcattcct gactttgctc ttttattata
     9421 ttaataaagt aaaacgtgct tttgcagatt acacccagtg tgctgtaatt gctgttgttg
     9481 ctgctgttct taatagcttg tgcatctgct ttgttgcctc tataccattg tgtatagtac
     9541 cttacactgc attgtactat tatgctacat tctattttac taatgagcct gcatttatta
     9601 tgcatgtttc ttggtacatt atgttcgggc ctatcgttcc catatggatg acctgcgtct
     9661 atacagttgc aatgtgcttt agacacttct tctgggtttt agcttatttt agtaagaaac
     9721 atgtagaagt ttttactgat ggtaagctta attgtagttt ccaggacgct gcctctaata
     9781 tctttgttat taacagggac acttatgcag ctcttagaaa ctctttaact aatgatgcct
     9841 attcacgatt tttggggttg tttaacaagt ataagtactt ctctggtgct atggaaacag
     9901 ccgcttatcg tgaagctgca gcatgtcatc ttgctaaagc cttacaaaca tacagcgaga
     9961 ctggtagtga tcttctttac caaccaccca actgtagcat aacctctggc gtgttgcaaa
    10021 gcggtttggt gaaaatgtca catcccagtg gagatgttga ggcttgtatg gttcaggtta
    10081 cctgcggtag catgactctt aatggtcttt ggcttgacaa cacagtctgg tgcccacgac
    10141 acgtaatgtg cccggctgac cagttgtctg atcctaatta tgatgccttg ttgatttcta
    10201 tgactaatca tagtttcagt gtgcaaaaac acattggtgc tccagcaaac ttgcgtgttg
    10261 ttggtcatgc catgcaaggc actcttttga agttgactgt cgatgttgct aaccctagca
    10321 ctccagccta cacttttaca acagtgaaac ctggcgcagc atttagtgtg ttagcatgct
    10381 ataatggtcg tccgactggt acattcactg ttgtaatgcg ccctaactac acaattaagg
    10441 gttcctttct gtgtggttct tgtggtagtg ttggttacac caaggagggt agtgtgatca
    10501 atttttgtta catgcatcaa atggaacttg ctaatggtac acataccggt tcagcatttg
    10561 atggtactat gtatggtgcc tttatggata aacaagtgca ccaagttcag ttaacagaca
    10621 aatactgcag tgttaatgta gtagcttggc tttacgcagc aatacttaat ggttgcgctt
    10681 ggtttgtaaa acctaatcgc actagtgttg tttcttttaa tgaatgggct cttgccaacc
    10741 aattcactga atttgttggc actcaatccg ttgacatgtt agctgtcaaa acaggcgttg
    10801 ctattgaaca gctgctttat gcgatccaac aactttatac tgggttccag ggaaagcaaa
    10861 tccttggcag tactatgttg gaagatgaat tcacacctga ggatgttaat atgcagatta
    10921 tgggtgtggt tatgcagagt ggtgtgagaa aagttacata tggtactgcg cattggttgt
    10981 tcgcgaccct tgtctcaacc tatgtgataa tcttacaagc cactaaattt actttgtgga
    11041 actacttgtt tgagactatt cccacacagt tgttcccact cttatttgtg actatggcct
    11101 tcgttatgtt gttggttaaa cacaaacaca cctttttgac acttttcttg ttgcctgtgg
    11161 ctatttgttt gacttatgca aacatagtct acgagcccac tactcccatt tcgtcagcgc
    11221 tgattgcagt tgcaaattgg cttgccccca ctaatgctta tatgcgcact acacatactg
    11281 atattggtgt ctacattagt atgtcacttg tattagtcat tgtagtgaag agattgtaca
    11341 acccatcact ttctaacttt gcgttagcat tgtgcagtgg tgtaatgtgg ttgtacactt
    11401 atagcattgg agaagcctca agccccattg cctatctggt ttttgtcact acactcacta
    11461 gtgattatac gattacagtc tttgttactg tcaaccttgc aaaagtttgc acttatgcca
    11521 tctttgctta ctcaccacag cttacacttg tgtttccgga agtgaagatg atacttttat
    11581 tatacacatg tttaggtttc atgtgtactt gctattttgg tgtcttctct cttttgaacc
    11641 ttaagcttag agcacctatg ggtgtctatg actttaaggt ctcaacacaa gagttcagat
    11701 tcatgactgc taacaatcta actgcaccta gaaattcttg ggaggctatg gctctgaact
    11761 ttaagttaat aggtattggc ggtacacctt gtataaaggt tgctgctatg cagtctaaac
    11821 ttacagatct taaatgcaca tctgtggttc tcctctctgt gctccaacag ttacacttag
    11881 aggctaatag tagggcctgg gctttctgtg ttaaatgcca taatgatata ttggcagcaa
    11941 cagaccccag tgaggctttc gagaaattcg taagtctctt tgccacttta atgacttttt
    12001 ctggtaatgt agatcttgat gcgttagcta gtgatatttt tgacactcct agcgtacttc
    12061 aagctactct ttctgagttt tcacacttag ctacctttgc tgagttggaa gctgcgcaga
    12121 aagcctatca ggaagctatg gactctggtg acacctcacc acaagttctt aaggctttgc
    12181 agaaggctgt taatatagct aaaaacgcct atgagaagga taaggcagtg gcccgtaagt
    12241 tagaacgtat ggctgatcag gctatgactt ctatgtataa gcaagcacgt gctgaagaca
    12301 agaaagcaaa aattgtcagt gctatgcaaa ctatgttgtt tggtatgatt aagaagctcg
    12361 acaacgatgt tcttaatggt atcatttcta acgctaggaa tggttgtata cctcttagtg
    12421 tcattccact gtgtgcttca aataaacttc gcgttgtaat tcctgacttc accgtctgga
    12481 atcaggtagt cacatatccc tcgcttaact acgctggggc tttgtgggac attacagtta
    12541 taaacaatgt ggacaatgaa attgttaagt cttcagatgt tgtagacagc aatgaaaatt
    12601 taacatggcc acttgtttta gaatgcacta gggcatccac ttctgccgtt aagttgcaaa
    12661 ataatgagat caaaccttca ggtttaaaaa ccatggttgt gtctgcaggt caagagcaaa
    12721 ctaactgtaa tactagttcc ttagcttatt acgaacctgt gcagggtcgt aaaatgctga
    12781 tggctcttct ttctgataat gcctatctca aatgggcgcg tgttgaaggt aaggacggat
    12841 ttgttagtgt agagctacaa cctccttgca aattcttgat tgcgggacca aaaggacctg
    12901 aaatccgata tctctatttt gttaaaaatc ttaacaacct tcatcgcggg caagtgttag
    12961 ggcacattgc tgcgactgtt agattgcaag ctggttctaa caccgagttt gcctctaatt
    13021 cttcggtgtt gtcacttgtt aacttcaccg ttgatcctca aaaagcttat ctcgatttcg
    13081 tcaatgcggg aggtgcccca ttgacaaatt gtgttaagat gcttactcct aaaactggta
    13141 caggtatagc tatatctgtt aaaccagaga gtacagctga tcaagagact tatggtggag
    13201 cttcagtgtg tctctattgc cgtgcgcata tagaacatcc tgatgtctct ggtgtttgta
    13261 aatataaggg taagtttgtc caaatccctg ctcagtgtgt ccgtgaccct gtgggatttt
    13321 gtttgtcaaa taccccctgt aatgtctgtc aatattggat tggatatggg tgcaattgtg
    13381 actcgcttag gcaagtagca ctgccccaat ctaaagattc caatttttta aacgagtccg
    13441 gggttctatt gtaaatgccc gaatagaacc ctgttcaagt ggtttgtcca ctgatgtcgt
    13501 ctttagggca tttgacatct gcaactataa ggctaaggtt gctggtattg gaaaatacta
    13561 caagactaat acttgtaggt ttgtagaatt agatgaccaa gggcatcatt tagactccta
    13621 ttttgtcgtt aagaggcata ctatggagaa ttatgaacta gagaagcact gttacgattt
    13681 gttacgtgac tgtgatgctg tagctcccca tgatttcttc atctttgatg tagacaaagt
    13741 taaaacacct catattgtac gtcagcgttt aactgagtac actatgatgg atcttgtata
    13801 tgccctgagg cactttgatc aaaatagcga agtgcttaag gctatcttag tgaagtatgg
    13861 ttgctgtgat gttacctact ttgaaaataa actctggttt gattttgttg aaaatcccag
    13921 tgttattggt gtttatcata aacttggaga acgtgtacgc caagctatct taaacactgt
    13981 taaattttgt gaccacatgg tcaaggctgg tttagtcggt gtgctcacac tagacaacca
    14041 ggaccttaat ggcaagtggt atgattttgg tgacttcgta atcactcaac ctggttcagg
    14101 agtagctata gttgatagct actattctta tttgatgcct gtgctctcaa tgaccgattg
    14161 tctggccgct gagacacata gggattgtga ttttaataaa ccactcattg agtggccact
    14221 tactgagtat gattttactg attataaggt acaactcttt gagaagtact ttaaatattg
    14281 ggatcagacg tatcacgcaa attgcgttaa ttgtactgat gaccgttgtg tgttacattg
    14341 tgctaatttc aatgtattgt ttgctatgac catgcctaag acttgtttcg gacccatagt
    14401 ccgaaagatc tttgttgatg gcgtgccatt tgtagtatct tgtggttatc actacaaaga
    14461 attaggttta gtcatgaata tggatgttag tctccataga cataggctct ctcttaagga
    14521 gttgatgatg tatgccgctg atccagccat gcacattgcc tcctctaacg cttttcttga
    14581 tttgaggaca tcatgtttta gtgtcgctgc acttacaact ggtttgactt ttcaaactgt
    14641 gcggcctggc aattttaacc aagacttcta tgatttcgtg gtatctaaag gtttctttaa
    14701 ggagggctct tcagttacgc tcaaacattt tttctttgct caagatggta atgctgctat
    14761 tacagattat aattactatt cttataatct gcctactatg tgtgacatca aacaaatgtt
    14821 gttctgcatg gaagttgtaa acaagtactt cgaaatctat gacggtggtt gtcttaatgc
    14881 ttctgaagtg gttgttaata atttagacaa gagtgctggc catcctttta ataagtttgg
    14941 caaagctcgt gtctattatg agagcatgtc ttaccaggag caagatgaac tctttgccat
    15001 gacaaagcgt aacgtcattc ctaccatgac tcaaatgaat ctaaaatatg ctattagtgc
    15061 taagaataga gctcgcactg ttgcaggcgt gtccatactt agcacaatga ctaatcgtca
    15121 gtaccatcag aaaatgctta agtccatggc tgcaactcgt ggagcgactt gcgtcattgg
    15181 tactacaaag ttctatggtg gctgggattt catgcttaaa acattgtaca aagatgttga
    15241 taatccgcat cttatgggtt gggattaccc taagtgtgat agagctatgc ctaatatgtg
    15301 tagaatcttt gcttcactca tattagctcg taaacatggc acttgttgta ctacaaggga
    15361 cagattttat cgcttggcaa atgagtgtgc tcaggtgcta agcgaatatg ttctatgtgg
    15421 tggtggttac tacgtcaaac ctggaggtac cagtagcgga gacgccacca ctgcatatgc
    15481 caatagtgtc tttaacattt tgcaggcgac aactgctaat gtcagtgcac ttatgggtgc
    15541 taatggcaac aagattgttg acaaagaagt taaagacatg cagtttgatt tgtatgtcaa
    15601 tgtttacagg agcactagcc cagaccccaa atttgttgat aaatactatg cttttcttaa
    15661 taagcacttt tctatgatga tactgtctga tgacggtgtc gtttgctata atagtgatta
    15721 tgcagctaag ggttacattg ctggaataca gaattttaag gaaacgctgt attatcagaa
    15781 caatgtcttt atgtctgaag ctaaatgctg ggtggaaacc gatctgaaga aagggccaca
    15841 tgaattctgt tcacagcata cgctttatat taaggatggc gacgatggtt acttccttcc
    15901 ttatccagac ccttcaagaa ttttgtctgc cggttgcttt gtagatgata tcgttaagac
    15961 tgacggtaca ctcatggtag agcggtttgt gtctttggct atagatgctt accctctcac
    16021 aaagcatgaa gatatagaat accagaatgt attctgggtc tacttacagt atatagaaaa
    16081 actgtataaa gaccttacag gacacatgct tgacagttat tctgtcatgc tatgtggtga
    16141 taattctgct aagttttggg aagaggcatt ctatagagat ctctatagtt cgcctaccac
    16201 tttgcaggct gtcggttcat gcgttgtatg ccattcacag acttccctac gctgtgggac
    16261 atgcatccgt agaccatttc tctgctgtaa atgctgctat gatcatgtta tagcaactcc
    16321 acataagatg gttttgtctg tttctcctta cgtttgtaat gcccctggtt gtggcgtttc
    16381 agacgttact aagctatatt taggtggtat gagctacttt tgtgtagatc atagacctgt
    16441 gtgtagtttt ccactttgcg ctaatggtct tgtattcggc ttatacaaga atatgtgcac
    16501 aggtagtcct tctatagttg aatttaatag gttggctacc tgtgactgga ctgaaagtgg
    16561 tgattacacc cttgccaata ctacaacaga accactcaaa ctttttgctg ctgagacttt
    16621 acgtgccact gaagaggcgt ctaagcagtc ttatgctatt gccaccatca aagaaattgt
    16681 tggtgagcgc caactattac ttgtgtggga ggctggcaag tccaaaccac cactcaatcg
    16741 taattatgtt tttactggtt atcatataac caaaaatagt aaagtgcagc tcggtgagta
    16801 catcttcgag cgcattgatt atagtgatgc tgtatcctac aagtctagta caacgtataa
    16861 actgactgta ggtgacatct tcgtacttac ctcccactct gtggctacct tgacggcgcc
    16921 cacaattgtg aatcaagaga ggtatgttaa aattactggg ttgtacccaa ccattacggt
    16981 acctgaagag ttcgcaagtc atgttgccaa cttccaaaaa tcaggttata gtaaatatgt
    17041 cactgttcag ggaccacctg gcactggcaa aagtcatttt gctatagggt tagcgattta
    17101 ctaccctaca gcacgtgttg tttatacagc atgttcacac gcagctgttg atgctttgtg
    17161 tgaaaaagct tttaaatatt tgaacattgc taaatgttcc cgtatcattc ctgcaaaggc
    17221 acgtgttgag tgctatgaca ggtttaaagt taatgagaca aattctcaat atttgtttag
    17281 tactattaat gctctaccag aaacttctgc cgatattctg gtggttgatg aggttagtat
    17341 gtgcactaat tatgatcttt caattattaa tgcacgtatt aaagctaagc acattgtcta
    17401 tgtaggagat ccagcacagt tgccagctcc taggactttg ttgactagag gcacattgga
    17461 accagaaaat ttcaatagtg tcactagatt gatgtgtaac ttaggtcctg acatattttt
    17521 aagtatgtgc tacaggtgtc ctaaggaaat agtaagcact gtgagcgctc ttgtctacaa
    17581 taataaattg ttagccaaga aggagctttc aggccagtgc tttaaaatac tctataaggg
    17641 caatgtgacg catgatgcta gctctgccat taatagacca caactcacat ttgtgaagaa
    17701 ttttattact gccaatccgg catggagtaa ggcagtcttt atttcgcctt ataattcaca
    17761 gaatgctgtg gctcgttcaa tgctgggcct tactactcag actgttgatt cctcacaggg
    17821 ttcagaatac cagtacgtta tcttctgtca aacagcagat acggcacatg ctaacaacat
    17881 taacagattt aatgttgcaa tcactcgtgc ccaaaaaggt attctttgtg ttatgacatc
    17941 tcaggcactc tttgagtcct tagagtttac tgaattgtct tttactaatt acaagctcca
    18001 gtctcagatt gtaactggcc tttttaaaga ttgctctaga gaaacttctg gcctctcacc
    18061 tgcttatgca ccaacatacg ttagtgttga tgacaagtat aagacgagtg atgagctttg
    18121 cgtgaatctt aatttacccg caaatgtccc atactctcgt gttatttcca ggatgggctt
    18181 taaactcgat gcaacagttc ctggatatcc taagcttttc attactcgtg aagaggctgt
    18241 aaggcaagtt cgaagctgga taggcttcga tgttgagggt gctcatgctt cccgtaatgc
    18301 atgtggcacc aatgtgcctc tacaattagg attttcaact ggtgtgaact ttgttgttca
    18361 gccagttggt gttgtagaca ctgagtgggg taacatgtta acgggcattg ctgcccgtcc
    18421 tccaccaggt gaacagttta agcacctcgt gcctcttatg cataaggggg ctgcatggcc
    18481 tattgttaga cgacgtatag tgcaaatgtt gtcagacact ttagacaaat tgtctgatta
    18541 ctgtacgttt gtttgttggg ctcatggctt tgaattaacg tctgcatcat acttttgcaa
    18601 gataggtaag gaacagaagt gttgcatgtg caatagacgc gctgcagcgt actcttcacc
    18661 tctgcaatct tatgcctgtt ggactcattc ctgcggttat gattatgtct acaacccttt
    18721 ctttgtcgat gttcaacagt ggggttatgt aggcaatctt gctactaatc acgatcgtta
    18781 ttgctctgtc catcaaggag ctcatgtggc ttctaatgat gcaataatga ctcgttgttt
    18841 agctattcat tcttgtttta tagaacgtgt ggattgggat atagagtatc cttatatctc
    18901 acatgaaaag aaattgaatt cctgttgtag aatcgttgag cgcaacgtcg tacgtgctgc
    18961 tcttcttgcc ggttcatttg acaaagtcta tgatattggc aatcctaaag gaattcctat
    19021 tgttgatgac cctgttgttg attggcatta ttttgatgca cagcccttga ccaggaaggt
    19081 acaacagctt ttctatacag aggacatggc ctcaagattt gctgatgggc tctgcttatt
    19141 ttggaactgt aatgtaccaa aatatcctaa taatgcaatt gtatgcaggt ttgacacacg
    19201 tgtgcattct gagttcaatt tgccaggttg tgatggcggt agtttgtatg ttaacaagca
    19261 cgcttttcat acaccagcat atgatgtgag tgcattccgt gatctgaaac ctttaccatt
    19321 cttttattat tctactacac catgtgaagt gcatggtaat ggtagtatga tagaggatat
    19381 tgattatgta cccctaaaat ctgcagtctg tattacaact tgtaatttag ggggcgctgt
    19441 ttgtaggaag catgctacag agtacagaga gtatatggaa gcatataatc ttgtctctgc
    19501 atcaggtttc cgcctttggt gttataagac ctttgatatt tataatctct ggtctacttt
    19561 tacaaaagtt caaggtttgg aaaacattgc ttttaatgtt gttaaacaag gccattttat
    19621 tggtgttgag ggtgaactac ctgtagctgt agtcaatgat aagatcttca ccaagagtgg
    19681 cgttaatgac atttgtatgt ttgagaataa aaccactttg cctactaata tagcttttga
    19741 actctatgct aagcgtgctg tacgctcgca tcccgatttc aaattgctac acaatttaca
    19801 agcagacatt tgctacaagt tcgtcctttg ggattatgaa cgtagcaata tttatggtac
    19861 tgctactatt ggtgtatgta agtacactga tattgatgtt aattcagctt tgaatatatg
    19921 ttttgacata cgcgataatg gttcattgga gaagttcatg tctactccca atgccatctt
    19981 tatttctgat agaaaaatca agaaataccc ttgtatggta ggtcctgatt atgcttactt
    20041 caatggtgct atcatccgtg atagtgatgt tgttaaacaa ccagtgaagt tctacttgta
    20101 taagaaagtc aataatgagt ttattgatcc tactgagtgt atttacactc agagtcgctc
    20161 ttgtagtgac ttcctacccc tgtctgacat ggagaaagac tttctatctt ttgatagtga
    20221 tgttttcatt aagaagtatg gcttggaaaa ctatgctttt gagcacgtag tctatggaga
    20281 cttctctcat actacgttag gcggtcttca cttgcttatt ggtttataca agaagcaaca
    20341 ggaaggtcat attattatgg aagaaatgct aaaaggtagc tcaactattc ataactattt
    20401 tattactgag actaacacag cggcttttaa ggcggtgtgt tctgttatag atttaaagct
    20461 tgacgacttt gttatgattt taaagagtca agaccttggc gtagtatcca aggttgtcaa
    20521 ggttcctatt gacttaacaa tgattgagtt tatgttatgg tgtaaggatg gacaggttca
    20581 aaccttctac cctcgactcc aggcttctgc agattggaaa cctggtcatg caatgccatc
    20641 cctctttaaa gttcaaaatg taaaccttga acgttgtgag cttgctaatt acaagcaatc
    20701 tattcctatg cctcgcggtg tgcacatgaa catcgctaaa tatatgcaat tgtgccagta
    20761 tttaaatact tgcacattag ccgtgcctgc caatatgcgt gttatacatt ttggcgctgg
    20821 ttctgataaa ggtatcgctc ctggtacatc agttttacga cagtggcttc ctacagatgc
    20881 cattattata gataatgatt taaatgagtt cgtgtcagat gctgacataa ctttatttgg
    20941 agattgtgta actgtacgtg tcggccaaca agtggatctt gttatttccg acatgtatga
    21001 tcctactact aagaatgtaa caggtagtaa tgagtcaaag gctttattct ttacttacct
    21061 gtgtaacctc attaataata atcttgctct tggtggttct gttgctatta aaataacaga
    21121 acactcttgg agcgttgaac tttatgaact tatgggaaaa tttgcttggt ggactgtttt
    21181 ctgcaccaat gcaaatgcat cctcatctga aggattcctt ttaggtatta attacttggg
    21241 tactattaaa gaaaatatag atggtggtgc tatgcacgcc aactatatat tttggagaaa
    21301 ttccactcct atgaatctga gtacttactc actttttgat ttatccaagt ttcaattaaa
    21361 attaaaagga acaccagttc ttcaattaaa ggagagtcaa attaacgaac tcgtaatatc
    21421 tctcctgtcg cagggtaagt tacttatccg tgacaatgat acactcagtg tttctactga
    21481 tgttcttgtt aacacctaca gaaagttacg ttgatgtagg gccagattct gttaagtctg
    21541 cttgtattga ggttgatata caacagacct tctttgataa aacttggcct aggccaattg
    21601 atgtttctaa ggctgacggt attatatacc ctcaaggccg tacatattct aacataacta
    21661 tcacttatca aggtcttttt ccctatcagg gagaccatgg tgatatgtat gtttactctg
    21721 caggacatgc tacaggcaca actccacaaa agttgtttgt agctaactat tctcaggacg
    21781 tcaaacagtt tgctaatggg tttgtcgtcc gtataggagc agctgccaat tccactggca
    21841 ctgttattat tagcccatct accagcgcta ctatacgaaa aatttaccct gcttttatgc
    21901 tgggttcttc agttggtaat ttctcagatg gtaaaatggg ccgcttcttc aatcatactc
    21961 tagttctttt gcccgatgga tgtggcactt tacttagagc tttttattgt attctagagc
    22021 ctcgctctgg aaatcattgt cctgctggca attcctatac ttcttttgcc acttatcaca
    22081 ctcctgcaac agattgttct gatggcaatt acaatcgtaa tgccagtctg aactctttta
    22141 aggagtattt taatttacgt aactgcacct ttatgtacac ttataacatt accgaagatg
    22201 agattttaga gtggtttggc attacacaaa ctgctcaagg tgttcacctc ttctcatctc
    22261 ggtatgttga tttgtacggc ggcaatatgt ttcaatttgc caccttgcct gtttatgata
    22321 ctattaagta ttattctatc attcctcaca gtattcgttc tatccaaagt gatagaaaag
    22381 cttgggctgc cttctacgta tataaacttc aaccgttaac tttcctgttg gatttttctg
    22441 ttgatggtta tatacgcaga gctatagact gtggttttaa tgatttgtca caactccact
    22501 gctcatatga atccttcgat gttgaatctg gagtttattc agtttcgtct ttcgaagcaa
    22561 aaccttctgg ctcagttgtg gaacaggctg aaggtgttga atgtgatttt tcacctcttc
    22621 tgtctggcac acctcctcag gtttataatt tcaagcgttt ggtttttacc aattgcaatt
    22681 ataatcttac caaattgctt tcactttttt ctgtgaatga ttttacttgt agtcaaatat
    22741 ctccagcagc aattgctagc aactgttatt cttcactgat tttggattat ttttcatacc
    22801 cacttagtat gaaatccgat ctcagtgtta gttctgctgg tccaatatcc cagtttaatt
    22861 ataaacagtc cttttctaat cccacatgtt tgatcttagc gactgttcct cataacctta
    22921 ctactattac taagcctctt aagtacagct atattaacaa gtgctctcgt cttctttctg
    22981 atgatcgtac tgaagtacct cagttagtga acgctaatca atactcaccc tgtgtatcca
    23041 ttgtcccatc cactgtgtgg gaagacggtg attattatag gaaacaacta tctccacttg
    23101 aaggtggtgg ctggcttgtt gctagtggct caactgttgc catgactgag caattacaga
    23161 tgggctttgg tattacagtt caatatggta cagacaccaa tagtgtttgc cccaagcttg
    23221 aatttgctaa tgacacaaaa attgcctctc aattaggcaa ttgcgtggaa tattccctct
    23281 atggtgtttc gggccgtggt gtttttcaga attgcacagc tgtaggtgtt cgacagcagc
    23341 gctttgttta tgatgcgtac cagaatttag ttggctatta ttctgatgat ggcaactact
    23401 actgtctgcg tgcttgtgtt agtgttcctg tttctgtcat ctatgataaa gaaactaaaa
    23461 cccacgctac tctatttggt agtgttgcat gtgaacacat ttcttctacc atgtctcaat
    23521 actcccgttc tacgcgatca atgcttaaac ggcgagattc tacatatggc ccccttcaga
    23581 cacctgttgg ttgtgtccta ggacttgtta attcctcttt gttcgtagag gactgcaagt
    23641 tgcctctcgg tcaatctctc tgtgctcttc ctgacacacc tagtactctc acacctcgca
    23701 gtgtgcgctc tgtgccaggt gaaatgcgct tggcatccat tgcttttaat catcccattc
    23761 aggttgatca acttaatagt agttatttta aattaagtat acccactaat ttttcctttg
    23821 gtgtgactca ggagtacatt cagacaacca ttcagaaagt tactgttgat tgtaaacagt
    23881 acgtttgcaa tggtttccag aagtgtgagc aattactgcg cgagtatggc cagttttgtt
    23941 ccaaaataaa ccaggctctc catggtgcca atttacgcca ggatgattct gtacgtaatt
    24001 tgtttgcgag cgtgaaaagc tctcaatcat ctcctatcat accaggtttt ggaggtgact
    24061 ttaatttgac acttctagaa cctgtttcta tatctactgg cagtcgtagt gcacgtagtg
    24121 ctattgagga tttgctattt gacaaagtca ctatagctga tcctggttat atgcaaggtt
    24181 acgatgattg tatgcagcaa ggtccagcat cagctcgtga tcttatttgt gctcaatatg
    24241 tggctggtta taaagtatta cctcctctta tggatgttaa tatggaagcc gcgtatactt
    24301 catctttgct tggcagcata gcaggtgttg gctggactgc tggcttatcc tcctttgctg
    24361 ctattccatt tgcacagagt attttttata ggttaaacgg tgttggcatt actcaacagg
    24421 ttctttcaga gaaccaaaag cttattgcca ataagtttaa tcaggctctg ggagctatgc
    24481 aaacaggctt cactacaact aatgaagctt ttcggaaggt tcaggatgct gtgaacaaca
    24541 atgcacaggc tctatccaaa ttagctagcg agctatctaa tacttttggt gctatttccg
    24601 cctctattgg agacatcata caacgtcttg atgttctcga acaggacgcc caaatagaca
    24661 gacttattaa tggccgtttg acaacactaa atgcttttgt tgcacagcag cttgttcgtt
    24721 ccgaatcagc tgctctttcc gctcaattgg ctaaagataa agtcaatgag tgtgtcaagg
    24781 cacaatccaa gcgttctgga ttttgcggtc aaggcacaca tatagtgtcc tttgttgtaa
    24841 atgcccctaa tggcctttac tttatgcatg ttggttatta ccctagcaac cacattgagg
    24901 ttgtttctgc ttatggtctt tgcgatgcag ctaaccctac taattgtata gcccctgtta
    24961 atggctactt tattaaaact aataacacta ggattgttga tgagtggtca tatactggct
    25021 cgtccttcta tgcacctgag cccatcacct ctcttaatac taagtatgtt gcaccacagg
    25081 tgacatacca aaacatttct actaacctcc ctcctcctct tctcagcaat tccaccggga
    25141 ttgacttcca agatgagttg gatgagtttt tcaaaaatgt tagcaccagt atacctaatt
    25201 ttggttctct aacacagatt aatactacat tactcgatct tacctacgag atgttgtctc
    25261 ttcaacaagt tgttaaagcc cttaatgagt cttatataga ccttaaagag cttggcaatt
    25321 atacttatta caacaaatgg ccgtggtaca tttggcttgg tttcattgct gggcttgttg
    25381 ccttagctct atgcgtcttc ttcatactgt gctgcactgg ttgtggcaca aactgtatgg
    25441 gaaaacttaa gtgtaatcgt tgttgtgata gatacgagga atacgacctc gagccgcata
    25501 aggttcatgt tcactaatta acgaactatc aatgagagtt caaagaccac ccactctctt
    25561 gttagtgttc tcactctctc ttttggtcac tgcattttca aaacctctct atgtacctga
    25621 gcattgtcag aattattctg gttgcatgct tagggcttgt attaaaactg cccaagctga
    25681 tacagctggt ctttatacaa attttcgaat tgacgtccca tctgcagaat caactggtac
    25741 tcaatcagtt tctgtcgatc gtgagtcaac ttcaactcat gatggtccta ccgaacatgt
    25801 tactagtgtg aatctttttg acgttggtta ctcagttaat taacgaactc tatggattac
    25861 gtgtctctgc ttaatcaaat ttggcagaag taccttaatt caccgtatac tacttgtttg
    25921 tatatcccta aacccacagc taagtataca cctttagttg gcacttcatt gcaccctgtg
    25981 ctgtggaact gtcagctatc ctttgctggt tatactgaat ctgctgttaa ttctacaaaa
    26041 gctttggcca aacaggacgc agctcagcga atcgcttggt tgctacataa ggatggagga
    26101 atccctgatg gatgttccct ctacctccgg cactcaagtt tattcgcgca aagcgaggaa
    26161 gaggagtcat tctccaacta agaaactgcg ctacgttaag cgtagatttt ctcttctgcg
    26221 ccctgaagac cttagtgtta ttgtccaacc aacacactat gtcagggtta cattttcaga
    26281 ccccaacatg tggtatctac gttcgggtca tcatttacac tcagttcaca attggcttaa
    26341 accttatggc ggccaacctg tttctgagta ccatattact ctagctttgc taaatctcac
    26401 tgatgaagat ttagctagag atttttcacc cattgcgctc tttttgcgca atgtcagatt
    26461 tgagctacat gagttcgcct tgctgcgcaa aactcttgtt cttaatgcat cagagatcta
    26521 ctgtgctaac atacatagat ttaagcctgt gtatagagtt aacacggcaa tccctactat
    26581 taaggattgg cttctcgttc agggattttc cctttaccat agtggcctcc ctttacatat
    26641 gtcaatctct aaattgcatg cactggatga tgttactcgc aattacatca ttacaatgcc
    26701 atgctttaga acttatcctc aacaaatgtt tgttactcct ttggccgtag atgttgtctc
    26761 catacggtct tccaatcagg gtaataaaca aattgttcat tcttacccca ttttacatca
    26821 tccaggattt taacgaacta tggctttctc ggcgtcttta tttaaacccg tccagctagt
    26881 cccagtttct cctgcatttc atcgcattga gtctactgac tctattgttt tcacatacat
    26941 tcctgctagc ggctatgtag ctgctttagc tgtcaatgtg tgtctcattc ccctattatt
    27001 actgctacgt caagatactt gtcgtcgcag cattatcaga actatggttc tctatttcct
    27061 tgttctgtat aactttttat tagccattgt actagtcaat ggtgtacatt atccaactgg
    27121 aagttgcctg atagccttct tagttatcct cataatactt tggtttgtag atagaattcg
    27181 tttctgtctc atgctgaatt cctacattcc actgtttgac atgcgttctc actttattcg
    27241 tgttagtaca gtttcttctc atggtatggt ccctgtcata cacaccaaac cattatttat
    27301 tagaaacttc gatcagcgtt gcagctgttc tcgttgtttt tatttgcact cttccactta
    27361 tatagagtgc acttatatta gccgttttag taagattagc ctagtttctg taactgactt
    27421 ctccttaaac ggcaatgttt ccactgtttt cgtgcctgca acgcgcgatt cagttcctct
    27481 tcacataatc gccccgagct cgcttatcgt ttaagcagct ctgcgctact atgggtcccg
    27541 tgtagaggct aatccattag tctctctttg gacatatgga aaacgaacta tgttaccctt
    27601 tgtccaagaa cgaatagggt tgttcatagt aaactttttc atttttaccg tagtatgtgc
    27661 tataacactc ttggtgtgta tggctttcct tacggctact agattatgtg tgcaatgtat
    27721 gacaggcttc aataccctgt tagttcagcc cgcattatac ttgtataata ctggacgttc
    27781 agtctatgta aaattccagg atagtaaacc ccctctacca cctgacgagt gggtttaacg
    27841 aactccttca taatgtctaa tatgacgcaa ctcactgagg cgcagattat tgccattatt
    27901 aaagactgga actttgcatg gtccctgatc tttctcttaa ttactatcgt actacagtat
    27961 ggatacccat cccgtagtat gactgtctat gtctttaaaa tgtttgtttt atggctccta
    28021 tggccatctt ccatggcgct atcaatattt agcgccattt atccaattga tctagcttcc
    28081 cagataatct ctggcattgt agcagctgtt tcagctatga tgtggatttc ctactttgtg
    28141 cagagtatcc ggctgtttat gagaactgga tcatggtggt cattcaatcc tgagactaat
    28201 tgccttttga acgttccatt tggtggtaca actgtcgtac gtccactcgt agaggactct
    28261 accagtgtaa ctgctgttgt aaccaatggc cacctcaaaa tggctggcat gcatttcggt
    28321 gcttgtgact acgacagact tcctaatgaa gtcaccgtgg ccaaacccaa tgtgctgatt
    28381 gctttaaaaa tggtgaagcg gcaaagctac ggaactaatt ccggcgttgc catttaccat
    28441 agatataagg caggtaatta caggagtccg cctattacgg cggatattga acttgcattg
    28501 cttcgagctt aggctcttta gtaagagtat cttaattgat tttaacgaat ctcaatttca
    28561 ttgttatggc atcccctgct gcacctcgtg ctgtttcctt tgccgataac aatgatataa
    28621 caaatacaaa cctgtctcga ggtagaggac gtaatccaaa accacgagct gcaccaaata
    28681 acactgtctc ttggtacact gggcttaccc aacacgggaa agtccctctt acctttccac
    28741 ctgggcaggg tgtacctctt aatgccaatt ccaccccagc gcaaaatgct gggtattggc
    28801 ggagacagga cagaaaaatt aataccggga atggaattaa gcaactggct cccaggtggt
    28861 acttctacta cactggaacc ggacccgaag cagcactccc attccgggct gttaaggatg
    28921 gcatcgtttg ggtccatgaa catggcgcca ctgatgctcc ttcaactttt gggacgcgga
    28981 accctaacaa tgattcagct attgttacac aattcgcgcc cggtactaag cttcctaaaa
    29041 acttccacat tgaggggact ggaggcaata gtcaatcatc ttcaagagcc tctagcgtaa
    29101 gcagaaactc ttccagatct agttcacaag gttcaagatc aggaaactct acccgcggca
    29161 cttctccagg tccatctgga atcggagcag taggaggtga tctactttac cttgatcttc
    29221 tgaacagact acaagccctt gagtctggca aagtaaagca atcgcagcca aaagtaatca
    29281 ctaagaaaga tgctgctgct gctaaaaata agatgcgcca caagcgcact tccaccaaaa
    29341 gtttcaacat ggtgcaagct tttggtcttc gcggaccagg agacctccag ggaaactttg
    29401 gtgatcttca attgaataaa ctcggcactg aggacccacg ttggccccaa attgctgagc
    29461 ttgctcctac agccagtgct tttatgggta tgtcgcaatt taaacttacc catcagaaca
    29521 atgatgatca tggcaaccct gtgtacttcc ttcggtacag tggagccatt aaacttgacc
    29581 caaagaatcc caactacaat aagtggttgg agcttcttga gcaaaatatt gatgcctaca
    29641 aaaccttccc taagaaggaa aagaaacaaa aggcaccaaa agaagaatca acagaccaaa
    29701 tgtctgaacc tcctaaggag cagcgtgtgc aaggtagcat cactcagcgc actcgcaccc
    29761 gtccaagtgt tcagcctggt ccaatgattg atgttaacac tgattagtgt cactcaaagt
    29821 aacaagatcg cggcaatcgt ttgtgtttgg taaccccatc tcaccatcgc ttgtccactc
    29881 ttgcacagaa tggaatcatg ttgtaattac agtgcaataa ggtaattata acccatttaa
    29941 ttgatagcta tgctttatta aagtgtgtag ctgtagagag aatgttaaag actgtcacct
    30001 ctgcctgatt gcaagtgaac agtgcccccc gggaagagct ctacagtgtg aaatgtaaat
    30061 aaaaatagct attattcaat tagattaggc taattagatg atttgcaaaa aaaaaaaaa

Share this post


Link to post
Share on other sites
LOCUS       KT368852               30117 bp    RNA     linear   VRL 17-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate
            camel/Jeddah/O47(b)/2014, complete genome.
ACCESSION   KT368852
VERSION     KT368852.1  GI:922058160
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 30117)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Co-circulation of three camel coronavirus species and recombination
            of MERS-CoVs in Saudi Arabia
  JOURNAL   Science (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 30117)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2015) Centre of Influenza Research & State Key
            Laboratory of Emerging Infectious Diseases, The University of Hong
            Kong, Laboratory Block, 21 Sassoon Road, Pokfulam, Hong Kong SAR,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..30117
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="camel/Jeddah/O47(b)/2014"
                     /host="camel"
                     /db_xref="taxon:1335626"
                     /country="Saudi Arabia"
                     /collection_date="Oct-2014"
     gene            279..21514
                     /gene="orf1ab"
     CDS             join(279..13433,13433..21514)
                     /gene="orf1ab"
                     /ribosomal_slippage
                     /codon_start=1
                     /product="polyprotein ORF1ab"
                     /protein_id="ALA49648.1"
                     /db_xref="GI:922058162"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
                     RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
                     RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
                     RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
                     KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
                     DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
                     VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
                     RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
                     VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
                     EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
                     MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
                     GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
                     LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
                     NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
                     AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
                     LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
                     YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
                     SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
                     FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
                     PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
                     ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
                     RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
                     RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
                     NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
                     PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
                     KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
                     SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
                     TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYS
                     RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
                     FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
                     MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
                     WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
                     CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
                     DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
                     VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
                     DIDYVPLKSAVCITTCNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
                     WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
                     TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
                     VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDGDV
                     VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
                     ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
                     AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
                     RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
                     TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
                     DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
                     TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
                     FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
                     LSVSTDVLVNTYRKLR"
     gene            279..13454
                     /gene="orf1a"
     CDS             279..13454
                     /gene="orf1a"
                     /codon_start=1
                     /product="polyprotein ORF1a"
                     /protein_id="ALA49647.1"
                     /db_xref="GI:922058161"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
     gene            21456..25517
                     /gene="S"
     CDS             21456..25517
                     /gene="S"
                     /codon_start=1
                     /product="spike protein"
                     /protein_id="ALA49649.1"
                     /db_xref="GI:922058163"
                     /translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
                     PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPKKLFV
                     ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
                     MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
                     YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
                     NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
                     RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAIPSGSVVEQAEGVECDFSPLLSGT
                     PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
                     SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
                     DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
                     LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
                     VRQQRFVYDAYHNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
                     SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
                     TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
                     IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
                     QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
                     QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
                     AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
                     QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
                     SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
                     IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
                     VAPQVTYQNISTNLPPPLLSNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
                     TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
                     TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
     gene            25532..25843
                     /gene="orf3"
     CDS             25532..25843
                     /gene="orf3"
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="ALA49650.1"
                     /db_xref="GI:922058164"
                     /translation="MRVQRPPTLLLVFSLSLLVTAFSKPLYVPEHCQNYSGCMLRACI
                     KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGPTEHVTSVNLFDVGYSV
                     N"
     gene            25852..26181
                     /gene="orf4a"
     CDS             25852..26181
                     /gene="orf4a"
                     /codon_start=1
                     /product="ORF4a"
                     /protein_id="ALA49651.1"
                     /db_xref="GI:922058165"
                     /translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
                     WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
                     EEESFSN"
     gene            26093..26833
                     /gene="orf4b"
     CDS             26093..26833
                     /gene="orf4b"
                     /codon_start=1
                     /product="ORF4b"
                     /protein_id="ALA49652.1"
                     /db_xref="GI:922058166"
                     /translation="MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
                     EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
                     TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
                     PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
                     VDVVSIRSSNQGNKQIVHSYPILHHPGF"
     gene            26840..27514
                     /gene="orf5"
     CDS             26840..27514
                     /gene="orf5"
                     /codon_start=1
                     /product="ORF5"
                     /protein_id="ALA49653.1"
                     /db_xref="GI:922058167"
                     /translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
                     VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
                     ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
                     CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
                     PSSLIV"
     gene            27590..27838
                     /gene="E"
     CDS             27590..27838
                     /gene="E"
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ALA49654.1"
                     /db_xref="GI:922058168"
                     /translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
                     TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
     gene            27853..28512
                     /gene="M"
     CDS             27853..28512
                     /gene="M"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="ALA49655.1"
                     /db_xref="GI:922058169"
                     /translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
                     VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
                     MRTGSWWSFNPETNCLLNVPFGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
                     DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
                     A"
     gene            28566..29807
                     /gene="N"
     CDS             28566..29807
                     /gene="N"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="ALA49656.1"
                     /db_xref="GI:922058170"
                     /translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
                     TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
                     TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
                     HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGSSPGPSGIGAVGGDLLYLDL
                     LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
                     NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
                     IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
                     TQRTRTRPSVQPGPMIDVNTD"
     gene            28762..29100
                     /gene="orf8b"
     CDS             28762..29100
                     /gene="orf8b"
                     /codon_start=1
                     /product="ORF8b"
                     /protein_id="ALA49657.1"
                     /db_xref="GI:922058171"
                     /translation="MPIPPLRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLEPDPKQ
                     HSHSGLLRMASFGSMKMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
                     IVNHLQEPLA"
ORIGIN      
        1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
       61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
      121 gtggcactaa tttgcctgct catctaggca gtggacatat gctcaacact gggtataatt
      181 ctaattgaat actatttttc agttagagcg tcgtgtctct tgtacgtctc ggtcacaata
      241 cacggtttcg tccggtgcgt ggcaattcgg ggcacatcat gtctttcgtg gctggtgtga
      301 tcgcgcaagg tgcgcgcggt acgtatcgag cagcgctcaa ctctgaaaaa catcaagacc
      361 atgtgtctct aactgtgcca ctctgtggtt caggaaacct ggttgaaaaa ctttcaccat
      421 ggttcatgga tggcgaaaat gcctatgaag tggtgaaggc catgttactt aaaaaagagc
      481 cacttctcta tgtgcccatc cggctggctg gacacactag acacctccca ggtcctcgtg
      541 tgtacctggt tgagaggctc attgcttgtg aaaatccatt catggttaac caattggctt
      601 atagctctag tgcaaatggc agcctggttg gcacaacttt gcagggcaag cctattggta
      661 tgttcttccc ttatgacatc gaacttgtca caggaaagca aaatattctc ctgcgcaagt
      721 atggccgtgg tggttatcac tacaccccat tccactatga gcgagacaac acctcttgcc
      781 ctgagtggat ggacgatttt gaggcggatc ctaaaggcaa atatgcccag aatctgctta
      841 agaagttgat tggcggtgat gtcactccag ttgaccaata catgtgtggc gttgatggaa
      901 aacccattag tgcctacgca tttttaatgg ccaaggatgg aataaccaaa ctggctgatg
      961 ttgaagcgga cgtcgcagca cgtgctgatg acgaaggctt catcacatta aagaacaatc
     1021 tatatagatt ggtttggcat gttgagcgta aagacgttcc atatcctaag caatctattt
     1081 ttactattaa tagtgtggtc caaaaggatg gtgttgaaaa cactcctcct cactatttta
     1141 ctcttggatg caaaatttta acgctcaccc cacgcaacaa gtggagtggc gtttctgact
     1201 tgtccctcaa acaaaaactc ctttacacct tctatggtaa ggagtcactt gagaacccaa
     1261 cctacattta ccactccgca ttcattgagt gtggaagttg tggtaatgat tcctggctta
     1321 cagggaatgc tatccaaggg tttgcctgtg gatgtggggc atcatataca gctaatgatg
     1381 tcgaagtcca atcatctggc atgattaagc caaatgctct tctttgtgct acttgcccct
     1441 ttgctaaggg tgacagctgt tcttctaatt gcaaacattc agttgctcag ttggttagtt
     1501 acctttctga acgctgtaat gttattgctg attctaagtc cttcacactt atctttggtg
     1561 gcgtagctta cgcctacttt ggatgtgagg aaggtactat gtactttgtg cctagagcta
     1621 agtctgttgt ctcaaggatt ggagactcca tctttacagg ctgtactggc tcttggaaca
     1681 aggtcactca aattgctaac atgttcttgg aacagactca gcattccctt aactttgtgg
     1741 gagagttcgt tgtcaacgat gttgtcctcg caattctctc tggaaccaca actaatgttg
     1801 acaaaatacg ccagcttctc aaaggtgtca ccattgacaa gttgcgtgat tatttagctg
     1861 actatgacgt agcagtcact gccggcccat tcatggataa tgctattaat gttggtggta
     1921 caggattaca gtatgccgcc attactgcac cttatgtagt tctcactggc ttaggtgagt
     1981 cctttaagaa agttgcaacc ataccgtaca aggtttgcaa ctctgttaag gatactctga
     2041 cttattatgc tcacagcgtg ttgtacagag tttttcctta tgacatggat tctggtgtgt
     2101 catcctttag tgaactactt tttgattgcg ttgatctttc agtagcttct acctattttt
     2161 tagtccgcct cttgcaagat aagactggcg actttatgtc tacaattatt acttcctgcc
     2221 aaactgctgt tagtaagctt ctagatacat gttttgaagc tacagaagca acatttaact
     2281 tcttgttaga tttggcagga ttgttcagaa tctttcttcg caatgcctat gtgtacactt
     2341 cacaagggtt tgtggtggtc aatggcaaag tttctacact tgtcaaacaa gtgttagact
     2401 tgcttaataa gggtatgcaa cttttgcata caaaggtctc ctgggctggt tctaatatca
     2461 gtgctgttat ctacagcggc agggagtctc taatattccc atcgggaacc tattactgtg
     2521 tcaccactaa ggctaagtcc gttcaacaag atcttgacgt tattttgcct ggtgagtttt
     2581 ccaagaagca gttaggactg ctccaaccta ctgacaattc tacaactgtt agtgttactg
     2641 tatccagtaa catggttgaa actgttgtgg gtcaacttga gcaaactaat atgcatagtc
     2701 ctgatgttat agtaggtgac tatgtcatta ttagtgaaaa attgtttgtg cgtagtaagg
     2761 aagaagacgg atttgccttc taccctgctt gcactaatgg tcatgctgta ccgactctct
     2821 ttagacttaa gggaggtgca cctgtaaaaa aagtagcctt tggcggtgat caagtacatg
     2881 aggttgctgc tgtaagaagt gttactgtcg agtacaacat tcatgctgta ttagacacac
     2941 tacttgcttc ttctagtctt agaacctttg ttgtagataa gtctttgtca attgaggagt
     3001 ttgctgacgt agtaaaggaa caagtctcag acttgcttgt taaattactg cgtggaatgc
     3061 cgattccaga ttttgattta gacgatttta ttgacgcacc atgctattgc tttaacgctg
     3121 agggtgatgc atcttggtct tctactatga tcttctctct tcaccccgtc gagtgtgacg
     3181 aggagtgttc tgaagtagag gcttcagatt tagaagaagg tgaatcagag tgcatttctg
     3241 agacttcaac tgaacaagtt gacgtttctc atgaggtttc tgacgacgag tgggctgctg
     3301 cagttgatga agcgttcccc ctcgatgaag cagaagatgt tactgaatct gtgcaagaag
     3361 aagcacaacc agtagaagta cctgttgaag atattgcgca ggttgtcata gctgacacct
     3421 tacaggaaac tcctgttgtg tttgatactg ttgaagtccc accgcaagtg gtgaaacttc
     3481 cgtctgaacc tcagactatc cagcccgagg taaaagaagt tgcacctgtc tatgaggctg
     3541 ataccgaaca gacacagagt gttactgtta aacctaagag gttacgcaaa aagcgtaatg
     3601 ttgacccttt gtccaatttt gaacataagg ttattacaga gtgcgttacc atagttttag
     3661 gtgacgcaat tcaagtagcc aagtgctatg gggagtctgt gttagttaat gctgctaaca
     3721 cacatcttaa gcatggcggt ggtatcgctg gtgctattaa tgcggcttca aaaggggctg
     3781 tccaaaaaga gtcagatgag tatattctgg ctaaagggcc gttacaagta ggagattcag
     3841 ttctcttgca aggccattct ctagctaaga atatcctgca tgtcgtaggc ccagatgccc
     3901 gcgctaaaca ggatgtttct ctccttagta agtgctataa ggctatgaat gcatatcctc
     3961 ttgtagtcac tcctcttgtt tcagcaggca tatttggtgt aaaaccagct gtgtcttttg
     4021 attatcttat tagagaggct aagactagag ttttagtcgt cgttaattcc caagatgtct
     4081 ataagagtct taccatagtt gacattccac agagtttgac tttttcatat gatgggttac
     4141 gtggcgcaat acgtaaagct aaagattatg gttttactgt ttttgtgtgc acagacaact
     4201 ctgctaacac taaagttctt aggaacaagg gtgttgatta tactaagaag tttcttacag
     4261 ttgacggtgt gcaatattat tgctacacgt ctaaggacac tttagatgat atcttacaac
     4321 aggctaataa gtctgttggt attatatcta tgcctttggg atatgtgtct catggtttag
     4381 acttaattca agcagggagt gtcgtgcgta gagttaacgt gccctacgtg tgtctcctag
     4441 ctaataaaga gcaagaagct attttgatgt ctgaagacgt taagttaaac ccttcagaag
     4501 attttataaa gcacgtccgc actaatggtg gttacaattc ttggcattta gtcgagggtg
     4561 aactattggt gcaagactta cgcttaaata agctcctgca ttggtctgat caaaccatat
     4621 gctacaagga tagtgtgttt tatgttgtaa agaatagtac agcttttcca tttgaaacac
     4681 tttcagcatg tcgtgcgtat ttggattcac gcacgacaca gcagttaaca atcgaagtct
     4741 tagtgactgt cgatggtgta aattttagaa cagtcgttct aaataataag aacacttata
     4801 gatcacagct tggatgcgtt ttctttaatg gtgctgatat ttctgatacc attcctgatg
     4861 agaaacagaa tggtcacagt ttatatctag cagacaattt gactgctgat gaaacaaagg
     4921 cgcttaaaga gttatatggc cccgttgatc ctactttctt acacagattc tattcactta
     4981 aggcagcagt ccataagtgg aagatggttg tgtgtgataa ggtacgttct ctcaaattga
     5041 gtgataataa ttgttatctt aatgcagtta ttatgacact tgatttattg aaggacatta
     5101 aatttgttat acctgctcta cagcatgcat ttatgaaaca taagggcggt gattcaactg
     5161 acttcatagc cctcattatg gcttatggca attgcacatt tggtgctcca gatgatgcct
     5221 ctcggttact tcacaccgtg cttgcaaagg ctgagttatg ctgttctgca cgcatggttt
     5281 ggagagagtg gtgcaatgtc tgtggcataa aagatgttgt tctacaaggc ttaagagctt
     5341 gttgttacgt gggtgtgcaa actgttgaag atctgcgtgc tcgcatgaca tatgtatgcc
     5401 agtgtggtgg tgaacgtcat cggcaaatag tcgaacacac cactccctgg ttgctgctct
     5461 caggcacacc aaatgaaaaa ttggtgacaa ccttcacggc gcctgatttt gtagcgttta
     5521 atgtctttca gggcattgaa acggctgttg gccattatgt tcatgctcgc ctgaagggtg
     5581 gtcttatttt aaagtttgac tctggcaccg ttagcaagac ttcagactgg aagtgcaagg
     5641 tgacagatgt acttttcccc ggccaaaaat acagtagcga ttgtaatgtc gtacggtatt
     5701 ctttggacgg taatttcaga acagaggttg atcccgacct atctgctttc tatgttaagg
     5761 atggtaaata ctttacaagt gaaccacccg taacatattc accagctaca attttagctg
     5821 gtagtgtcta cactaatagc tgccttgtat cgtctgatgg acaacctggc ggtgatgcta
     5881 ttagtttgag ttttaataac cttttagggt ttgattctag taaaccagtc actaagaaat
     5941 acacttactc cttcttgcct aaagaagacg gcgatgtgtt gttggctgag tttgacactt
     6001 atgaccctat ttataagaat ggtgccatgt ataaaggcaa accaattctt tgggtcaaca
     6061 aagcatctta tgatattaat cttaataagt tcaatagagc tagtttgcgt caaatttttg
     6121 acgtagcccc cattgaactc gaaaataaat tcacaccttt gagtgtggcg tctacaccag
     6181 ttgaacctcc aactgtagat gtggtagcac ttcaacagga aatgacaatt gtcaaatgta
     6241 agggtttaaa taaacctttc gtgaaggaca atgtcagttt cgttgttgat gactcaggta
     6301 ctcccgttgt tgagtatctg tctaaagaag atctacatac attgtatgta gaccctaagt
     6361 atcaagtcat tgtcttaaaa gacaatgtac tttcttctat gcttagattg cacaccgttg
     6421 agtcaggtga tattaacgtt gttgcagctt ccggatcttt gacacgtaaa gtgaagttac
     6481 tatttagggc ttcattttat ttcaaagaat ttgctacccg cactttcact gctaccactg
     6541 ctgtaggtag ttgtataaag agtgtagtgc ggcatctagg tgttactaaa ggcatattga
     6601 caggctgttt tagttttgtc aagatgttat ttatgcttcc actagcttac tttagtgatt
     6661 caaaactcgg caccacagag gttaaagtga gtgctttgaa aacagctggc gttgtgacag
     6721 gtaatgttgt aaaacagtgt tgcactgctg ctgttgattt aagtatggat aagttgcgcc
     6781 gtgtggattg gaaatcaacc ctacggttgt tacttatgtt atgcacaact atggtattgt
     6841 tgtcttctgt gtatcacttg tatgtcttca atcaggtctt atcaagtgat gttatgtttg
     6901 aagatgccca aggtttgaaa aagttctaca aagaagttag agcttaccta ggaatctctt
     6961 ctgcttgtga cggtcttgct tcagcttata gggcgaattc atttgatgta cctacattct
     7021 gcgcaaaccg ttctgcaatg tgtaattggt gcttgattag ccaagattcc ataactcact
     7081 acccagctct taagatggtt caaacacatc ttagccacta tgttcttaac atagattggt
     7141 tgtggtttgc atttgagact ggtttggcat acatgctcta tacctcggcc ttcaactggt
     7201 tgttgttggc aggtacattg cattatttct ttgcacaaac ttccatattt gtagactggc
     7261 ggtcatacaa ttatgctgtg tctagtgcct tctggttatt cacccacatt ccaatggcgg
     7321 gtttggtacg aatgtataat ttgttagcat gcctttggct tttacgcaag ttttatcagc
     7381 atgtaatcaa tggttgcaaa gatacggcat gcttgctctg ctataagagg aaccgactta
     7441 ctagagttga agcttctacc gttgtctgtg gtggaaaacg tacgttttat atcacagcaa
     7501 atggcggtat ttcattctgt cgtaggcata attggaattg tgtggattgt gacattgcag
     7561 gtgtggggaa taccttcatc tgtgaagaag tcgcaaatga cctcactacc gccctacgca
     7621 ggcctattaa cgctacggat agatcacatt attatgtgga ttccgttaca gttaaagaga
     7681 ctgttgttca gtttaattat cgtagagacg gtcaaccatt ctacgagcgg tttcccctct
     7741 gcgcttttac aaatctagat aagttgaagt tcaaagaggt ctgtaaaact actactggta
     7801 tacctgaata caactttatc atctacgact catcagatcg tggccaggaa agtttagcta
     7861 ggtctgcatg tgtttattat tctcaagtct tgtgtaaatc aattcttttg gttgactcaa
     7921 gtttggttac ttctgttggt gattctagtg aaatcgccac taaaatgttt gattcctttg
     7981 ttaatagttt cgtctcgctg tataatgtca cacgcgataa gttggaaaaa cttatctcta
     8041 ctgctcgtga tggcgtaagg cgaggcgata acttccatag tgtcttaaca acattcattg
     8101 acgcagcacg aggccccgca ggtgtggagt ctgatgttga gaccaatgaa attgttgact
     8161 ctgtgcagta tgctcataaa catgacatac aaattactaa tgagagttac aataattatg
     8221 taccctcata tgttaaacct gatagtgtgt ctaccagtga tttaggtagt ctcattgatt
     8281 gtaatgcggc ttcagttaac caaattgtct tgcgtaattc taatggtgct tgtatttgga
     8341 acgctgctgc atatatgaaa ctctcggatg cacttaaacg acagattcgc attgcatgcc
     8401 gtaagtgtaa tttagctttc cggttaacca cctcaaagct acgcgctaat gataatatct
     8461 tatcagttag attcactgct aacaaaattg ttggtggtgc tcctacatgg tttaatgtgt
     8521 tgcgtgactt tacgttaaag ggttacgttc ttgctaccat tattgtgttt ctgtgtgctg
     8581 tactgatgta tttgtgttta cctacatttt ctatggtacc tgttgaattt tatgaagacc
     8641 gcatcttgga ctttaaagtt cttgataatg gtatcattag ggatgtaaat cctgatgata
     8701 agtgctttgc taataagcac cggtccttca cacaatggta tcatgagcat gttggtggtg
     8761 tctatgacaa ctctatcaca tgcccattga cagttgcagt aattgctgga gttgctggtg
     8821 ctcgcattcc agacgtacct actacattgg cttgggtgaa caatcagata attttctttg
     8881 tttctcgagt ctttgctaat acaggcagtg tttgctacac tcctatagat gagataccct
     8941 ataagagttt ctctgatagt ggttgcattc ttccatctga gtgcactatg tttagggatg
     9001 cagagggccg tatgacacca tactgccatg atcctactgt tttgcctggg gcttttgcgt
     9061 acagtcagat gaggcctcat gttcgttacg acttgtatga tggtaacatg tttattaaat
     9121 ttcctgaagt agtatttgaa agtacactta ggattactag aactctgtca actcagtact
     9181 gccggttcgg tagttgtgag tatgcacaag agggtgtttg tattaccaca aatggctcgt
     9241 gggccatttt taatgaccac catcttaata gacctggtgt ctattgtggt tctgatttta
     9301 ttgacattgt caggcggtta gcagtatcac tgttccagcc tattacttat ttccaattga
     9361 ctacctcatt ggtcttgggt ataggtttgt gtgcattcct gactttgctc ttttattata
     9421 ttaataaagt aaaacgtgct tttgcagatt acacccagtg tgctgtaatt gctgttgttg
     9481 ctgctgttct taatagcttg tgcatctgct ttgttgcctc tataccattg tgtatagtac
     9541 cttacactgc attgtactat tatgctacat tctattttac taatgagcct gcatttatta
     9601 tgcatgtttc ttggtacatt atgttcgggc ctatcgttcc catatggatg acctgcgtct
     9661 atacagttgc aatgtgcttt agacacttct tctgggtttt agcttatttt agtaagaaac
     9721 atgtagaagt ttttactgat ggtaagctta attgtagttt ccaggacgct gcctctaata
     9781 tctttgttat taacaaggac acttatgcag ctcttagaaa ctctttaact aatgatgcct
     9841 attcacgatt tttggggttg tttaacaagt ataagtactt ctctggtgct atggaaacag
     9901 ccgcttatcg tgaagctgca gcatgtcatc ttgctaaagc cttacaaaca tacagcgaga
     9961 ctggtagtga tcttctttac caaccaccca actgtagcat aacctctggc gtgttgcaaa
    10021 gcggtttggt gaaaatgtca catcccagtg gagatgttga ggcttgtatg gttcaggtta
    10081 cctgcggtag catgactctt aatggtcttt ggcttgacaa cacagtctgg tgcccacgac
    10141 acgtaatgtg cccggctgac cagttgtctg atcctaatta tgatgccttg ttgatttcta
    10201 tgactaatca tagtttcagt gtgcaaaaac acattggcgc tccagcaaac ttgcgtgttg
    10261 ttggtcatgc catgcaaggc actcttttga agttgactgt cgatgttgct aaccctagca
    10321 ctccagccta cacttttaca acagtgaaac ctggcgcagc atttagtgtg ttagcatgct
    10381 ataatggtcg tccgactggt acattcactg ttgtaatgcg ccctaactac acaattaagg
    10441 gttcctttct gtgtggttct tgtggtagtg ttggttacac caaggagggt agtgtgatca
    10501 atttttgtta catgcatcaa atggaacttg ctaatggtac acataccggt tcagcatttg
    10561 atggtactat gtatggtgcc tttatggata aacaagtgca ccaagttcag ttaacagaca
    10621 aatactgcag tgttaatgta gtagcttggc tttacgcagc aatacttaat ggttgcgctt
    10681 ggtttgtaaa acctaatcgc actagtgttg tttcttttaa tgaatgggct cttgccaacc
    10741 aattcactga atttgttggc actcaatccg ttgacatgtt agctgtcaaa acaggcgttg
    10801 ctattgaaca gctgctttat gcgatccaac aactttatac tgggttccag ggaaagcaaa
    10861 tccttggcag tactatgttg gaagatgaat tcacacctga ggatgttaat atgcagatta
    10921 tgggtgtggt tatgcagagt ggtgtgagaa aagttacata tggtactgcg cattggttgt
    10981 tcgcgaccct tgtctcaacc tatgtgataa tcttacaagc cactaaattt actttgtgga
    11041 actacttgtt tgagactatt cccacacagt tgttcccact cttatttgtg actatggcct
    11101 tcgttatgtt gttggttaaa cacaaacaca cctttttgac acttttcttg ttgcctgtgg
    11161 ctatttgttt gacttatgca aacatagtct acgagcccac tactcccatt tcgtcagcgc
    11221 tgattgcagt tgcaaattgg cttgccccca ctaatgctta tatgcgcact acacatactg
    11281 atattggtgt ctacattagt atgtcacttg tattagtcat tgtagtgaag agattgtaca
    11341 acccatcact ttctaacttt gcgttagcat tgtgcagtgg tgtaatgtgg ttgtacactt
    11401 atagcattgg agaagcctca agccccattg cctatctggt ttttgtcact acactcacta
    11461 gtgattatac gattacagtc tttgttactg tcaaccttgc aaaagtttgc acttatgcca
    11521 tctttgctta ctcaccacag cttacacttg tgtttccgga agtgaagatg atacttttat
    11581 tatacacatg tttaggtttc atgtgtactt gctattttgg tgtcttctct cttttgaacc
    11641 ttaagcttag agcacctatg ggtgtctatg actttaaggt ctcaacacaa gagttcagat
    11701 tcatgactgc taacaatcta actgcaccta gaaattcttg ggaggctatg gctctgaact
    11761 ttaagttaat aggtattggc ggtacacctt gtataaaggt tgctgctatg cagtctaaac
    11821 ttacagatct taaatgcaca tctgtggttc tcctctctgt gctccaacag ttacacttag
    11881 aggctaatag tagggcctgg gctttctgtg ttaaatgcca taatgatata ttggcagcaa
    11941 cagaccccag tgaggctttc gagaaattcg taagtctctt tgccacttta atgacttttt
    12001 ctggtaatgt agatcttgat gcgttagcta gtgatatttt tgacactcct agcgtacttc
    12061 aagctactct ttctgagttt tcacacttag ctacctttgc tgagttggaa gctgcgcaga
    12121 aagcctatca ggaagctatg gactctggtg acacctcacc acaagttctt aaggctttgc
    12181 agaaggctgt taatatagct aaaaacgcct atgagaagga taaggcagtg gcccgtaagt
    12241 tagaacgtat ggctgatcag gctatgactt ctatgtataa gcaagcacgt gctgaagaca
    12301 agaaagcaaa aattgtcagt gctatgcaaa ctatgttgtt tggtatgatt aagaagctcg
    12361 acaacgatgt tcttaatggt atcatttcta acgctaggaa tggttgtata cctcttagtg
    12421 tcattccact gtgtgcttca aataaacttc gcgttgtaat tcctgacttc accgtctgga
    12481 atcaggtagt cacatatccc tcgcttaact acgctggggc tttgtgggac attacagtta
    12541 taaacaatgt ggacaatgaa attgttaagt cttcagatgt tgtagacagc aatgaaaatt
    12601 taacatggcc acttgtttta gaatgcacta gggcatccac ttctgccgtt aagttgcaaa
    12661 ataatgagat caaaccttca ggtttaaaaa ccatggttgt gtctgcaggt caagagcaaa
    12721 ctaactgtaa tactagttcc ttagcttatt acgaacctgt gcagggtcgt aaaatgctga
    12781 tggctcttct ttctgataat gcctatctca aatgggcgcg tgttgaaggt aaggacggat
    12841 ttgttagtgt agagctacaa cctccttgca aattcttgat tgcgggacca aaaggacctg
    12901 aaatccgata tctctatttt gttaaaaatc ttaacaacct tcatcgcggg caagtgttag
    12961 ggcacattgc tgcgactgtt agattgcaag ctggttctaa caccgagttt gcctctaatt
    13021 cttcggtgtt gtcacttgtt aacttcaccg ttgatcctca aaaagcttat ctcgatttcg
    13081 tcaatgcggg aggtgcccca ttgacaaatt gtgttaagat gcttactcct aaaactggta
    13141 caggtatagc tatatctgtt aaaccagaga gtacagctga tcaagagact tatggtggag
    13201 cttcagtgtg tctctattgc cgtgcgcata tagaacatcc tgatgtctct ggtgtttgta
    13261 aatataaggg taagtttgtc caaatccctg ctcagtgtgt ccgtgaccct gtgggatttt
    13321 gtttgtcaaa taccccctgt aatgtctgtc aatattggat tggatatggg tgcaattgtg
    13381 actcgcttag gcaagtagca ctgccccaat ctaaagattc caatttttta aacgagtccg
    13441 gggttctatt gtaaatgccc gaatagaacc ctgttcaagt ggtttgtcca ctgatgtcgt
    13501 ctttagggca tttgacatct gcaactataa ggctaaggtt gctggtattg gaaaatacta
    13561 caagactaat acttgtaggt ttgtagaatt agatgaccaa gggcatcatt tagactccta
    13621 ttttgtcgtt aagaggcata ctatggagaa ttatgaacta gagaagcact gttacgattt
    13681 gttacgtgac tgtgatgctg tagctcccca tgatttcttc atctttgatg tagacaaagt
    13741 taaaacacct catattgtac gtcagcgttt aactgagtac actatgatgg atcttgtata
    13801 tgccctgagg cactttgatc aaaatagcga agtgcttaag gctatcttag tgaagtatgg
    13861 ttgctgtgat gttacctact ttgaaaataa actctggttt gattttgttg aaaatcccag
    13921 tgttattggt gtttatcata aacttggaga acgtgtacgc caagctatct taaacactgt
    13981 taaattttgt gaccacatgg tcaaggctgg tttagtcggt gtgctcacac tagacaacca
    14041 ggaccttaat ggcaagtggt atgattttgg tgacttcgta atcactcaac ctggttcagg
    14101 agtagctata gttgatagct actattctta tttgatgcct gtgctctcaa tgaccgattg
    14161 tctggccgct gagacacata gggattgtga ttttaataaa ccactcattg agtggccact
    14221 tactgagtat gattttactg attataaggt acaactcttt gagaagtact ttaaatattg
    14281 ggatcagacg tatcacgcaa attgcgttaa ttgtactgat gaccgttgtg tgttacattg
    14341 tgctaatttc aatgtattgt ttgctatgac catgcctaag acttgtttcg gacccatagt
    14401 ccgaaagatc tttgttgatg gcgtgccatt tgtagtatct tgtggttatc actacaaaga
    14461 attaggttta gtcatgaata tggatgttag tctccataga cataggctct ctcttaaaga
    14521 gttgatgatg tatgccgctg atccagccat gcacattgcc tcctctaacg cttttcttga
    14581 tttgaggaca tcatgtttta gtgtcgctgc acttacaact ggtttgactt ttcaaactgt
    14641 gcggcctggc aattttaacc aagacttcta tgatttcgtg gtatctaaag gtttttttaa
    14701 ggagggctct tcagttacgc tcaaacattt tttctttgct caagatggta atgctgctat
    14761 tacagattat aattactatt cttataatct gcctactatg tgtgacatca aacaaatgtt
    14821 gttctgcatg gaagttgtaa acaagtactt cgaaatctat gacggtggtt gtcttaatgc
    14881 ttctgaagtg gttgttaata atttagacaa gagtgctggc catcctttta ataagtttgg
    14941 caaagctcgt gtctattatg agagcatgtc ttaccaggag caagatgaac tctttgccat
    15001 gacaaagcgt aacgtcattc ctaccatgac tcaaatgaat ctaaaatatg ctattagtgc
    15061 taagaataga gctcgcactg ttgcaggcgt gtccatactt agcacaatga ctaatcgtca
    15121 gtaccatcag aaaatgctta agtccatggc tgcaactcgt ggagcgactt gcgtcattgg
    15181 tactacaaag ttctatggtg gctgggattt catgcttaaa acattgtaca aagatgttga
    15241 taatccgcat cttatgggtt gggattaccc taagtgtgat agagctatgc ctaatatgtg
    15301 tagaatcttt gcttcactca tattagctcg taaacatggc acttgttgta ctacaaggga
    15361 cagattttat cgcttggcaa atgagtgtgc tcaggtgcta agcgaatatg ttctatgtgg
    15421 tggtggttac tacgtcaaac ctggaggtac cagtagcgga gacgccacca ctgcatatgc
    15481 caatagtgtc tttaacattt tgcaggcgac aactgctaat gtcagtgcac ttatgggtgc
    15541 taatggcaac aagattgttg acaaagaagt taaagacatg cagtttgatt tgtatgtcaa
    15601 tgtttacagg agcactagcc cagaccccaa atttgttgat aaatactatg cttttcttaa
    15661 taagcacttt tctatgatga tactgtctga tgacggtgtc gtttgctata atagtgatta
    15721 tgcagctaag ggttacattg ctggaataca gaattttaag gaaacgctgt attatcagaa
    15781 caatgtcttt atgtctgaag ctaaatgctg ggtggaaacc gatctgaaga aagggccaca
    15841 tgaattctgt tcacagcata cgctttatat taaggatggc gacgatggtt acttccttcc
    15901 ttatccagac ccttcaagaa ttttgtctgc cggttgcttt gtagatgata tcgttaagac
    15961 tgacggtaca ctcatggtag agcggtttgt gtctttggct atagatgctt accctctcac
    16021 aaagcatgaa gatatagaat accagaatgt attctgggtc tacttacagt atatagaaaa
    16081 actgtataaa gaccttacag gacacatgct tgacagttat tctgtcatgc tatgtggtga
    16141 taattctgct aagttttggg aagaggcatt ctatagagat ctctatagtt cgcctaccac
    16201 tttgcaggct gtcggttcat gcgttgtatg ccattcacag acttccctac gctgtgggac
    16261 atgcatccgt agaccatttc tctgctgtaa atgctgctat gatcatgtta tagcaactcc
    16321 acataagatg gttttgtctg tttctcctta cgtttgtaat gcccctggtt gtggcgtttc
    16381 agacgttact aagctatatt taggtggtat gagctacttt tgtgtagatc atagacctgt
    16441 gtgtagtttt ccactttgcg ctaatggtct tgtattcggc ttatacaaga atatgtgcac
    16501 aggtagtcct tctatagttg aatttaatag gttggctacc tgtgactgga ctgaaagtgg
    16561 tgattacacc cttgccaata ctacaacaga accactcaaa ctttttgctg ctgagacttt
    16621 acgtgccact gaagaggcgt ctaagcagtc ttatgctatt gccaccatca aagaaattgt
    16681 tggtgagcgc caactattac ttgtgtggga ggctggcaag tccaaaccac cactcaatcg
    16741 taattatgtt tttactggtt atcatataac caaaaatagt aaagtgcagc tcggtgagta
    16801 catcttcgag cgcattgatt atagtgatgc tgtatcctac aagtctagta caacgtataa
    16861 actgactgta ggtgacatct tcgtacttac ctcccactct gtggctacct tgacggcgcc
    16921 cacaattgtg aatcaagaga ggtatgttaa aattactggg ttgtacccaa ccattacggt
    16981 acctgaagag ttcgcaagtc atgttgccaa cttccaaaaa tcaggttata gtaaatatgt
    17041 cactgttcag ggaccacctg gcactggcaa aagtcatttt gctatagggt tagcgattta
    17101 ctaccctaca gcacgtgttg tttatacagc atgttcacac gcagctgttg atgctttgtg
    17161 tgaaaaagct tttaaatatt tgaacattgc taaatgttcc cgtatcattc ctgcaaaggc
    17221 acgtgttgag tgctatgaca ggtttaaagt taatgagaca aattctcaat atttgtttag
    17281 tactattaat gctctaccag aaacttctgc cgatattctg gtggttgatg aggttagtat
    17341 gtgcactaat tatgatcttt caattattaa tgcacgtatt aaagctaagc acattgtcta
    17401 tgtaggagat ccagcacagt tgccagctcc taggactttg ttgactagag gcacattgga
    17461 accagaaaat ttcaatagtg tcactagatt gatgtgtaac ttaggtcctg acatattttt
    17521 aagtatgtgc tacaggtgtc ctaaggaaat agtaagcact gtgagcgctc ttgtctacaa
    17581 taataaattg ttagccaaga aggagctttc aggccagtgc tttaaaatac tctataaggg
    17641 caatgtgacg catgatgcta gctctgccat taatagacca caactcacat ttgtgaagaa
    17701 ttttattact gccaatccgg catggagtaa ggcagtcttt atttcgcctt ataattcaca
    17761 gaatgctgtg gctcgttcaa tgctgggcct tactactcag actgttgatt cctcacaggg
    17821 ttcagaatac cagtacgtta tcttctgtca aacagcagat acggcacatg ctaacaacat
    17881 taacagattt aatgttgcaa tcactcgtgc ccaaaaaggt attctttgtg ttatgacatc
    17941 tcaggcactc tttgagtcct tagagtttac tgaattgtct tttactaatt acaagctcca
    18001 gtctcagatt gtaactggcc tttttaaaga ttgctctaga gaaacttctg gcctctcacc
    18061 tgcttatgca ccaacatacg ttagtgttga tgacaagtat aagacgagtg atgagctttg
    18121 cgtgaatctt aatttacccg caaatgtccc atactctcgt gttatttcca ggatgggctt
    18181 taaactcgat gcaacagttc ctggatatcc taagcttttc attactcgtg aagaggctgt
    18241 aaggcaagtt cgaagctgga taggcttcga tgttgagggt gctcatgctt cccgtaatgc
    18301 atgtggcacc aatgtgcctc tacaattagg attttcaact ggtgtgaact ttgttgttca
    18361 gccagttggt gttgtagaca ctgagtgggg taacatgtta acgggcattg ctgcccgtcc
    18421 tccaccaggt gaacagttta agcacctcgt gcctcttatg cataaggggg ctgcatggcc
    18481 tattgttaga cgacgtatag tgcaaatgtt gtcagacact ttagacaaat tgtctgatta
    18541 ctgtacgttt gtttgttggg ctcatggctt tgaattaacg tctgcatcat acttttgcaa
    18601 gataggtaag gaacagaagt gttgcatgtg caatagacgc gctgcagcgt actcttcacc
    18661 tctgcaatct tatgcctgtt ggactcattc ctgcggttat gattatgtct acaacccttt
    18721 ctttgtcgat gttcaacagt ggggttatgt aggcaatctt gctactaatc acgatcgtta
    18781 ttgctctgtc catcaaggag ctcatgtggc ttctaatgat gcaataatga ctcgttgttt
    18841 agctattcat tcttgtttta tagaacgtgt ggattgggat atagagtatc cttatatctc
    18901 acatgaaaag aaattgaatt cctgttgtag aatcgttgag cgcaacgtcg tacgtgctgc
    18961 tcttcttgcc ggttcatttg acaaagtcta tgatattggc aatcctaaag gaattcctat
    19021 tgttgatgac cctgttgttg attggcatta ttttgatgca cagcccttga ccaggaaggt
    19081 acaacagctt ttctatacag aggacatggc ctcaagattt gctgatgggc tctgcttatt
    19141 ttggaactgt aatgtaccaa aatatcctaa taatgcaatt gtatgcaggt ttgacacacg
    19201 tgtgcattct gagttcaatt tgccaggttg tgatggcggt agtttgtatg ttaacaagca
    19261 cgcttttcat acaccagcat atgatgtgag tgcattccgt gatctgaaac ctttaccatt
    19321 cttttattat tctactacac catgtgaagt gcatggtaat ggtagtatga tagaggatat
    19381 tgattatgta cccctaaaat ctgcagtctg tattacaact tgtaatttag ggggcgctgt
    19441 ttgtaggaag catgctacag agtacagaga gtatatggaa gcatataatc ttgtctctgc
    19501 atcaggtttc cgcctttggt gttataagac ctttgatatt tataatctct ggtctacttt
    19561 tacaaaagtt caaggtttgg aaaacattgc ttttaatgtt gttaaacaag gccattttat
    19621 tggtgttgag ggtgaactac ctgtagctgt agtcaatgat aagatcttca ccaagagtgg
    19681 cgttaatgac atttgtatgt ttgagaataa aaccactttg cctactaata tagcttttga
    19741 actctatgct aagcgtgctg tacgctcgca tcccgatttc aaattgctac acaatttaca
    19801 agcagacatt tgctacaagt tcgtcctttg ggattatgaa cgtagcaata tttatggtac
    19861 tgctactatt ggtgtatgta agtacactga tattgatgtt aattcagctt tgaatatatg
    19921 ttttgacata cgcgataatg gttcattgga gaagttcatg tctactccca atgccatctt
    19981 tatttctgat agaaaaatca agaaataccc ttgtatggta ggtcctgatt atgcttactt
    20041 caatggtgct atcatccgtg atggtgatgt tgttaaacaa ccagtgaagt tctacttgta
    20101 taagaaagtc aataatgagt ttattgatcc tactgagtgt atttacactc agagtcgctc
    20161 ttgtagtgac ttcctacccc tgtctgacat ggagaaagac tttctatctt ttgatagtga
    20221 tgttttcatt aagaagtatg gcttggaaaa ctatgctttt gagcacgtag tctatggaga
    20281 cttctctcat actacgttag gcggtcttca cttgcttatt ggtttataca agaagcaaca
    20341 ggaaggtcat attattatgg aagaaatgct aaaaggtagc tcaactattc ataactattt
    20401 tattactgag actaacacag cggcttttaa ggcggtgtgt tctgttatag atttaaagct
    20461 tgacgacttt gttatgattt taaagagtca agaccttggc gtagtatcca aggttgtcaa
    20521 ggttcctatt gacttaacaa tgattgagtt tatgttatgg tgtaaggatg gacaggttca
    20581 aaccttctac cctcgactcc aggcttctgc agattggaaa cctggtcatg caatgccatc
    20641 cctctttaaa gttcaaaatg taaaccttga acgttgtgag cttgctaatt acaagcaatc
    20701 tattcctatg cctcgcggtg tgcacatgaa catcgctaaa tatatgcaat tgtgccagta
    20761 tttaaatact tgcacattag ccgtgcctgc caatatgcgt gttatacatt ttggcgctgg
    20821 ttctgataaa ggtatcgctc ctggtacatc agttttacga cagtggcttc ctacagatgc
    20881 cattattata gataatgatt taaatgagtt cgtgtcagat gctgacataa ctttatttgg
    20941 agattgtgta actgtacgtg tcggccaaca agtggatctt gttatttccg acatgtatga
    21001 tcctactact aagaatgtaa caggtagtaa tgagtcaaag gctttattct ttacttacct
    21061 gtgtaacctc attaataata atcttgctct tggtggttct gttgctatta aaataacaga
    21121 acactcttgg agcgttgaac tttatgaact tatgggaaaa tttgcttggt ggactgtttt
    21181 ctgcaccaat gcaaatgcat cctcatctga aggattcctt ttaggtatta attacttggg
    21241 tactattaaa gaaaatatag atggtggtgc tatgcacgcc aactatatat tttggagaaa
    21301 ttccactcct atgaatctga gtacttactc actttttgat ttatccaagt ttcaattaaa
    21361 attaaaagga acaccagttc ttcaattaaa ggagagtcaa attaacgaac tcgtaatatc
    21421 tctcctgtcg cagggtaagt tacttatccg tgacaatgat acactcagtg tttctactga
    21481 tgttcttgtt aacacctaca gaaagttacg ttgatgtagg gccagattct gttaagtctg
    21541 cttgtattga ggttgatata caacagacct tctttgataa aacttggcct aggccaattg
    21601 atgtttctaa ggctgacggt attatatacc ctcaaggccg tacatattct aacataacta
    21661 tcacttatca aggtcttttt ccctatcagg gagaccatgg tgatatgtat gtttactctg
    21721 caggacatgc tacaggcaca actccaaaaa agttgtttgt agctaactat tctcaggacg
    21781 tcaaacagtt tgctaatggg tttgtcgtcc gtataggagc agctgccaat tccactggca
    21841 ctgttattat tagcccatct accagcgcta ctatacgaaa aatttaccct gcttttatgc
    21901 tgggttcttc agttggtaat ttctcagatg gtaaaatggg ccgcttcttc aatcatactc
    21961 tagttctttt gcccgatgga tgtggcactt tacttagagc tttttattgt attctagagc
    22021 ctcgctctgg aaatcattgt cctgctggca attcctatac ttcttttgcc acttatcaca
    22081 ctcctgcaac agattgttct gatggcaatt acaatcgtaa tgccagtctg aactctttta
    22141 aggagtattt taatttacgt aactgcacct ttatgtacac ttataacatt accgaagatg
    22201 agattttaga gtggtttggc attacacaaa ctgctcaagg tgttcacctc ttctcatctc
    22261 ggtatgttga tttgtacggc ggcaatatgt ttcaatttgc caccttgcct gtttatgata
    22321 ctattaagta ttattctatc attcctcaca gtattcgttc tatccaaagt gatagaaaag
    22381 cttgggctgc cttctacgta tataaacttc aaccgttaac tttcctgttg gatttttctg
    22441 ttgatggtta tatacgcaga gctatagact gtggttttaa tgatttgtca caactccact
    22501 gctcatatga atccttcgat gttgaatctg gagtttattc agtttcgtct ttcgaagcaa
    22561 taccttctgg ctcagttgtg gaacaggctg aaggtgttga atgtgatttt tcacctcttc
    22621 tgtctggcac acctcctcag gtttataatt tcaagcgttt ggtttttacc aattgcaatt
    22681 ataatcttac caaattgctt tcactttttt ctgtgaatga ttttacttgt agtcaaatat
    22741 ctccagcagc aattgctagc aactgttatt cttcactgat tttggattat ttttcatacc
    22801 cacttagtat gaaatccgat ctcagtgtta gttctgctgg tccaatatcc cagtttaatt
    22861 ataaacagtc cttttctaat cccacatgtt tgatcttagc gactgttcct cataacctta
    22921 ctactattac taagcctctt aagtacagct atattaacaa gtgctctcgt cttctttctg
    22981 atgatcgtac tgaagtacct cagttagtga acgctaatca atactcaccc tgtgtatcca
    23041 ttgtcccatc cactgtgtgg gaagacggtg attattatag gaaacaacta tctccacttg
    23101 aaggtggtgg ctggcttgtt gctagtggct caactgttgc catgactgag caattacaga
    23161 tgggctttgg tattacagtt caatatggta cagacaccaa tagtgtttgc cccaagcttg
    23221 aatttgctaa tgacacaaaa attgcctctc aattaggcaa ttgcgtggaa tattccctct
    23281 atggtgtttc gggccgtggt gtttttcaga attgcacagc tgtaggtgtt cgacagcagc
    23341 gctttgttta tgatgcgtac cataatttag ttggctatta ttctgatgat ggcaactact
    23401 actgtctgcg tgcttgtgtt agtgttcctg tttctgtcat ctatgataaa gaaactaaaa
    23461 cccacgctac tctatttggt agtgttgcat gtgaacacat ttcttctacc atgtctcaat
    23521 actcccgttc tacgcgatca atgcttaaac ggcgagattc tacatatggc ccccttcaga
    23581 cacctgttgg ttgtgtccta ggacttgtta attcctcttt gttcgtagag gactgcaagt
    23641 tgcctctcgg tcaatctctc tgtgctcttc ctgacacacc tagtactctc acacctcgca
    23701 gtgtgcgctc tgtgccaggt gaaatgcgct tggcatccat tgcttttaat catcccattc
    23761 aggttgatca acttaatagt agttatttta aattaagtat acccactaat ttttcctttg
    23821 gtgtgactca ggagtacatt cagacaacca ttcagaaagt tactgttgat tgtaaacagt
    23881 acgtttgcaa tggtttccag aagtgtgagc aattactgcg cgagtatggc cagttttgtt
    23941 ccaaaataaa ccaggctctc catggtgcca atttacgcca ggatgattct gtacgtaatt
    24001 tgtttgcgag cgtgaaaagc tctcaatcat ctcctatcat accaggtttt ggaggtgact
    24061 ttaatttgac acttctagaa cctgtttcta tatctactgg cagtcgtagt gcacgtagtg
    24121 ctattgagga tttgctattt gacaaagtca ctatagctga tcctggttat atgcaaggtt
    24181 acgatgattg tatgcagcaa ggtccagcat cagctcgtga tcttatttgt gctcaatatg
    24241 tggctggtta taaagtatta cctcctctta tggatgttaa tatggaagcc gcgtatactt
    24301 catctttgct tggcagcata gcaggtgttg gctggactgc tggcttatcc tcctttgctg
    24361 ctattccatt tgcacagagt attttttata ggttaaacgg tgttggcatt actcaacagg
    24421 ttctttcaga gaaccaaaag cttattgcca ataagtttaa tcaggctctg ggagctatgc
    24481 aaacaggctt cactacaact aatgaagctt ttcggaaggt tcaggatgct gtgaacaaca
    24541 atgcacaggc tctatccaaa ttagctagcg agctatctaa tacttttggt gctatttccg
    24601 cctctattgg agacatcata caacgtcttg atgttctcga acaggacgcc caaatagaca
    24661 gacttattaa tggccgtttg acaacactaa atgcttttgt tgcacagcag cttgttcgtt
    24721 ccgaatcagc tgctctttcc gctcaattgg ctaaagataa agtcaatgag tgtgtcaagg
    24781 cacaatccaa gcgttctgga ttttgcggtc aaggcacaca tatagtgtcc tttgttgtaa
    24841 atgcccctaa tggcctttac tttatgcatg ttggttatta ccctagcaac cacattgagg
    24901 ttgtttctgc ttatggtctt tgcgatgcag ctaaccctac taattgtata gcccctgtta
    24961 atggctactt tattaaaact aataacacta ggattgttga tgagtggtca tatactggct
    25021 cgtccttcta tgcacctgag cccatcacct ctcttaatac taagtatgtt gcaccacagg
    25081 tgacatacca aaacatttct actaacctcc ctcctcctct tctcagcaat tccaccggga
    25141 ttgacttcca agatgagttg gatgagtttt tcaaaaatgt tagcaccagt atacctaatt
    25201 ttggttctct aacacagatt aatactacat tactcgatct tacctacgag atgttgtctc
    25261 ttcaacaagt tgttaaagcc cttaatgagt cttatataga ccttaaagag cttggcaatt
    25321 atacttatta caacaaatgg ccgtggtaca tttggcttgg tttcattgct gggcttgttg
    25381 ccttagctct atgcgtcttc ttcatactgt gctgcactgg ttgtggcaca aactgtatgg
    25441 gaaaacttaa gtgtaatcgt tgttgtgata gatacgagga atacgacctc gagccgcata
    25501 aggttcatgt tcactaatta acgaactatc aatgagagtt caaagaccac ccactctctt
    25561 gttagtgttc tcactctctc ttttggtcac tgcattttca aaacctctct atgtacccga
    25621 gcattgtcag aattattctg gttgcatgct tagggcttgt attaaaactg cccaagctga
    25681 tacagctggt ctttatacaa attttcgaat tgacgtccca tctgcagaat caactggtac
    25741 tcaatcagtt tctgtcgatc gtgagtcaac ttcaactcat gatggtccta ccgaacatgt
    25801 tactagtgtg aatctttttg acgttggtta ctcagttaat taacgaactc tatggattac
    25861 gtgtctctgc ttaatcaaat ttggcagaag taccttaatt caccgtatac tacttgtttg
    25921 tatatcccta aacccacagc taagtataca cctttagttg gcacttcatt gcaccctgtg
    25981 ctgtggaact gtcagctatc ctttgctggt tatactgaat ctgctgttaa ttctacaaaa
    26041 gctttggcca aacaggacgc agctcagcga atcgcttggt tgctacataa ggatggagga
    26101 atccctgatg gatgttccct ctacctccgg cactcaagtt tattcgcgca aagcgaggaa
    26161 gaggagtcat tctccaacta agaaactgcg ctacgttaag cgtagatttt ctcttctgcg
    26221 ccctgaagac cttagtgtta ttgtccaacc aacacactat gtcagggtta cattttcaga
    26281 ccccaacatg tggtatctac gttcgggtca tcatttacac tcagttcaca attggcttaa
    26341 accttatggc ggccaacctg tttctgagta ccatattact ctagctttgc taaatctcac
    26401 tgatgaagat ttagctagag atttttcacc cattgcgctc tttttgcgca atgtcagatt
    26461 tgagctacat gagttcgcct tgctgcgcaa aactcttgtt cttaatgcat cagagatcta
    26521 ctgtgctaac atacatagat ttaagcctgt gtatagagtt aacacggcaa tccctactat
    26581 taaggattgg cttctcgttc agggattttc cctttaccat agtggcctcc ctttacatat
    26641 gtcaatctct aaattgcatg cactggatga tgttactcgc aattacatca ttacaatgcc
    26701 atgctttaga acttatcctc aacaaatgtt tgttactcct ttggccgtag atgttgtctc
    26761 catacggtct tccaatcagg gtaataaaca aattgttcat tcttacccca ttttacatca
    26821 tccaggattt taacgaacta tggctttctc ggcgtcttta tttaaacccg tccagctagt
    26881 cccagtttct cctgcatttc atcgcattga gtctactgac tctattgttt tcacatacat
    26941 tcctgctagc ggctatgtag ctgctttagc tgtcaatgtg tgtctcattc ccctattatt
    27001 actgctacgt caagatactt gtcgtcgcag cattatcaga actatggttc tctatttcct
    27061 tgttctgtat aactttttat tagccattgt actagtcaat ggtgtacatt atccaactgg
    27121 aagttgcctg atagccttct tagttatcct cataatactt tggtttgtag atagaattcg
    27181 tttctgtctc atgctgaatt cctacattcc actgtttgac atgcgttctc actttattcg
    27241 tgttagtaca gtttcttctc atggtatggt ccctgtcata cacaccaaac cattatttat
    27301 tagaaacttc gatcagcgtt gcagctgttc tcgttgtttt tatttgcact cttccactta
    27361 tatagagtgc acttatatta gccgttttag taagattagc ctagtttctg taactgactt
    27421 ctccttaaac ggcaatgttt ccactgtttt cgtgcctgca acgcgcgatt cagttcctct
    27481 tcacataatc gccccgagct cgcttatcgt ttaagcagct ctgcgctact atgggtcccg
    27541 tgtagaggct aatccattag tctctctttg gacatatgga aaacgaacta tgttaccctt
    27601 tgtccaagaa cgaatagggt tgttcatagt aaactttttc atttttaccg tagtatgtgc
    27661 tataacactc ttggtgtgta tggctttcct tacggctact agattatgtg tgcaatgtat
    27721 gacaggcttc aataccctgt tagttcagcc cgcattatac ttgtataata ctggacgttc
    27781 agtctatgta aaattccagg atagtaaacc ccctctacca cctgacgagt gggtttaacg
    27841 aactccttca taatgtctaa tatgacgcaa ctcactgagg cgcagattat tgccattatt
    27901 aaagactgga actttgcatg gtccctgatc tttctcttaa ttactatcgt actacagtat
    27961 ggatacccat cccgtagtat gactgtctat gtctttaaaa tgtttgtttt atggctccta
    28021 tggccatctt ccatggcgct atcaatattt agcgccattt atccaattga tctagcttcc
    28081 cagataatct ctggcattgt agcagctgtt tcagctatga tgtggatttc ctactttgtg
    28141 cagagtatcc ggctgtttat gagaactgga tcatggtggt cattcaatcc tgagactaat
    28201 tgccttttga acgttccatt tggtggtaca actgtcgtac gtccactcgt agaggactct
    28261 accagtgtaa ctgctgttgt aaccaatggc cacctcaaaa tggctggcat gcatttcggt
    28321 gcttgtgact acgacagact tcctaatgaa gtcaccgtgg ccaaacccaa tgtgctgatt
    28381 gctttaaaaa tggtgaagcg gcaaagctac ggaactaatt ccggcgttgc catttaccat
    28441 agatataagg caggtaatta caggagtccg cctattacgg cggatattga acttgcattg
    28501 cttcgagctt aggctcttta gtaagagtat cttaattgat tttaacgaat ctcaatttca
    28561 ttgttatggc atcccctgct gcacctcgtg ctgtttcctt tgccgataac aatgatataa
    28621 caaatacaaa cctgtctcga ggtagaggac gtaatccaaa accacgagct gcaccaaata
    28681 acactgtctc ttggtacact gggcttaccc aacacgggaa agtccctctt acctttccac
    28741 ctgggcaggg tgtacctctt aatgccaatt ccacccctgc gcaaaatgct gggtattggc
    28801 ggagacagga cagaaaaatt aataccggga atggaattaa gcaactggct cccaggtggt
    28861 acttctacta cactggaacc ggacccgaag cagcactccc attccgggct gttaaggatg
    28921 gcatcgtttg ggtccatgaa gatggcgcca ctgatgctcc ttcaactttt gggacgcgga
    28981 accctaacaa tgattcagct attgttacac aattcgcgcc cggtactaag cttcctaaaa
    29041 acttccacat tgaggggact ggaggcaata gtcaatcatc ttcaagagcc tctagcgtaa
    29101 gcagaaactc ttccagatct agttcacaag gttcaagatc aggaaactct acccgcggca
    29161 gttctccagg tccatctgga atcggagcag taggaggtga tctactttac cttgatcttc
    29221 tgaacagact acaagccctt gagtctggca aagtaaagca atcgcagcca aaagtaatca
    29281 ctaagaaaga tgctgctgct gctaaaaata agatgcgcca caagcgcact tccaccaaaa
    29341 gtttcaacat ggtgcaagct tttggtcttc gcggaccagg agacctccag ggaaactttg
    29401 gtgatcttca attgaataaa ctcggcactg aggacccacg ttggccccaa attgctgagc
    29461 ttgctcctac agctagtgct tttatgggta tgtcgcaatt taaacttacc catcagaaca
    29521 atgatgatca tggcaaccct gtgtacttcc ttcggtacag tggagccatt aaacttgacc
    29581 caaagaatcc caactacaat aagtggttgg agcttcttga gcaaaatatt gatgcctaca
    29641 aaaccttccc taagaaggaa aagaaacaaa aggcaccaaa agaagaatca acagaccaaa
    29701 tgtctgaacc tccaaaggag cagcgtgtgc aaggtagcat cactcagcgc actcgcaccc
    29761 gtccaagtgt tcagcctggt ccaatgattg atgttaacac tgattagtgt cactcaaagt
    29821 aacaagatcg cggcaatcgt ttgtgtttgg taaccccatc tcaccatcgc ttgtccactc
    29881 ttgcacagaa tggaatcatg ttgtaattac agtgcaataa ggtaattata acccatttaa
    29941 ttgatagcta tgctttatta aagtgtgtag ctgtagagag aatgttaaag actgtcacct
    30001 ctgcgtgatt gcaagtgaac agtgcccccc gggaagagct ctacagtgtg aaatgtaaat
    30061 aaaaatagct attattcaat tagattaggc taattagatg atttgcaaaa aaaaaaa

Share this post


Link to post
Share on other sites
LOCUS       KT368853               30108 bp    RNA     linear   VRL 17-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate
            camel/Jeddah/S100/2014, complete genome.
ACCESSION   KT368853
VERSION     KT368853.1  GI:922058172
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 30108)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Co-circulation of three camel coronavirus species and recombination
            of MERS-CoVs in Saudi Arabia
  JOURNAL   Science (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 30108)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2015) Centre of Influenza Research & State Key
            Laboratory of Emerging Infectious Diseases, The University of Hong
            Kong, Laboratory Block, 21 Sassoon Road, Pokfulam, Hong Kong SAR,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..30108
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="camel/Jeddah/S100/2014"
                     /host="camel"
                     /db_xref="taxon:1335626"
                     /country="Saudi Arabia"
                     /collection_date="Sep-2014"
     gene            279..21514
                     /gene="orf1ab"
     CDS             join(279..13433,13433..21514)
                     /gene="orf1ab"
                     /ribosomal_slippage
                     /codon_start=1
                     /product="polyprotein ORF1ab"
                     /protein_id="ALA49659.1"
                     /db_xref="GI:922058174"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKG
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKDITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTSLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLALAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINRDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
                     RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
                     RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
                     RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
                     KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
                     DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
                     VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
                     RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
                     VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
                     EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
                     MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
                     GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
                     LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
                     NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
                     AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
                     LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
                     YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
                     SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
                     FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
                     PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
                     ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
                     RYVKITGLYPTITVPEEFASHXANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
                     RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
                     NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
                     PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
                     KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
                     SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
                     TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYS
                     RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
                     FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
                     MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
                     WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
                     CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
                     DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
                     VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
                     DIDYVPLKSAVCITTCNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
                     WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
                     TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
                     VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDV
                     VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
                     ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
                     AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
                     RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
                     TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
                     DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
                     TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
                     FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
                     LSVSTDVLVNTYRKLR"
     gene            279..13454
                     /gene="orf1a"
     CDS             279..13454
                     /gene="orf1a"
                     /codon_start=1
                     /product="polyprotein ORF1a"
                     /protein_id="ALA49658.1"
                     /db_xref="GI:922058173"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKG
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKDITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTSLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
                     EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
                     FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
                     TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
                     VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLALAYRANSFDVPTFC
                     ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
                     WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
                     FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
                     DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
                     FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
                     CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
                     DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
                     DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
                     AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
                     YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
                     YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
                     PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
                     FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
                     CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
                     CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
                     IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINRDTY
                     AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
                     QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
                     ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
                     YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
                     FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
                     AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
                     GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
                     KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
                     TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
                     CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
                     LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
                     TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
                     AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
                     LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
                     ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
                     SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
                     NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
                     GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
                     LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
                     VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
                     PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
     gene            21456..25517
                     /gene="S"
     CDS             21456..25517
                     /gene="S"
                     /codon_start=1
                     /product="spike protein"
                     /protein_id="ALA49660.1"
                     /db_xref="GI:922058175"
                     /translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
                     PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
                     ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKFYPAFMLGSSVGNFSDGK
                     MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
                     YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
                     NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
                     RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
                     PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
                     SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
                     DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
                     LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
                     VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
                     SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
                     TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
                     IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
                     QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
                     QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
                     AQSIFYRLNGVGITQQVLSDNQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
                     QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
                     SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
                     IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
                     VAPQVTYQNISTNLPPPLLSNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
                     TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
                     TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
     gene            25532..25843
                     /gene="orf3"
     CDS             25532..25843
                     /gene="orf3"
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="ALA49661.1"
                     /db_xref="GI:922058176"
                     /translation="MRVQRPPTLLLVFSLSLLVTAFSKPLYVPEHCQNYSGCMLRACI
                     KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGPTEHVTSVNLFDVGYSV
                     N"
     gene            25852..26181
                     /gene="orf4a"
     CDS             25852..26181
                     /gene="orf4a"
                     /codon_start=1
                     /product="ORF4a"
                     /protein_id="ALA49662.1"
                     /db_xref="GI:922058177"
                     /translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
                     WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
                     EEESFSN"
     gene            26093..26833
                     /gene="orf4b"
     CDS             26093..26833
                     /gene="orf4b"
                     /codon_start=1
                     /product="ORF4b"
                     /protein_id="ALA49663.1"
                     /db_xref="GI:922058178"
                     /translation="MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
                     EDLSVIVQPTHYVXVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
                     TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
                     PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
                     VDVVSIRSSNQGNKQIVHSYPILHHPGF"
     gene            26840..27514
                     /gene="orf5"
     CDS             26840..27514
                     /gene="orf5"
                     /codon_start=1
                     /product="ORF5"
                     /protein_id="ALA49664.1"
                     /db_xref="GI:922058179"
                     /translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
                     VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
                     ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
                     CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
                     PSSLIV"
     gene            27590..27838
                     /gene="E"
     CDS             27590..27838
                     /gene="E"
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="ALA49665.1"
                     /db_xref="GI:922058180"
                     /translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
                     TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
     gene            27853..28512
                     /gene="M"
     CDS             27853..28512
                     /gene="M"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="ALA49666.1"
                     /db_xref="GI:922058181"
                     /translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
                     VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
                     MRTGSWWSFNPETNCLLNVPFGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
                     DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
                     A"
     gene            28566..29807
                     /gene="N"
     CDS             28566..29807
                     /gene="N"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="ALA49667.1"
                     /db_xref="GI:922058182"
                     /translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
                     TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
                     TGTGPEAALPFRAVKDGIVWVHEHGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
                     HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
                     LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
                     NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
                     IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
                     TQRTRTRPSVQPGPMIDVNTD"
     gene            28762..29100
                     /gene="orf8b"
     CDS             28762..29100
                     /gene="orf8b"
                     /codon_start=1
                     /product="ORF8b"
                     /protein_id="ALA49668.1"
                     /db_xref="GI:922058183"
                     /translation="MPIPPQRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLEPDPKQ
                     HSHSGLLRMASFGSMNMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
                     IVNHLQEPLA"
ORIGIN      
        1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
       61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
      121 gtggcactaa tttgcctgct catctaggca gtggacatat gctcaacact gggtataatt
      181 ctaattgaat actatttttc agttagagcg tcgtgtctct tgtacgtctc ggtcacaata
      241 cacggtttcg tccggtgcgt ggcaattcgg ggcacatcat gtctttcgtg gctggtgtga
      301 tcgcgcaagg tgcgcgcggt acgtatcgag cagcgctcaa ctctgaaaaa catcaagacc
      361 atgtgtctct aactgtgcca ctctgtggtt caggaaacct ggttgaaaaa ctttcaccat
      421 ggttcatgga tggcgaaaat gcctatgaag tggtgaaggc catgttactt aaaaaagagc
      481 cacttctcta tgtgcccatc cggctggctg gacacactag acacctccca ggtcctcgtg
      541 tgtacctggt tgagaggctc attgcttgtg aaaatccatt catggttaac caattggctt
      601 atagctctag tgcaaatggc agcctggttg gcacaacttt gcagggcaag cctattggta
      661 tgttcttccc ttatgacatc gaacttgtca caggaaagca aaatattctc ctgcgcaagt
      721 atggccgtgg tggttatcac tacaccccat tccactatga gcgagacaac acctcttgcc
      781 ctgagtggat ggacgatttt gaggcggatc ctaaaggcaa atatgcccag aatctgctta
      841 agaagttgat tggcggtgat gtcactccag ttgaccaata catgtgtggc gttgatggaa
      901 aacccattag tgcctacgca tttttaatgg ccaaggatgg aataaccaaa ctggctgatg
      961 ttgaagcgga cgtcgcagca cgtgctgatg acgaaggctt catcacatta aagaacaatc
     1021 tatatagatt ggtttggcat gttgagcgta aagacgttcc atatcctaag caatctattt
     1081 ttactattaa tagtgtggtc caaaaggatg gtgttgaaaa cactcctcct cactatttta
     1141 ctcttggatg caaaatttta acgctcaccc cacgcaacaa gtggagtggc gtttctgact
     1201 tgtccctcaa acaaaaactc ctttacacct tctatggtaa ggagtcactt gagaacccaa
     1261 cctacattta ccactccgca ttcattgagt gtggaagttg tggtaatgat tcctggctta
     1321 cagggaatgc tatccaaggg tttgcctgtg gatgtggggc atcatataca gctaatgatg
     1381 tcgaagtcca atcatctggc atgattaagc caaatgctct tctttgtgct acttgcccct
     1441 ttgctaaggg tgacagctgt tcttctaatt gcaaacattc agttgctcag ttggttagtt
     1501 acctttctga acgctgtaat gttattgctg attctaagtc cttcacactt atctttggtg
     1561 gcgtagctta cgcctacttt ggatgtgagg aaggtactat gtactttgtg cctagagcta
     1621 agtctgttgt ctcaaggatt ggagactcca tctttacagg ctgtactggc tcttggaaca
     1681 aggtcactca aattgctaac atgttcttgg aacagactca gcattccctt aactttgtgg
     1741 gagagttcgt tgtcaacgat gttgtcctcg caattctctc tggaaccaca actaatgttg
     1801 acaaaatacg ccagcttctc aaaggtgtca ccattgacaa gttgcgtgat tatttagctg
     1861 actatgacgt agcagtcact gccggcccat tcatggataa tgctattaat gttggtggta
     1921 caggattaca gtatgccgcc attactgcac cttatgtagt tctcactggc ttaggtgagt
     1981 cctttaagaa agttgcaacc ataccgtaca aggtttgcaa ctctgttaag gatactctga
     2041 cttattatgc tcacagcgtg ttgtacagag tttttcctta tgacatggat tctggtgtgt
     2101 catcctttag tgaactactt tttgattgcg ttgatctttc agtagcttct acctattttt
     2161 tagtccgcct cttgcaagat aagactggcg actttatgtc tacaattatt acttcctgcc
     2221 aaactgctgt tagtaagctt ctagatacat gttttgaagc tacagaagca acatttaact
     2281 tcttgttaga tttggcagga ttgttcagaa tctttcttcg caatgcctat gtgtacactt
     2341 cacaagggtt tgtggtggtc aatggcaaag tttctacact tgtcaaacaa gtgttagact
     2401 tgcttaataa gggtatgcaa cttttgcata caaaggtctc ctgggctggt tctaatatca
     2461 gtgctgttat ctacagcggc agggagtctc taatattccc atcgggaacc tattactgtg
     2521 tcaccactaa ggctaagtcc gttcaacaag atcttgacgt tattttgcct ggtgagtttt
     2581 ccaagaagca gttaggactg ctccaaccta ctgacaattc tacaactgtt agtgttactg
     2641 tatccagtaa catggttgaa actgttgtgg gtcaacttga gcaaactaat atgcatagtc
     2701 ctgatgttat agtaggtgac tatgtcatta ttagtgaaaa attgtttgtg cgtagtaagg
     2761 aagaagacgg atttgccttc taccctgctt gcactaatgg tcatgctgta ccgactctct
     2821 ttagacttaa gggaggtgca cctgtaaaaa aagtagcctt tggcggtgat caagtacatg
     2881 aggttgctgc tgtaagaagt gttactgtcg agtacaacat tcatgctgta ttagacacac
     2941 tacttgcttc ttctagtctt agaacctttg ttgtagataa gtctttgtca attgaggagt
     3001 ttgctgacgt agtaaaggga caagtctcag acttgcttgt taaattactg cgtggaatgc
     3061 cgattccaga ttttgattta gacgatttta ttgacgcacc atgctattgc tttaacgctg
     3121 agggtgatgc atcttggtct tctactatga tcttctctct tcaccccgtc gagtgtgacg
     3181 aggagtgttc tgaagtagag gcttcagatt tagaagaagg tgaatcagag tgcatttctg
     3241 agacttcaac tgaacaagtt gacgtttctc atgaggtttc tgacgacgag tgggctgctg
     3301 cagttgatga agcgttcccc ctcgatgaag cagaagatgt tactgaatct gtgcaagaag
     3361 aagcacaacc agtagaagta cctgttgaag atattgcgca ggttgtcata gctgacacct
     3421 tacaggaaac tcctgttgtg tttgatactg ttgaagtccc accgcaagtg gtgaaacttc
     3481 cgtctgaacc tcagactatc cagcccgagg taaaagaagt tgcacctgtc tatgaggctg
     3541 ataccgaaca gacacagagt gttactgtta aacctaagag gttacgcaaa aagcgtaatg
     3601 ttgacccttt gtccaatttt gaacataagg atattacaga gtgcgttacc atagttttag
     3661 gtgacgcaat tcaagtagcc aagtgctatg gggagtctgt gttagttaat gctgctaaca
     3721 cacatcttaa gcatggcggt ggtatcgctg gtgctattaa tgcggcttca aaaggggctg
     3781 tccaaaaaga gtcagatgag tatattctgg ctaaagggcc gttacaagta ggagattcag
     3841 ttctcttgca aggccattct ctagctaaga atatcctgca tgtcgtaggc ccagatgccc
     3901 gcgctaaaca ggatgtttct ctccttagta agtgctataa ggctatgaat gcatatcctc
     3961 ttgtagtcac ttctcttgtt tcagcgggca tatttggtgt aaaaccagct gtgtcttttg
     4021 attatcttat tagagaggct aagactagag ttttagtcgt cgttaattcc caagatgtct
     4081 ataagagtct taccatagtt gacattccac agagtttgac tttttcatat gatgggttac
     4141 gtggcgcaat acgtaaagct aaagattatg gttttactgt ttttgtgtgc acagacaact
     4201 ctgctaacac taaagttctt aggaacaagg gtgttgatta tactaagaag tttcttacag
     4261 ttgacggtgt gcaatattat tgctacacgt ctaaggacac tttagatgat atcttacaac
     4321 aggctaataa gtctgttggt attatatcta tgcctttggg atatgtgtct catggtttag
     4381 acttaattca agcagggagt gtcgtgcgta gagttaacgt gccctacgtg tgtctcctag
     4441 ctaataaaga gcaagaagct attttgatgt ctgaagacgt taagttaaac ccttcagaag
     4501 attttataaa gcacgtccgc actaatggtg gttacaattc ttggcattta gtcgagggtg
     4561 aactattggt gcaagactta cgcttaaata agctcctgca ttggtctgat caaaccatat
     4621 gctacaagga tagtgtgttt tatgttgtaa agaatagtac agcttttcca tttgaaacac
     4681 tttcagcatg tcgtgcgtat ttggattcac gcacgacaca gcagttaaca atcgaagtct
     4741 tagtgactgt cgatggtgta aattttagaa cagtcgttct aaataataag aacacttata
     4801 gatcacagct tggatgcgtt ttctttaatg gtgctgatat ttctgatacc attcctgatg
     4861 agaaacagaa tggtcacagt ttatatctag cagacaattt gactgctgat gaaacaaagg
     4921 cgcttaaaga gttatatggc cccgttgatc ctactttctt acacagattc tattcactta
     4981 aggcagcagt ccatgggtgg aagatggttg tgtgtgataa ggtacgttct ctcaaattga
     5041 gtgataataa ttgttatctt aatgcagtta ttatgacact tgatttattg aaggacatta
     5101 aatttgttat acctgctcta cagcatgcat ttatgaaaca taagggcggt gattcaactg
     5161 acttcatagc cctcattatg gcttatggca attgcacatt tggtgctcca gatgatgcct
     5221 ctcggttact tcacaccgtg cttgcaaagg ctgagttatg ctgttctgca cgcatggttt
     5281 ggagagagtg gtgcaatgtc tgtggcataa aagatgttgt tctacaaggc ttaagagctt
     5341 gttgttacgt gggtgtgcaa actgttgaag atctgcgtgc tcgcatgaca tatgtatgcc
     5401 agtgtggtgg tgaacgtcat cggcaaatag tcgaacacac cactccctgg ttgctgctct
     5461 caggcacacc aaatgaaaaa ttggtgacaa ccttcacggc gcctgatttt gtagcgttta
     5521 atgtctttca gggcattgaa acggctgttg gccattatgt tcatgctcgc ctgaagggtg
     5581 gtcttatttt aaagtttgac tctggcaccg ttagcaagac ttcagactgg aagtgcaagg
     5641 tgacagatgt acttttcccc ggccaaaaat acagtagcga ttgtaatgtc gtacggtatt
     5701 ctttggacgg taatttcaga acagaggttg atcccgacct atctgctttc tatgttaagg
     5761 atggtaaata ctttacaagt gaaccacccg taacatattc accagctaca attttagctg
     5821 gtagtgtcta cactaatagc tgccttgtat cgtctgatgg acaacctggc ggtgatgcta
     5881 ttagtttgag ttttaataac cttttagggt ttgattctag taaaccagtc actaagaaat
     5941 acacttactc cttcttgcct aaagaagacg gcgatgtgtt gttggctgag tttgacactt
     6001 atgaccctat ttataagaat ggtgccatgt ataaaggcaa accaattctt tgggtcaaca
     6061 aagcatctta tgatattaat cttaataagt tcaatagagc tagtttgcgt caaatttttg
     6121 acgtagcccc cattgaactc gaaaataaat tcacaccttt gagtgtggcg tctacaccag
     6181 ttgaacctcc aactgtagat gtggtagcac ttcaacagga aatgacaatt gtcaaatgta
     6241 agggtttaaa taaacctttc gtgaaggaca atgtcagttt cgttgttgat gactcaggta
     6301 ctcccgttgt tgagtatctg tctaaagaag atctacatac attgtatgta gaccctaagt
     6361 atcaagtcat tgtcttaaaa gacaatgtac tttcttctat gcttagattg cacaccgttg
     6421 agtcaggtga tattaacgtt gttgcagctt ccggatcttt gacacgtaaa gtgaagttac
     6481 tatttagggc ttcattttat ttcaaagaat ttgctacccg cactttcact gctaccactg
     6541 ctgtaggtag ttgtataaag agtgtagtgc ggcatctagg tgttactaaa ggcatattga
     6601 caggctgttt tagttttgtc aagatgttat ttatgcttcc actagcttac tttagtgatt
     6661 caaaactcgg caccacagag gttaaagtga gtgctttgaa aacagctggc gttgtgacag
     6721 gtaatgttgt aaaacagtgt tgcactgctg ctgttgattt aagtatggat aagttgcgcc
     6781 gtgtggattg gaaatcaacc ctacggttgt tacttatgtt atgcacaact atggtattgt
     6841 tgtcttctgt gtatcacttg tatgtcttca atcaggtctt atcaagtgat gttatgtttg
     6901 aagatgccca aggtttgaaa aagttctaca aagaagttag agcttaccta ggaatctctt
     6961 ctgcttgtga cggtcttgct ttagcttata gggcgaattc atttgatgta cctacattct
     7021 gcgcaaaccg ttctgcaatg tgtaattggt gcttgattag ccaagattcc ataactcact
     7081 acccagctct taagatggtt caaacacatc ttagccacta tgttcttaac atagattggt
     7141 tgtggtttgc atttgagact ggtttggcat acatgctcta tacctcggcc ttcaactggt
     7201 tgttgttggc aggtacattg cattatttct ttgcacaaac ttccatattt gtagactggc
     7261 ggtcatacaa ttatgctgtg tctagtgcct tctggttatt cacccacatt ccaatggcgg
     7321 gtttggtacg aatgtataat ttgttagcat gcctttggct tttacgcaag ttttatcagc
     7381 atgtaatcaa tggttgcaaa gatacggcat gcttgctctg ctataagagg aaccgactta
     7441 ctagagttga agcttctacc gttgtctgtg gtggaaaacg tacgttttat atcacagcaa
     7501 atggcggtat ttcattctgt cgtaggcata attggaattg tgtggattgt gacattgcag
     7561 gtgtggggaa taccttcatc tgtgaagaag tcgcaaatga cctcactacc gccctacgca
     7621 ggcctattaa cgctacggat agatcacatt attatgtgga ttccgttaca gttaaagaga
     7681 ctgttgttca gtttaattat cgtagagacg gtcaaccatt ctacgagcgg tttcccctct
     7741 gcgcttttac aaatctagat aagttgaagt tcaaagaggt ctgtaaaact actactggta
     7801 tacctgaata caactttatc atctacgact catcagatcg tggccaggaa agtttagcta
     7861 ggtctgcatg tgtttattat tctcaagtct tgtgtaaatc aattcttttg gttgactcaa
     7921 gtttggttac ttctgttggt gattctagtg aaatcgccac taaaatgttt gattcctttg
     7981 ttaatagttt cgtctcgctg tataatgtca cacgcgataa gttggaaaaa cttatctcta
     8041 ctgctcgtga tggcgtaagg cgaggcgata acttccatag tgtcttaaca acattcattg
     8101 acgcagcacg aggccccgca ggtgtggagt ctgatgttga gaccaatgaa attgttgact
     8161 ctgtgcagta tgctcataaa catgacatac aaattactaa tgagagttac aataattatg
     8221 taccctcata tgttaaacct gatagtgtgt ctaccagtga tttaggtagt ctcattgatt
     8281 gtaatgcggc ttcagttaac caaattgtct tgcgtaattc taatggtgct tgtatttgga
     8341 acgctgctgc atatatgaaa ctctcggatg cacttaaacg acagattcgc attgcatgcc
     8401 gtaagtgtaa tttagctttc cggttaacca cctcaaagct acgcgctaat gataatatct
     8461 tatcagttag attcactgct aacaaaattg ttggtggtgc tcctacatgg tttaatgtgt
     8521 tgcgtgactt tacgttaaag ggttacgttc ttgctaccat tattgtgttt ctgtgtgctg
     8581 tactgatgta tttgtgttta cctacatttt ctatggtacc tgttgaattt tatgaagacc
     8641 gcatcttgga ctttaaagtt cttgataatg gtatcattag ggatgtaaat cctgatgata
     8701 agtgctttgc taataagcac cggtccttca cacaatggta tcatgagcat gttggtggtg
     8761 tctatgacaa ctctatcaca tgcccattga cagttgcagt aattgctgga gttgctggtg
     8821 ctcgcattcc agacgtacct actacattgg cttgggtgaa caatcagata attttctttg
     8881 tttctcgagt ctttgctaat acaggcagtg tttgctacac tcctatagat gagataccct
     8941 ataagagttt ctctgatagt ggttgcattc ttccatctga gtgcactatg tttagggatg
     9001 cagagggccg tatgacacca tactgccatg atcctactgt tttgcctggg gcttttgcgt
     9061 acagtcagat gaggcctcat gttcgttacg acttgtatga tggtaacatg tttattaaat
     9121 ttcctgaagt agtatttgaa agtacactta ggattactag aactctgtca actcagtact
     9181 gccggttcgg tagttgtgag tatgcacaag agggtgtttg tattaccaca aatggctcgt
     9241 gggccatttt taatgaccac catcttaata gacctggtgt ctattgtggt tctgatttta
     9301 ttgacattgt caggcggtta gcagtatcac tgttccagcc tattacttat ttccaattga
     9361 ctacctcatt ggtcttgggt ataggtttgt gtgcattcct gactttgctc ttttattata
     9421 ttaataaagt aaaacgtgct tttgcagatt acacccagtg tgctgtaatt gctgttgttg
     9481 ctgctgttct taatagcttg tgcatctgct ttgttgcctc tataccattg tgtatagtac
     9541 cttacactgc attgtactat tatgctacat tctattttac taatgagcct gcatttatta
     9601 tgcatgtttc ttggtacatt atgttcgggc ctatcgttcc catatggatg acctgcgtct
     9661 atacagttgc aatgtgcttt agacacttct tctgggtttt agcttatttt agtaagaaac
     9721 atgtagaagt ttttactgat ggtaagctta attgtagttt ccaggacgct gcctctaata
     9781 tctttgttat taacagggac acttatgcag ctcttagaaa ctctttaact aatgatgcct
     9841 attcacgatt tttggggttg tttaacaagt ataagtactt ctctggtgct atggaaacag
     9901 ccgcttatcg tgaagctgca gcatgtcatc ttgctaaagc cttacaaaca tacagcgaga
     9961 ctggtagtga tcttctttac caaccaccca actgtagcat aacctctggc gtgttgcaaa
    10021 gcggtttggt gaaaatgtca catcccagtg gagatgttga ggcttgtatg gttcaggtta
    10081 cctgcggtag catgactctt aatggtcttt ggcttgacaa cacagtctgg tgcccacgac
    10141 acgtaatgtg cccggctgac cagttgtctg atcctaatta tgatgccttg ttgatttcta
    10201 tgactaatca tagtttcagt gtgcaaaaac acattggcgc tccagcaaac ttgcgtgttg
    10261 ttggtcatgc catgcaaggc actcttttga agttgactgt cgatgttgct aaccctagca
    10321 ctccagccta cacttttaca acagtgaaac ctggcgcagc atttagtgtg ttagcatgct
    10381 ataatggtcg tccgactggt acattcactg ttgtaatgcg ccctaactac acaattaagg
    10441 gttcctttct gtgtggttct tgtggtagtg ttggttacac caaggagggt agtgtgatca
    10501 atttttgtta catgcatcaa atggaacttg ctaatggtac acataccggt tcagcatttg
    10561 atggtactat gtatggtgcc tttatggata aacaagtgca ccaagttcag ttaacagaca
    10621 aatactgcag tgttaatgta gtagcttggc tttacgcagc aatacttaat ggttgcgctt
    10681 ggtttgtaaa acctaatcgc actagtgttg tttcttttaa tgaatgggct cttgccaacc
    10741 aattcactga atttgttggc actcaatccg ttgacatgtt agctgtcaaa acaggcgttg
    10801 ctattgaaca gctgctttat gcgatccaac aactttatac tgggttccag ggaaagcaaa
    10861 tccttggcag tactatgttg gaagatgaat tcacacctga ggatgttaat atgcagatta
    10921 tgggtgtggt tatgcagagt ggtgtgagaa aagttacata tggtactgcg cattggttgt
    10981 tcgcgaccct tgtctcaacc tatgtgataa tcttacaagc cactaaattt actttgtgga
    11041 actacttgtt tgagactatt cccacacagt tgttcccact cttatttgtg actatggcct
    11101 tcgttatgtt gttggttaaa cacaaacaca cctttttgac acttttcttg ttgcctgtgg
    11161 ctatttgttt gacttatgca aacatagtct acgagcccac tactcccatt tcgtcagcgc
    11221 tgattgcagt tgcaaattgg cttgccccca ctaatgctta tatgcgcact acacatactg
    11281 atattggtgt ctacattagt atgtcacttg tattagtcat tgtagtgaag agattgtaca
    11341 acccatcact ttctaacttt gcgttagcat tgtgcagtgg tgtaatgtgg ttgtacactt
    11401 atagcattgg agaagcctca agccccattg cctatctggt ttttgtcact acactcacta
    11461 gtgattatac gattacagtc tttgttactg tcaaccttgc aaaagtttgc acttatgcca
    11521 tctttgctta ctcaccacag cttacacttg tgtttccgga agtgaagatg atacttttat
    11581 tatacacatg tttaggtttc atgtgtactt gctattttgg tgtcttctct cttttgaacc
    11641 ttaagcttag agcacctatg ggtgtctatg actttaaggt ctcaacacaa gagttcagat
    11701 tcatgactgc taacaatcta actgcaccta gaaattcttg ggaggctatg gctctgaact
    11761 ttaagttaat aggtattggc ggtacacctt gtataaaggt tgctgctatg cagtctaaac
    11821 ttacagatct taaatgcaca tctgtggttc tcctctctgt gctccaacag ttacacttag
    11881 aggctaatag tagggcctgg gctttctgtg ttaaatgcca taatgatata ttggcagcaa
    11941 cagaccccag tgaggctttc gagaaattcg taagtctctt tgccacttta atgacttttt
    12001 ctggtaatgt agatcttgat gcgttagcta gtgatatttt tgacactcct agcgtacttc
    12061 aagctactct ttctgagttt tcacacttag ctacctttgc tgagttggaa gctgcgcaga
    12121 aagcctatca ggaagctatg gactctggtg acacctcacc acaagttctt aaggctttgc
    12181 agaaggctgt taatatagct aaaaacgcct atgagaagga taaggcagtg gcccgtaagt
    12241 tagaacgtat ggctgatcag gctatgactt ctatgtataa gcaagcacgt gctgaagaca
    12301 agaaagcaaa aattgtcagt gctatgcaaa ctatgttgtt tggtatgatt aagaagctcg
    12361 acaacgatgt tcttaatggt atcatttcta acgctaggaa tggttgtata cctcttagtg
    12421 tcattccact gtgtgcttca aataaacttc gcgttgtaat tcctgacttc accgtctgga
    12481 atcaggtagt cacatatccc tcgcttaact acgctggggc tttgtgggac attacagtta
    12541 taaacaatgt ggacaatgaa attgttaagt cttcagatgt tgtagacagc aatgaaaatt
    12601 taacatggcc acttgtttta gaatgcacta gggcatccac ttctgccgtt aagttgcaaa
    12661 ataatgagat caaaccttca ggtttaaaaa ccatggttgt gtctgcaggt caagagcaaa
    12721 ctaactgtaa tactagttcc ttagcttatt acgaacctgt gcagggtcgt aaaatgctga
    12781 tggctcttct ttctgataat gcctatctca aatgggcgcg tgttgaaggt aaggacggat
    12841 ttgttagtgt agagctacaa cctccttgca aattcttgat tgcgggacca aaaggacctg
    12901 aaatccgata tctctatttt gttaaaaatc ttaacaacct tcatcgcggg caagtgttag
    12961 ggcacattgc tgcgactgtt agattgcaag ctggttctaa caccgagttt gcctctaatt
    13021 cttcggtgtt gtcacttgtt aacttcaccg ttgatcctca aaaagcttat ctcgatttcg
    13081 tcaatgcggg aggtgcccca ttgacaaatt gtgttaagat gcttactcct aaaactggta
    13141 caggtatagc tatatctgtt aaaccagaga gtacagctga tcaagagact tatggtggag
    13201 cttcagtgtg tctctattgc cgtgcgcata tagaacatcc tgatgtctct ggtgtttgta
    13261 aatataaggg taagtttgtc caaatccctg ctcagtgtgt ccgtgaccct gtgggatttt
    13321 gtttgtcaaa taccccctgt aatgtctgtc aatattggat tggatatggg tgcaattgtg
    13381 actcgcttag gcaagtagca ctgccccaat ctaaagattc caatttttta aacgagtccg
    13441 gggttctatt gtaaatgccc gaatagaacc ctgttcaagt ggtttgtcca ctgatgtcgt
    13501 ctttagggca tttgacatct gcaactataa ggctaaggtt gctggtattg gaaaatacta
    13561 caagactaat acttgtaggt ttgtagaatt agatgaccaa gggcatcatt tagactccta
    13621 ttttgtcgtt aagaggcata ctatggagaa ttatgaacta gagaagcact gttacgattt
    13681 gttacgtgac tgtgatgctg tagctcccca tgatttcttc atctttgatg tagacaaagt
    13741 taaaacacct catattgtac gtcagcgttt aactgagtac actatgatgg atcttgtata
    13801 tgccctgagg cactttgatc aaaatagcga agtgcttaag gctatcttag tgaagtatgg
    13861 ttgctgtgat gttacctact ttgaaaataa actctggttt gattttgttg aaaatcccag
    13921 tgttattggt gtttatcata aacttggaga acgtgtacgc caagctatct taaacactgt
    13981 taaattttgt gaccacatgg tcaaggctgg tttagtcggt gtgctcacac tagacaacca
    14041 ggaccttaat ggcaagtggt atgattttgg tgacttcgta atcactcaac ctggttcagg
    14101 agtagctata gttgatagct actattctta tttgatgcct gtgctctcaa tgaccgattg
    14161 tctggccgct gagacacata gggattgtga ttttaataaa ccactcattg agtggccact
    14221 tactgagtat gattttactg attataaggt acaactcttt gagaagtact ttaaatattg
    14281 ggatcagacg tatcacgcaa attgcgttaa ttgtactgat gaccgttgtg tgttacattg
    14341 tgctaatttc aatgtattgt ttgctatgac catgcctaag acttgtttcg gacccatagt
    14401 ccgaaagatc tttgttgatg gcgtgccatt tgtagtatct tgtggttatc actacaaaga
    14461 attaggttta gtcatgaata tggatgttag tctccataga cataggctct ctcttaagga
    14521 gttgatgatg tatgccgctg atccagccat gcacattgcc tcctctaacg cttttcttga
    14581 tttgaggaca tcatgtttta gtgtcgctgc acttacaact ggtttgactt ttcaaactgt
    14641 gcggcctggc aattttaacc aagacttcta tgatttcgtg gtatctaaag gtttctttaa
    14701 ggagggctct tcagttacgc tcaaacattt tttctttgct caagatggta atgctgctat
    14761 tacagattat aattactatt cttataatct gcctactatg tgtgacatca aacaaatgtt
    14821 gttctgcatg gaagttgtaa acaagtactt cgaaatctat gacggtggtt gtcttaatgc
    14881 ttctgaagtg gttgttaata atttagacaa gagtgctggc catcctttta ataagtttgg
    14941 caaagctcgt gtctattatg agagcatgtc ttaccaggag caagatgaac tctttgccat
    15001 gacaaagcgt aacgtcattc ctaccatgac tcaaatgaat ctaaaatatg ctattagtgc
    15061 taagaataga gctcgcactg ttgcaggcgt gtccatactt agcacaatga ctaatcgtca
    15121 gtaccatcag aaaatgctta agtccatggc tgcaactcgt ggagcgactt gcgtcattgg
    15181 tactacaaag ttctatggtg gctgggattt catgcttaaa acattgtaca aagatgttga
    15241 taatccgcat cttatgggtt gggattaccc taagtgtgat agagctatgc ctaatatgtg
    15301 tagaatcttt gcttcactca tattagctcg taaacatggc acttgttgta ctacaaggga
    15361 cagattttat cgcttggcaa atgagtgtgc tcaggtgcta agcgaatatg ttctatgtgg
    15421 tggtggttac tacgtcaaac ctggaggtac cagtagcgga gacgccacca ctgcatatgc
    15481 caatagtgtc tttaacattt tgcaggcgac aactgctaat gtcagtgcac ttatgggtgc
    15541 taatggcaac aagattgttg acaaagaagt taaagacatg cagtttgatt tgtatgtcaa
    15601 tgtttacagg agcactagcc cagaccccaa atttgttgat aaatactatg cttttcttaa
    15661 taagcacttt tctatgatga tactgtctga tgacggtgtc gtttgctata atagtgatta
    15721 tgcagctaag ggttacattg ctggaataca gaattttaag gaaacgctgt attatcagaa
    15781 caatgtcttt atgtctgaag ctaaatgctg ggtggaaacc gatctgaaga aagggccaca
    15841 tgaattctgt tcacagcata cgctttatat taaggatggc gacgatggtt acttccttcc
    15901 ttatccagac ccttcaagaa ttttgtctgc cggttgcttt gtagatgata tcgttaagac
    15961 tgacggtaca ctcatggtag agcggtttgt gtctttggct atagatgctt accctctcac
    16021 aaagcatgaa gatatagaat accagaatgt attctgggtc tacttacagt atatagaaaa
    16081 actgtataaa gaccttacag gacacatgct tgacagttat tctgtcatgc tatgtggtga
    16141 taattctgct aagttttggg aagaggcatt ctatagagat ctctatagtt cgcctaccac
    16201 tttgcaggct gtcggttcat gcgttgtatg ccattcacag acttccctac gctgtgggac
    16261 atgcatccgt agaccatttc tctgctgtaa atgctgctat gatcatgtta tagcaactcc
    16321 acataagatg gttttgtctg tttctcctta cgtttgtaat gcccctggtt gtggcgtttc
    16381 agacgttact aagctatatt taggtggtat gagctacttt tgtgtagatc atagacctgt
    16441 gtgtagtttt ccactttgcg ctaatggtct tgtattcggc ttatacaaga atatgtgcac
    16501 aggtagtcct tctatagttg aatttaatag gttggctacc tgtgactgga ctgaaagtgg
    16561 tgattacacc cttgccaata ctacaacaga accactcaaa ctttttgctg ctgagacttt
    16621 acgtgccact gaagaggcgt ctaagcagtc ttatgctatt gccaccatca aagaaattgt
    16681 tggtgagcgc caactattac ttgtgtggga ggctggcaag tccaaaccac cactcaatcg
    16741 taattatgtt tttactggtt atcatataac caaaaatagt aaagtgcagc tcggtgagta
    16801 catcttcgag cgcattgatt atagtgatgc tgtatcctac aagtctagta caacgtataa
    16861 actgactgta ggtgacatct tcgtacttac ctcccactct gtggctacct tgacggcgcc
    16921 cacaattgtg aatcaagaga ggtatgttaa aattactggg ttgtacccaa ccattacggt
    16981 acctgaagag ttcgcaagtc atkttgccaa cttccaaaaa tcaggttata gtaaatatgt
    17041 cactgttcag ggaccacctg gcactggcaa aagtcatttt gctatagggt tagcgattta
    17101 ctaccctaca gcacgtgttg tttatacagc atgttcacac gcagctgttg atgctttgtg
    17161 tgaaaaagct tttaaatatt tgaacattgc taaatgttcc cgtatcattc ctgcaaaggc
    17221 acgtgttgag tgctatgaca ggtttaaagt taatgagaca aattctcaat atttgtttag
    17281 tactattaat gctctaccag aaacttctgc cgatattctg gtggttgatg aggttagtat
    17341 gtgcactaat tatgatcttt caattattaa tgcacgtatt aaagctaagc acattgtcta
    17401 tgtaggagat ccagcacagt tgccagctcc taggactttg ttgactagag gcacattgga
    17461 accagaaaat ttcaatagtg tcactagatt gatgtgtaac ttaggtcctg acatattttt
    17521 aagtatgtgc tacaggtgtc ctaaggaaat agtaagcact gtgagcgctc ttgtctacaa
    17581 taataaattg ttagccaaga aggagctttc aggccagtgc tttaaaatac tctataaggg
    17641 caatgtgacg catgatgcta gctctgccat taatagacca caactcacat ttgtgaagaa
    17701 ttttattact gccaatccgg catggagtaa ggcagtcttt atttcgcctt ataattcaca
    17761 gaatgctgtg gctcgttcaa tgctgggcct tactactcag actgttgatt cctcacaggg
    17821 ttcagaatac cagtacgtta tcttctgtca aacagcagat acggcacatg ctaacaacat
    17881 taacagattt aatgttgcaa tcactcgtgc ccaaaaaggt attctttgtg ttatgacatc
    17941 tcaggcactc tttgagtcct tagagtttac tgaattgtct tttactaatt acaagctcca
    18001 gtctcagatt gtaactggcc tttttaaaga ttgctctaga gaaacttctg gcctctcacc
    18061 tgcttatgca ccaacatacg ttagtgttga tgacaagtat aagacgagtg atgagctttg
    18121 cgtgaatctt aatttacccg caaatgtccc atactctcgt gttatttcca ggatgggctt
    18181 taaactcgat gcaacagttc ctggatatcc taagcttttc attactcgtg aagaggctgt
    18241 aaggcaagtt cgaagctgga taggcttcga tgttgagggt gctcatgctt cccgtaatgc
    18301 atgtggcacc aatgtgcctc tacaattagg attttcaact ggtgtgaact ttgttgttca
    18361 gccagttggt gttgtagaca ctgagtgggg taacatgtta acgggcattg ctgcccgtcc
    18421 tccaccaggt gaacagttta agcacctcgt gcctcttatg cataaggggg ctgcatggcc
    18481 tattgttaga cgacgtatag tgcaaatgtt gtcagacact ttagacaaat tgtctgatta
    18541 ctgtacgttt gtttgttggg ctcatggctt tgaattaacg tctgcatcat acttttgcaa
    18601 gataggtaag gaacagaagt gttgcatgtg caatagacgc gctgcagcgt actcttcacc
    18661 tctgcaatct tatgcctgtt ggactcattc ctgcggttat gattatgtct acaacccttt
    18721 ctttgtcgat gttcaacagt ggggttatgt aggcaatctt gctactaatc acgatcgtta
    18781 ttgctctgtc catcaaggag ctcatgtggc ttctaatgat gcaataatga ctcgttgttt
    18841 agctattcat tcttgtttta tagaacgtgt ggattgggat atagagtatc cttatatctc
    18901 acatgaaaag aaattgaatt cctgttgtag aatcgttgag cgcaacgtcg tacgtgctgc
    18961 tcttcttgcc ggttcatttg acaaagtcta tgatattggc aatcctaaag gaattcctat
    19021 tgttgatgac cctgttgttg attggcatta ttttgatgca cagcccttga ccaggaaggt
    19081 acaacagctt ttctatacag aggacatggc ctcaagattt gctgatgggc tctgcttatt
    19141 ttggaactgt aatgtaccaa aatatcctaa taatgcaatt gtatgcaggt ttgacacacg
    19201 tgtgcattct gagttcaatt tgccaggttg tgatggcggt agtttgtatg ttaacaagca
    19261 cgcttttcat acaccagcat atgatgtgag tgcattccgt gatctgaaac ctttaccatt
    19321 cttttattat tctactacac catgtgaagt gcatggtaat ggtagtatga tagaggatat
    19381 tgattatgta cccctaaaat ctgcagtctg tattacaact tgtaatttag ggggcgctgt
    19441 ttgtaggaag catgctacag agtacagaga gtatatggaa gcatataatc ttgtctctgc
    19501 atcaggtttc cgcctttggt gttataagac ctttgatatt tataatctct ggtctacttt
    19561 tacaaaagtt caaggtttgg aaaacattgc ttttaatgtt gttaaacaag gccattttat
    19621 tggtgttgag ggtgaactac ctgtagctgt agtcaatgat aagatcttca ccaagagtgg
    19681 cgttaatgac atttgtatgt ttgagaataa aaccactttg cctactaata tagcttttga
    19741 actctatgct aagcgtgctg tacgctcgca tcccgatttc aaattgctac acaatttaca
    19801 agcagacatt tgctacaagt tcgtcctttg ggattatgaa cgtagcaata tttatggtac
    19861 tgctactatt ggtgtatgta agtacactga tattgatgtt aattcagctt tgaatatatg
    19921 ttttgacata cgcgataatg gttcattgga gaagttcatg tctactccca atgccatctt
    19981 tatttctgat agaaaaatca agaaataccc ttgtatggta ggtcctgatt atgcttactt
    20041 caatggtgct atcatccgtg atagtgatgt tgttaaacaa ccagtgaagt tctacttgta
    20101 taagaaagtc aataatgagt ttattgatcc tactgagtgt atttacactc agagtcgctc
    20161 ttgtagtgac ttcctacccc tgtctgacat ggagaaagac tttctatctt ttgatagtga
    20221 tgttttcatt aagaagtatg gcttggaaaa ctatgctttt gagcacgtag tctatggaga
    20281 cttctctcat actacgttag gcggtcttca cttgcttatt ggtttataca agaagcaaca
    20341 ggaaggtcat attattatgg aagaaatgct aaaaggtagc tcaactattc ataactattt
    20401 tattactgag actaacacag cggcttttaa ggcggtgtgt tctgttatag atttaaagct
    20461 tgacgacttt gttatgattt taaagagtca agaccttggc gtagtatcca aggttgtcaa
    20521 ggttcctatt gacttaacaa tgattgagtt tatgttatgg tgtaaggatg gacaggttca
    20581 aaccttctac cctcgactcc aggcttctgc agattggaaa cctggtcatg caatgccatc
    20641 cctctttaaa gttcaaaatg taaaccttga acgttgtgag cttgctaatt acaagcaatc
    20701 tattcctatg cctcgcggtg tgcacatgaa catcgctaaa tatatgcaat tgtgccagta
    20761 tttaaatact tgcacattag ccgtgcctgc caatatgcgt gttatacatt ttggcgctgg
    20821 ttctgataaa ggtatcgctc ctggtacatc agttttacga cagtggcttc ctacagatgc
    20881 cattattata gataatgatt taaatgagtt cgtgtcagat gctgacataa ctttatttgg
    20941 agattgtgta actgtacgtg tcggccaaca agtggatctt gttatttccg acatgtatga
    21001 tcctactact aagaatgtaa caggtagtaa tgagtcaaag gctttattct ttacttacct
    21061 gtgtaacctc attaataata atcttgctct tggtggttct gttgctatta aaataacaga
    21121 acactcttgg agcgttgaac tttatgaact tatgggaaaa tttgcttggt ggactgtttt
    21181 ctgcaccaat gcaaatgcat cctcatctga aggattcctt ttaggtatta attacttggg
    21241 tactattaaa gaaaatatag atggtggtgc tatgcacgcc aactatatat tttggagaaa
    21301 ttccactcct atgaatctga gtacttactc actttttgat ttatccaagt ttcaattaaa
    21361 attaaaagga acaccagttc ttcaattaaa ggagagtcaa attaacgaac tcgtaatatc
    21421 tctcctgtcg cagggtaagt tacttatccg tgacaatgat acactcagtg tttctactga
    21481 tgttcttgtt aacacctaca gaaagttacg ttgatgtagg gccagattct gttaagtctg
    21541 cttgtattga ggttgatata caacagacct tctttgataa aacttggcct aggccaattg
    21601 atgtttctaa ggctgacggt attatatacc ctcaaggccg tacatattct aacataacta
    21661 tcacttatca aggtcttttt ccctatcagg gagaccatgg tgatatgtat gtttactctg
    21721 caggacatgc tacaggcaca actccacaaa agttgtttgt agctaactat tctcaggacg
    21781 tcaaacagtt tgctaatggg tttgtcgtcc gtataggagc agctgccaat tccactggca
    21841 ctgttattat tagcccatct accagcgcta ctatacgaaa attttaccct gcttttatgc
    21901 tgggttcttc agttggtaat ttctcagatg gtaaaatggg ccgcttcttc aatcatactc
    21961 tagttctttt gcccgatgga tgtggcactt tacttagagc tttttattgt attctagagc
    22021 ctcgctctgg aaatcattgt cctgctggca attcctatac ttcttttgcc acttatcaca
    22081 ctcctgcaac agattgttct gatggcaatt acaatcgtaa tgccagtctg aactctttta
    22141 aggagtattt taatttacgt aactgcacct ttatgtacac ttataacatt accgaagatg
    22201 agattttaga gtggtttggc attacacaaa ctgctcaagg tgttcacctc ttctcatctc
    22261 ggtatgttga tttgtacggc ggcaatatgt ttcaatttgc caccttgcct gtttatgata
    22321 ctattaagta ttattctatc attcctcaca gtattcgttc tatccaaagt gatagaaaag
    22381 cttgggctgc cttctacgta tataaacttc aaccgttaac tttcctgttg gatttttctg
    22441 ttgatggtta tatacgcaga gctatagact gtggttttaa tgatttgtca caactccact
    22501 gctcatatga atccttcgat gttgaatctg gagtttattc agtttcgtct ttcgaagcaa
    22561 aaccttctgg ctcagttgtg gaacaggctg aaggtgttga atgtgatttt tcacctcttc
    22621 tgtctggcac acctcctcag gtttataatt tcaagcgttt ggtttttacc aattgcaatt
    22681 ataatcttac caaattgctt tcactttttt ctgtgaatga ttttacttgt agtcaaatat
    22741 ctccagcagc aattgctagc aactgttatt cttcactgat tttggattat ttttcatacc
    22801 cacttagtat gaaatccgat ctcagtgtta gttctgctgg tccaatatcc cagtttaatt
    22861 ataaacagtc cttttctaat cccacatgtt tgatcttagc gactgttcct cataacctta
    22921 ctactattac taagcctctt aagtacagct atattaacaa gtgctctcgt cttctttctg
    22981 atgatcgtac tgaagtacct cagttagtga acgctaatca atactcaccc tgtgtatcca
    23041 ttgtcccatc cactgtgtgg gaagacggtg attattatag gaaacaacta tctccacttg
    23101 aaggtggtgg ctggcttgtt gctagtggct caactgttgc catgactgag caattacaga
    23161 tgggctttgg tattacagtt caatatggta cagacaccaa tagtgtttgc cccaagcttg
    23221 aatttgctaa tgacacaaaa attgcctctc aattaggcaa ttgcgtggaa tattccctct
    23281 atggtgtttc gggccgtggt gtttttcaga attgcacagc tgtaggtgtt cgacagcagc
    23341 gctttgttta tgatgcgtac cagaatttag ttggctatta ttctgatgat ggcaactact
    23401 actgtctgcg tgcttgtgtt agtgttcctg tttctgtcat ctatgataaa gaaactaaaa
    23461 cccacgctac tctatttggt agtgttgcat gtgaacacat ttcttctacc atgtctcaat
    23521 actcccgttc tacgcgatca atgcttaaac ggcgagattc tacatatggc ccccttcaga
    23581 cacctgttgg ttgtgtccta ggacttgtta attcctcttt gttcgtagag gactgcaagt
    23641 tgcctctcgg tcaatctctc tgtgctcttc ctgacacacc tagtactctc acacctcgca
    23701 gtgtgcgctc tgtgccaggt gaaatgcgct tggcatccat tgcttttaat catcccattc
    23761 aggttgatca acttaatagt agttatttta aattaagtat acccactaat ttttcctttg
    23821 gtgtgactca ggagtacatt cagacaacca ttcagaaagt tactgttgat tgtaaacagt
    23881 acgtttgcaa tggtttccag aagtgtgagc aattactgcg cgagtatggc cagttttgtt
    23941 ccaaaataaa ccaggctctc catggtgcca atttacgcca ggatgattct gtacgtaatt
    24001 tgtttgcgag cgtgaaaagc tctcaatcat ctcctatcat accaggtttt ggaggtgact
    24061 ttaatttgac acttctagaa cctgtttcta tatctactgg cagtcgtagt gcacgtagtg
    24121 ctattgagga tttgctattt gacaaagtca ctatagctga tcctggttat atgcaaggtt
    24181 acgatgattg tatgcagcaa ggtccagcat cagctcgtga tcttatttgt gctcaatatg
    24241 tggctggtta taaagtatta cctcctctta tggatgttaa tatggaagcc gcgtatactt
    24301 catctttgct tggcagcata gcaggtgttg gctggactgc tggcttatcc tcctttgctg
    24361 ctattccatt tgcacagagt attttttata ggttaaacgg tgttggcatt actcaacagg
    24421 ttctttcaga taaccaaaag cttattgcca ataagtttaa tcaggctctg ggagctatgc
    24481 aaacaggctt cactacaact aatgaagctt ttcggaaggt tcaggatgct gtgaacaaca
    24541 atgcacaggc tctatccaaa ttagctagcg agctatctaa tacttttggt gctatttccg
    24601 cctctattgg agacatcata caacgtcttg atgttctcga acaggacgcc caaatagaca
    24661 gacttattaa tggccgtttg acaacactaa atgcttttgt tgcacagcag cttgttcgtt
    24721 ccgaatcagc tgctctttcc gctcaattgg ctaaagataa agtcaatgag tgtgtcaagg
    24781 cacaatccaa gcgttctgga ttttgcggtc aaggcacaca tatagtgtcc tttgttgtaa
    24841 atgcccctaa tggcctttac tttatgcatg ttggttatta ccctagcaac cacattgagg
    24901 ttgtttctgc ttatggtctt tgcgatgcag ctaaccctac taattgtata gcccctgtta
    24961 atggctactt tattaaaact aataacacta ggattgttga tgagtggtca tatactggct
    25021 cgtccttcta tgcacctgag cccatcacct ctcttaatac taagtatgtt gcaccacagg
    25081 tgacatacca aaacatttct actaacctcc ctcctcctct tctcagcaat tccaccggga
    25141 ttgacttcca agatgagttg gatgagtttt tcaaaaatgt tagcaccagt atacctaatt
    25201 ttggttctct aacacagatt aatactacat tactcgatct tacctacgag atgttgtctc
    25261 ttcaacaagt tgttaaagcc cttaatgagt cttatataga ccttaaagag cttggcaatt
    25321 atacttatta caacaaatgg ccgtggtaca tttggcttgg tttcattgct gggcttgttg
    25381 ccttagctct atgcgtcttc ttcatactgt gctgcactgg ttgtggcaca aactgtatgg
    25441 gaaaacttaa gtgtaatcgt tgttgtgata gatacgagga atacgacctc gagccgcata
    25501 aggttcatgt tcactaatta acgaactatc aatgagagtt caaagaccac ccactctctt
    25561 gttagtgttc tcactctctc ttttggtcac tgcattttca aaacctctct atgtacctga
    25621 gcattgtcag aattattctg gttgcatgct tagggcttgt attaaaactg cccaagctga
    25681 tacagctggt ctttatacaa attttcgaat tgacgtccca tctgcagaat caactggtac
    25741 tcaatcagtt tctgtcgatc gtgagtcaac ttcaactcat gatggtccta ccgaacatgt
    25801 tactagtgtg aatctttttg acgttggtta ctcagttaat taacgaactc tatggattac
    25861 gtgtctctgc ttaatcaaat ttggcagaag taccttaatt caccgtatac tacttgtttg
    25921 tatatcccta aacccacagc taagtataca cctttagttg gcacttcatt gcaccctgtg
    25981 ctgtggaact gtcagctatc ctttgctggt tatactgaat ctgctgttaa ttctacaaaa
    26041 gctttggcca aacaggacgc agctcagcga atcgcttggt tgctacataa ggatggagga
    26101 atccctgatg gatgttccct ctacctccgg cactcaagtt tattcgcgca aagcgaggaa
    26161 gaggagtcat tctccaacta agaaactgcg ctacgttaag cgtagatttt ctcttctgcg
    26221 ccctgaagac cttagtgtta ttgtccaacc aacacactat gtcarggtta cattttcaga
    26281 ccccaacatg tggtatctac gttcgggtca tcatttacac tcagttcaca attggcttaa
    26341 accttatggc ggccaacctg tttctgagta ccatattact ctagctttgc taaatctcac
    26401 tgatgaagat ttagctagag atttttcacc cattgcgctc tttttgcgca atgtcagatt
    26461 tgagctacat gagttcgcct tgctgcgcaa aactcttgtt cttaatgcat cagagatcta
    26521 ctgtgctaac atacatagat ttaagcctgt gtatagagtt aacacggcaa tccctactat
    26581 taaggattgg cttctcgttc agggattttc cctttaccat agtggcctcc ctttacatat
    26641 gtcaatctct aaattgcatg cactggatga tgttactcgc aattacatca ttacaatgcc
    26701 atgctttaga acttatcctc aacaaatgtt tgttactcct ttggccgtag atgttgtctc
    26761 catacggtct tccaatcagg gtaataaaca aattgttcat tcttacccca ttttacatca
    26821 tccaggattt taacgaacta tggctttctc ggcgtcttta tttaaacccg tccagctagt
    26881 cccagtttct cctgcatttc atcgcattga gtctactgac tctattgttt tcacatacat
    26941 tcctgctagc ggctatgtag ctgctttagc tgtcaatgtg tgtctcattc ccctattatt
    27001 actgctacgt caagatactt gtcgtcgcag cattatcaga actatggttc tctatttcct
    27061 tgttctgtat aactttttat tagccattgt actagtcaat ggtgtacatt atccaactgg
    27121 aagttgcctg atagccttct tagttatcct cataatactt tggtttgtag atagaattcg
    27181 tttctgtctc atgctgaatt cctacattcc actgtttgac atgcgttctc actttattcg
    27241 tgttagtaca gtttcttctc atggtatggt ccctgtcata cacaccaaac cattatttat
    27301 tagaaacttc gatcagcgtt gcagctgttc tcgttgtttt tatttgcact cttccactta
    27361 tatagagtgc acttatatta gccgttttag taagattagc ctagtttctg taactgactt
    27421 ctccttaaac ggcaatgttt ccactgtttt cgtgcctgca acgcgcgatt cagttcctct
    27481 tcacataatc gccccgagct cgcttatcgt ttaagcagct ctgcgctact atgggtcccg
    27541 tgtagaggct aatccattag tctctctttg gacatatgga aaacgaacta tgttaccctt
    27601 tgtccaagaa cgaatagggt tgttcatagt aaactttttc atttttaccg tagtatgtgc
    27661 tataacactc ttggtgtgta tggctttcct tacggctact agattatgtg tgcaatgtat
    27721 gacaggcttc aataccctgt tagttcagcc cgcattatac ttgtataata ctggacgttc
    27781 agtctatgta aaattccagg atagtaaacc ccctctacca cctgacgagt gggtttaacg
    27841 aactccttca taatgtctaa tatgacgcaa ctcactgagg cgcagattat tgccattatt
    27901 aaagactgga actttgcatg gtccctgatc tttctcttaa ttactatcgt actacagtat
    27961 ggatacccat cccgtagtat gactgtctat gtctttaaaa tgtttgtttt atggctccta
    28021 tggccatctt ccatggcgct atcaatattt agcgccattt atccaattga tctagcttcc
    28081 cagataatct ctggcattgt agcagctgtt tcagctatga tgtggatttc ctactttgtg
    28141 cagagtatcc ggctgtttat gagaactgga tcatggtggt catttaatcc tgagactaat
    28201 tgccttttga acgttccatt tggtggtaca actgtcgtac gtccactcgt agaggactct
    28261 accagtgtaa ctgctgttgt aaccaatggc cacctcaaaa tggctggcat gcatttcggt
    28321 gcttgtgact acgacagact tcctaatgaa gtcaccgtgg ccaaacccaa tgtgctgatt
    28381 gctttaaaaa tggtgaagcg gcaaagctac ggaactaatt ccggcgttgc catttaccat
    28441 agatataagg caggtaatta caggagtccg cctattacgg cggatattga acttgcattg
    28501 cttcgagctt aggctcttta gtaagagtat cttaattgat tttaacgaat ctcaatttca
    28561 ttgttatggc atcccctgct gcacctcgtg ctgtttcctt tgccgataac aatgatataa
    28621 caaatacaaa cctgtctcga ggtagaggac gtaatccaaa accacgagct gcaccaaata
    28681 acactgtctc ttggtacact gggcttaccc aacacgggaa agtccctctt acctttccac
    28741 ctgggcaggg tgtacctctt aatgccaatt ccaccccagc gcaaaatgct gggtattggc
    28801 ggagacagga cagaaaaatt aataccggga atggaattaa gcaactggct cccaggtggt
    28861 acttctacta cactggaacc ggacccgaag cagcactccc attccgggct gttaaggatg
    28921 gcatcgtttg ggtccatgaa catggcgcca ctgatgctcc ttcaactttt gggacgcgga
    28981 accctaacaa tgattcagct attgttacac aattcgcgcc cggtactaag cttcctaaaa
    29041 acttccacat tgaggggact ggaggcaata gtcaatcatc ttcaagagcc tctagcgtaa
    29101 gcagaaactc ttccagatct agttcacaag gttcaagatc aggaaactct acccgcggca
    29161 cttctccagg tccatctgga atcggagcag taggaggtga tctactttac cttgatcttc
    29221 tgaacagact acaagccctt gagtctggca aagtaaagca atcgcagcca aaagtaatca
    29281 ctaagaaaga tgctgctgct gctaaaaata agatgcgcca caagcgcact tccaccaaaa
    29341 gtttcaacat ggtgcaagct tttggtcttc gcggaccagg agacctccag ggaaactttg
    29401 gtgatcttca attgaataaa ctcggcactg aggacccacg ttggccccaa attgctgagc
    29461 ttgctcctac agccagtgct tttatgggta tgtcgcaatt taaacttacc catcagaaca
    29521 atgatgatca tggcaaccct gtgtacttcc ttcggtacag tggagccatt aaacttgacc
    29581 caaagaatcc caactacaat aagtggttgg agcttcttga gcaaaatatt gatgcctaca
    29641 aaaccttccc taagaaggaa aagaaacaaa aggcaccaaa agaagaatca acagaccaaa
    29701 tgtctgaacc tcctaaggag cagcgtgtgc aaggtagcat cactcagcgc actcgcaccc
    29761 gtccaagtgt tcagcctggt ccaatgattg atgttaacac tgattagtgt cactcaaagt
    29821 aacaagatcg cggcaatcgt ttgtgtttgg taaccccatc tcaccatcgc ttgtccactc
    29881 ttgcacagaa tggaatcatg ttgtaattac agtgcaataa ggtaattata acccatttaa
    29941 ttgatagcta tgctttatta aagtgtgtag ctgtagagag aatgttaaag actgtcacct
    30001 ctgcttgatt gcaagtgaac agtgcccccc gggaagagct ctacagtgtg aaatgtaaat
    30061 aaaaatagct attattcaat tagattaggc taattagatg atttgcaa

Share this post


Link to post
Share on other sites
LOCUS       KT368854               30118 bp    RNA     linear   VRL 17-DEC-2015
DEFINITION  Middle East respiratory syndrome coronavirus isolate
            camel/Jeddah/S73/2014, complete genome.
ACCESSION   KT368854
VERSION     KT368854.1  GI:922058184
KEYWORDS    .
SOURCE      Middle East respiratory syndrome coronavirus (MERS-CoV)
  ORGANISM  Middle East respiratory syndrome coronavirus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
            unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 30118)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Co-circulation of three camel coronavirus species and recombination
            of MERS-CoVs in Saudi Arabia
  JOURNAL   Science (2015) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 30118)
  AUTHORS   Sabir,J.S.M., Lam,T.Y., Ahmed,M.M., Li,L., Shen,Y., AboAba,S.,
            Qureshi,M.I., Abu-Zaid,M., Zhang,Y., Khiyami,M.A., Alharbi,N.S.,
            Hajrah,N.H., Sabir,M.J., Mutwakil,M.H.Z., Kabli,S.A.,
            Alsulaimany,F.A.S., Obaid,A.Y., Zhou,B., Smith,D.K., Holmes,E.C.,
            Zhu,H. and Guan,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2015) Centre of Influenza Research & State Key
            Laboratory of Emerging Infectious Diseases, The University of Hong
            Kong, Laboratory Block, 21 Sassoon Road, Pokfulam, Hong Kong SAR,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Lasergene v. 9.0
            Sequencing Technology :: Sanger dideoxy sequencing; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..30118
                     /organism="Middle East respiratory syndrome coronavirus"
                     /mol_type="genomic RNA"
                     /isolate="camel/Jeddah/S73/2014"
                     /host="camel"
                     /db_xref="taxon:1335626"
                     /country="Saudi Arabia"
                     /collection_date="Sep-2014"
     gene            279..21514
                     /gene="orf1ab"
     CDS             join(279..13433,13433..21514)
                     /gene="orf1ab"
                     /ribosomal_slippage
                     /codon_start=1
                     /product="polyprotein ORF1ab"
                     /protein_id="ALA49670.1"
                     /db_xref="GI:922058186"
                     /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
                     LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
                     VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
                     ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
                     KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
                     DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
                     FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
                     SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
                     VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
                     KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
                     ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
                     TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
                     AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
                     PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
                     QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
                     KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
                     QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
                     VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
                     PVEVPVEDIAQVVIADTLQETPVVFDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
                     TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
                     NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
                     PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
                     NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
                     YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
                     VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
                     NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
                     NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
                     YGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
                     IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
                     REWCNVCGIKDVVLQGLRACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
                     LSGTPNEKLVTTFTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
                     KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
                     ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
                     LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDINLNKFNRASLRQIFDVAPIELENKF
                     TPL