Sign in to follow this  
Followers 0
niman

Partial Zika Sequence - Russia ex-Goa India - Recombinant?

4 posts in this topic

Vector has released a partial Zika sequence exported to Russia from Goa, India.  

Sequence shows obvious recombination between older Asian sequences and those from the Americas.

Share this post


Link to post
Share on other sites
LOCUS       KX867786                1308 bp    RNA     linear   VRL 21-SEP-2016
DEFINITION  Zika virus isolate D304 polyprotein gene, partial cds.
ACCESSION   KX867786
VERSION     KX867786.1  GI:1069415456
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 1308)
  AUTHORS   Chausov,E.V., Ternovoi,V.A., Plyasunova,I.V., Loktev,V.B.,
            Pyankov,O.V., Agafonov,A.P., Maksiytov,R.A. and Popova,A.Y.
  TITLE     Imported cases of Zika fever in Russia
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1308)
  AUTHORS   Chausov,E.V., Ternovoi,V.A., Plyasunova,I.V., Loktev,V.B.,
            Pyankov,O.V., Agafonov,A.P., Maksiytov,R.A. and Popova,A.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-SEP-2016) Head of Molecular Diagnostic Sector, Src Vb
            Vector, Koltsovo, Koltsovo, Novosibirsk Region 630559, Russia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1308
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="D304"
                     /isolation_source="blood"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Russia"
                     /collection_date="30-May-2016"
                     /note="imported from Goa, India"
     CDS             <1..>1308
                     /codon_start=3
                     /product="polyprotein"
                     /protein_id="AOR39541.1"
                     /db_xref="GI:1069415457"
                     /translation="VGLLLTTAMAVEVTRRGSAYYMYLDRSDAGEAISFPTTLGVNKC
                     YIQIMDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSR
                     RAVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSST
                     SQKVIYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPT
                     VDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVD
                     RGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDT
                     GHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVH
                     KEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVV"
ORIGIN      
        1 ttgttggcct cctgctgacc acagccatgg cagtggaggt cactagacgt gggagtgcat
       61 actatatgta cttggacaga agcgatgctg gggaggccat atcttttcca accacactgg
      121 gggtgaataa gtgttacata cagatcatgg atcttggaca catgtgtgat gccacaatga
      181 gctatgaatg ccctatgttg gatgaggggg tagaaccaga tgacgtcgat tgctggtgca
      241 acacgacatc gacttgggtt gtgtacggaa cctgccatca caaaaaaggt gaagcacgga
      301 gatctagaag agctgtgacg ctcccctccc attccactag gaagctgcaa acgcggtcgc
      361 agacctggtt ggaatcaaga gaatacacaa agcacttgat cagagtcgag aattggatat
      421 tcaggaaccc tggtttcgct ttagcagcag ctgccatcgc gtggcttttg ggaagctcaa
      481 cgagccaaaa agtcatatac ttggtcatga tactgctgat tgccccggca tacagcatca
      541 ggtgcatagg agtcagcaat agggactttg tggaaggtat gtcaggtggg acctgggttg
      601 atgttgtctt ggaacatgga ggttgtgtta ccgtaatggc acaggacaaa ccgactgttg
      661 acatagagct ggtcacaaca acggttagca acatggcgga ggtaagatcc tactgctacg
      721 aggcatcaat atcggacatg gcttcggaca gccgctgccc aacacaaggt gaagcctacc
      781 ttgacaagca gtcagacact caatatgttt gcaaaagaac gttagtggac agaggttggg
      841 gaaatggatg tggacttttt ggcaaaggga gcctggtgac atgcgctaag tttgcatgct
      901 ccaagaaaat gaccgggaag agcatccagc cagagaatct ggagtaccgg ataatgctgt
      961 cagttcatgg ctcccagcac agtgggatga ttgttaatga cacaggacat gaaactgatg
     1021 agaatagagc gaaggttgag ataacgccca attcaccaag agccgaagcc accctggggg
     1081 gttttggaag cctaggactt gattgtgaac cgaggacagg ccttgacttt tcagatttgt
     1141 attacttgac tatgaataac aagcactggt tggttcacaa ggagtggttc catgacattc
     1201 cactaccttg gcatgctggg gcagacaccg gaactccaca ttggaacaac aaagaagcat
     1261 tggtagagtt caaggacgca catgccaaaa ggcaaactgt cgtggttc

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
2360 2360 100% 0.0 100% KX867786.1
2246 2246 100% 0.0 98% KX601167.1
2242 2242 100% 0.0 98% HQ234499.1
2237 2237 100% 0.0 98% KX694533.1
2237 2237 100% 0.0 98% KX377336.1
2233 2233 100% 0.0 98% EU545988.1
2206 2206 100% 0.0 97% KX856011.1
2206 2206 100% 0.0 97% KX447521.1
2206 2206 100% 0.0 97% KX447518.1
2206 2206 100% 0.0 97% KX447509.1
2206 2206 100% 0.0 97% KX247632.1
2206 2206 100% 0.0 97% KU955593.1
2206 2206 100% 0.0 97% KU922960.1
2206 2206 100% 0.0 97% KU681081.3
2206 2206 100% 0.0 97% KU707826.1
2206 2206 100% 0.0 97% KU647676.1
2206 2206 100% 0.0 97% KU365779.1
2206 2206 100% 0.0 97% JN860885.1
2201 2201 100% 0.0 97% KX813683.1
2201 2201 100% 0.0 97% KX197205.1
2201 2201 100% 0.0 97% KJ776791.2
2201 2201 100% 0.0 97% KX702400.1
2201 2201 100% 0.0 97% KX694534.1
2201 2201 100% 0.0 97% KX447520.1
2201 2201 100% 0.0 97% KX447519.1
2201 2201 100% 0.0 97% KX447515.1
2201 2201 100% 0.0 97% KX447514.1
2201 2201 100% 0.0 97% KX447513.1
2201 2201 100% 0.0 97% KX447510.1
2201 2201 100% 0.0 97% KX266255.1
2201 2201 100% 0.0 97% KX548902.1
2201 2201 100% 0.0 97% KX446951.1
2201 2201 100% 0.0 97% KU866423.2
2201 2201 100% 0.0 97% KX262887.1
2201 2201 100% 0.0 97% KX253996.1
2201 2201 100% 0.0 97% KX198135.1
2201 2201 100% 0.0 97% KX185891.1
2201 2201 100% 0.0 97% KX117076.1
2201 2201 100% 0.0 97% KU963796.1
2201 2201 100% 0.0 97% KU940228.1
2201 2201 100% 0.0 97% KU955589.1
2201 2201 100% 0.0 97% KU922923.1
2201 2201 100% 0.0 97% KU820899.2
2201 2201 100% 0.0 97% KU365780.1
2201 2201 100% 0.0 97% KU365777.1
2197 2197 100% 0.0 97% KX879604.1
2197 2197 100% 0.0 97% KX879603.1
2197 2197 100% 0.0 97% KX827309.1
2197 2197 100% 0.0 97% KX806557.1
2197 2197 100% 0.0 97% KX766029.1
2197 2197 100% 0.0 97% KX447516.1
2197 2197 100% 0.0 97% KX447512.1
2197 2197 100% 0.0 97% KX447511.1
2197 2197 100% 0.0 97% KX520666.1
2197 2197 100% 0.0 97% KX446950.1
2197 2197 100% 0.0 97% KU758876.1
2197 2197 100% 0.0 97% KU758874.1
2197 2197 100% 0.0 97% KU758871.1
2197 2197 100% 0.0 97% KU758870.1
2197 2197 100% 0.0 97% KU758869.1
2197 2197 100% 0.0 97% KU758868.1
2197 2197 100% 0.0 97% KX247646.1
2197 2197 100% 0.0 97% KU937936.1
2197 2197 100% 0.0 97% KX156776.1
2197 2197 100% 0.0 97% KX156774.1
2197 2197 100% 0.0 97% KX051563.1
2197 2197 100% 0.0 97% KU509998.3
2197 2197 100% 0.0 97% KU991811.1
2197 2197 100% 0.0 97% KU729218.1
2197 2197 100% 0.0 97% KU527068.1
2197 2197 100% 0.0 97% KU365778.1
2197 2197 100% 0.0 97% KU312314.1
2194 2194 100% 0.0 97% KX766028.1
2194 2194 100% 0.0 97% KU940224.1
2192 2192 100% 0.0 97% KX838906.1
2192 2192 100% 0.0 97% KU820897.5
2192 2192 100% 0.0 97% KX673530.1
2192 2192 100% 0.0 97% KX447517.1
2192 2192 100% 0.0 97% KX576684.1
2192 2192 100% 0.0 97% KX369547.1
2192 2192 100% 0.0 97% KU758877.1
2192 2192 100% 0.0 97% KU758873.1
2192 2192 100% 0.0 97% KX280026.1
2192 2192 100% 0.0 97% KX197192.1
2192 2192 100% 0.0 97% KX156775.1
2192 2192 100% 0.0 97% KX087102.1
2192 2192 100% 0.0 97% KU853013.1
2192 2192 100% 0.0 97% KU853012.1
2192 2192 100% 0.0 97% KU681082.3
2192 2192 100% 0.0 97% KU501217.1
2192 2192 100% 0.0 97% KU501216.1
2192 2192 100% 0.0 97% KU321639.1
2188 2188 100% 0.0 97% KX838904.1
2188 2188 100% 0.0 97% KU870645.1
2188 2188 100% 0.0 97% KU926310.1
2188 2188 99% 0.0 97% KU497555.1
2183 2183 100% 0.0 97% KX811222.1
2183 2183 100% 0.0 97% KX838905.1
2183 2183 100% 0.0 97% KX601168.1
2183 2183 100% 0.0 97% KX377337.1
2183 2183 100% 0.0 97% KU758872.1
2183 2183 100% 0.0 97% KX087101.2
2183 2183 100% 0.0 97% KX056898.1
2183 2183 100% 0.0 97% KU955590.1
2183 2183 100% 0.0 97% KU926309.1
2183 2183 100% 0.0 97% KU820898.1
2183 2183 100% 0.0 97% KU740184.2
2183 2183 100% 0.0 97% KU729217.2
2183 2183 100% 0.0 97% KU761564.1
2183 2183 100% 0.0 97% KU501215.1
2179 2179 100% 0.0 97% KX842449.1
2179 2179 100% 0.0 97% KX694532.1
2179 2179 100% 0.0 97% KU758875.1
2179 2179 100% 0.0 97% KU744693.1
2179 2179 100% 0.0 97% KU312312.1
2179 2179 100% 0.0 97% KF993678.1
2174 2174 100% 0.0 97% KX832731.1
2174 2174 100% 0.0 97% KU312313.1
1784 2051 92% 0.0 98% KX101060.1
1714 1714 99% 0.0 89% KF268950.1
1714 1714 99% 0.0 89% KF268948.1
1709 1709 99% 0.0 89% KX830960.1
1709 1709 99% 0.0 89% KU720415.1
1709 1709 99% 0.0 89% HQ234498.1
1705 1705 99% 0.0 89% KX830961.1
1705 1705 99% 0.0 89% KF383121.1
1705 1705 99% 0.0 89% KF383119.1
1700 1700 99% 0.0 89% KX377335.1
1696 1696 99% 0.0 89% LC002520.1
1685 1685 99% 0.0 88% DQ859059.1
1683 1683 99% 0.0 89% KU955595.1
1683 1683 99% 0.0 88% KF383115.1
1680 1680 99% 0.0 89% KX198134.1
1680 1680 99% 0.0 89% KU955592.1
1680 1680 99% 0.0 89% KF383116.1
1674 1674 99% 0.0 88% KU955591.1
1674 1674 99% 0.0 88% HQ234501.1
1671 1671 99% 0.0 88% KX601169.1
1671 1671 99% 0.0 88% KU963573.1
1667 1667 99% 0.0 88% KF268949.1
1665 1665 99% 0.0 88% KU955594.1
1662 1662 99% 0.0 88% AY632535.2
1651 1651 99% 0.0 88% KF383117.1
1615 1615 99% 0.0 87% KX601166.1
1611 1611 99% 0.0 87% KU963574.1
1611 1611 99% 0.0 87% HQ234500.1
1564 1564 99% 0.0 87% KF383118.1
1462 1462 99% 0.0 85% KF383120.1
1371 1371 61% 0.0 98% KX173841.1
1371 1371 61% 0.0 98% KX173840.1
1359 1359 64% 0.0 96% KU686218.1
1330 1330 60% 0.0 98% KU312315.1
1321 1321 59% 0.0 98% KX216640.1
1321 1321 59% 0.0 98% KX216635.1
1321 1321 59% 0.0 98% KX216634.1
1321 1321 59% 0.0 98% KJ634273.1
1315 1315 59% 0.0 98% KX216637.1
1315 1315 59% 0.0 98% KX216636.1
1315 1315 59% 0.0 98% KX216632.1
1315 1315 59% 0.0 98% LC171327.1
1312 1312 59% 0.0 98% KX380263.1
1312 1312 59% 0.0 98% KX216639.1
1312 1312 59% 0.0 98% KX216638.1
1312 1312 59% 0.0 98% KX216633.1
1312 1312 59% 0.0 98% KU646828.1
1306 1306 59% 0.0 98% KX380262.1
1306 1306 59% 0.0 98% KU646827.1
1229 1229 55% 0.0 98% KX173843.1
1223 1223 55% 0.0 98% KX173844.1
771 771 35% 0.0 97% AB908162.1
641 1700 78% 1e-179 98% KX101061.1
637 1504 76% 2e-178 98% KX101066.1
632 632 27% 7e-177 99% KU985088.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.