Sign in to follow this  
Followers 0
niman

2015 H5N6 Yunnan Sequences In Poultry

27 posts in this topic

Kunming University of Science and Technology in Yunnan has released 2015 poultry an environmental H5N6 sequences.

Share this post


Link to post
Share on other sites
LOCUS       KT963046                1701 bp    cRNA    linear   VRL 24-NOV-2015
DEFINITION  Influenza A virus (A/environment/Yunnan/YN19/2015(H5N6)) segment 4
            hemagglutinin (HA) gene, complete cds.
ACCESSION   KT963046
VERSION     KT963046.1  GI:953525540
KEYWORDS    .
SOURCE      Influenza A virus (A/environment/Yunnan/YN19/2015(H5N6))
  ORGANISM  Influenza A virus (A/environment/Yunnan/YN19/2015(H5N6))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1701)
  AUTHORS   Feng,Y., Guan,W., Yuan,B., Wang,Y., Li,Z., Song,Y., Li,S., Yang,Z.,
            Zhong,N., Xia,X. and Zhang,Y.
  TITLE     Suspected poultry origin of a reassortant avian influenza A H5N6
            virus from a fatal human case in Yunnan, China
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1701)
  AUTHORS   Feng,Y., Guan,W., Bing,Y., Wang,Y., Li,Z., Song,Y., Li,S., Yang,Z.,
            Zhong,N., Xia,X. and Zhang,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-OCT-2015) Kunming University of Science and
            Technology, Faculty of Life Science and Technology, No. 727 Jing
            Ming Road, Chenggong District, Kunming, Yunnan 650500, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1701
                     /organism="Influenza A virus
                     (A/environment/Yunnan/YN19/2015(H5N6))"
                     /mol_type="viral cRNA"
                     /strain="A/environment/Yunnan/YN19/2015"
                     /serotype="H5N6"
                     /isolation_source="fecal droppings"
                     /db_xref="taxon:1747098"
                     /segment="4"
                     /country="China"
                     /collection_date="16-Feb-2015"
     gene            1..1701
                     /gene="HA"
     CDS             1..1701
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="ALO75919.1"
                     /db_xref="GI:953525541"
                     /translation="MEKIVLLLAIVSLVKGDQICIGYHANNSTEQVDTIMEKNVTVTH
                     AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLHGNRMCDEFIRVPEWSYIVERANPA
                     NDLCYPGNLNDYEELKHLLSRINHFEKTLIIPKSSWPNHTSSGVSAACPYQGMPSFFR
                     NVVWLTKKNDAYPTIKMSYNNTYREDLLILWGIHHSNNAAEQTNLYKNPTTYVSVGTS
                     TLNQRLEPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKGD
                     STIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRN
                     SPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADRESTQKAIDGV
                     TNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENER
                     TLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPLYSE
                     EASLKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRICI
                     "
     sig_peptide     1..48
                     /gene="HA"
     mat_peptide     49..1032
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1033..1698
                     /gene="HA"
                     /product="HA2"
ORIGIN      
        1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaggtga tcagatttgc
       61 attggttacc atgcaaacaa ctcgacggag caggttgaca cgataatgga aaagaacgtc
      121 actgttacac atgcccaaga catactggaa aagacacaca atggaaagct ctgcgattta
      181 aatggagtga agcctctgat tttaaaggat tgtagtgtag ctggatggct ccatggaaac
      241 cgaatgtgtg acgagttcat cagagtgccg gaatggtctt acatagtgga gagggctaac
      301 ccagccaatg acctctgtta tccagggaac ctcaatgact atgaggaact gaaacaccta
      361 ttgagcagaa taaatcattt tgagaagact ctgatcatcc ccaagagttc ttggcccaat
      421 catacatcat caggggtgag tgcagcatgt ccataccagg gaatgccctc ctttttcaga
      481 aatgtggtat ggcttaccaa aaagaacgat gcatacccaa caataaagat gagctacaat
      541 aatacctata gggaagatct tttgatactg tgggggattc atcattccaa caatgcagca
      601 gagcagacaa atctctataa aaacccaacc acctatgttt ccgttgggac atcaacatta
      661 aaccagagat tggagccaaa aatagctact agatcccaag taaacgggca acgtggaaga
      721 atggatttct tctggaccat tttaaaaccg aatgatgcaa tccacttcga gagtaatgga
      781 aattttattg ctccagaata tgcatacaaa attgtcaaga aaggggactc aacaattatg
      841 aaaagtgaaa tggaatatgg gcactgcaac accaaatgtc aaactccaat aggggcgata
      901 aactctagta tgccattcca caatatacac cctctcacta tcggggagtg ccccaaatac
      961 gtgaaatcga acaaattagt ccttgcgact gggctcagaa atagtcctct aagagaaaga
     1021 agaagaaaaa gaggactatt tggagctata gcagggttta tagagggagg atggcaagga
     1081 atggtagatg gttggtatgg gtaccaccat agcaatgaac aggggagtgg gtacgctgca
     1141 gacagagaat ccacccaaaa ggcaatagat ggagttacca ataaggtcaa ctcgataata
     1201 gacaaaatga acactcaatt tgaggccgtt ggaagagaat ttaataactt agaacggaga
     1261 atagagaatt taaataagaa aatggaagac ggattcttag atgtctggac ttataatgct
     1321 gaacttttag ttctcatgga aaatgagaga actctagatt tccatgactc aaatgtcaag
     1381 aacctttatg acaaggtccg actacagctt agggataatg caaaggagct gggtaatggt
     1441 tgtttcgagt tctatcacaa atgtgataat gaatgtatgg aaagtgtaag aaatgggacg
     1501 tatgactacc ccctgtattc agaagaagcc agcttaaaaa gggaagaaat aagcggagtg
     1561 aaattggaat caataggaac ttaccaaata ctgtcaattt attcaacagt ggcgagttcc
     1621 ctagcactgg caatcatagt ggctggttta tctttatgga tgtgctccaa tgggtcgttg
     1681 cagtgcagaa tttgcattta a

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI641392A/chicken/Yunnan/19/2015 (A/H5N6) segment 4 (HA)3142.30.000000e+001701/1701 (100%)
text_code_colored.pngEPI641394A/chicken/Yunnan/22/2015 (A/H5N6) segment 4 (HA)3092.40.000000e+001692/1701 (99%)
text_code_colored.pngEPI641398A/Yunnan/0127/2015 (A/H5N6) segment 4 (HA)3009.30.000000e+001678/1702 (98%)
text_code_colored.pngEPI641396A/chicken/Yunnan/25A/2015 (A/H5N6) segment 4 (HA)3009.30.000000e+001678/1702 (98%)
text_code_colored.pngEPI550768A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA)2950.20.000000e+001670/1705 (97%)
text_code_colored.pngEPI550763A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA)2950.20.000000e+001670/1705 (97%)
text_code_colored.pngEPI550759A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA)2950.20.000000e+001670/1705 (97%)
text_code_colored.pngEPI550757A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA)2950.20.000000e+001670/1705 (97%)
text_code_colored.pngEPI550752A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA)2944.70.000000e+001669/1705 (97%)
text_code_colored.pngEPI602412A/chicken/Dongguan/2690/2013 (A/H5N6) segment 4 (HA)2928.10.000000e+001665/1704 (97%)
text_code_colored.pngEPI602045A/chicken/Dongguan/2818/2013 (A/H0) segment 4 (HA)2928.10.000000e+001665/1704 (97%)
text_code_colored.pngEPI599662A/goose/Shantou/1806/2014 (A/H5N6) segment 4 (HA)2922.50.000000e+001665/1705 (97%)
text_code_colored.pngEPI599655A/goose/Shantou/1791/2014 (A/H5N6) segment 4 (HA)2922.50.000000e+001665/1705 (97%)
text_code_colored.pngEPI599648A/goose/Shantou/1763/2014 (A/H5N6) segment 4 (HA)2922.50.000000e+001665/1705 (97%)
text_code_colored.pngEPI530054A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA)2922.50.000000e+001664/1704 (97%)
text_code_colored.pngEPI681296A/chicken/Zhejiang/727155/2014 (A/H5N6) segment 4 (HA)2917.00.000000e+001663/1704 (97%)
text_code_colored.pngEPI602419A/chicken/Dongguan/3363/2013 (A/H5N6) segment 4 (HA)2917.00.000000e+001663/1704 (97%)
text_code_colored.pngEPI599292A/chicken/Shenzhen/552/2013 (A/H5N6) segment 4 (HA)2917.00.000000e+001663/1704 (97%)
text_code_colored.pngEPI602028A/chicken/Dongguan/4190/2013 (A/H0) segment 4 (HA)2913.30.000000e+001662/1704 (97%)
text_code_colored.pngEPI681295A/chicken/Zhejiang/727026/2014 (A/H5N6) segment 4 (HA)2911.40.000000e+001662/1704 (97%)
text_code_colored.pngEPI681294A/chicken/Zhejiang/727022/2014 (A/H5N6) segment 4 (HA)2911.40.000000e+001662/1704 (97%)
text_code_colored.pngEPI681284A/chicken/Zhejiang/727159/2014 (A/H5N2) segment 4 (HA)2911.40.000000e+001662/1704 (97%)
text_code_colored.pngEPI681283A/chicken/Zhejiang/727079/2014 (A/H5N2) segment 4 (HA)2911.40.000000e+001662/1704 (97%)
text_code_colored.pngEPI599339A/duck/Dongguan/3069/2013 (A/H5N6) segment 4 (HA)2911.40.000000e+001662/1704 (97%)
text_code_colored.pngEPI599320A/chicken/Shenzhen/2464/2013 (A/H5N6) segment 4 (HA)2911.40.000000e+001662/1704 (97%)
text_code_colored.pngEPI599313A/chicken/Shenzhen/2396/2013 (A/H5N6) segment 4 (HA)2911.40.000000e+001662/1704 (97%)
text_code_colored.pngEPI599299A/chicken/Shenzhen/1395/2013 (A/H5N6) segment 4 (HA)2911.40.000000e+001662/1704 (97%)
text_code_colored.pngEPI681287A/goose/Zhejiang/727110/2014 (A/H5N6) segment 4 (HA)2905.90.000000e+001661/1704 (97%)
text_code_colored.pngEPI602491A/chicken/Shenzhen/2269/2013 (A/H5N6) segment 4 (HA)2905.90.000000e+001661/1704 (97%)
text_code_colored.pngEPI601941A/chicken/Dongguan/1100/2014 (A/H0) segment 4 (HA)2905.90.000000e+001661/1704 (97%)
text_code_colored.pngEPI599346A/chicken/Dongguan/4259/2013 (A/H5N6) segment 4 (HA)2905.90.000000e+001661/1704 (97%)
text_code_colored.pngEPI599333A/silkie chicken/Dongguan/2809/2013 (A/H5N6) segment 4 (HA)2905.90.000000e+001661/1704 (97%)
text_code_colored.pngEPI599327A/duck/Dongguan/2685/2013 (A/H5N6) segment 4 (HA)2905.90.000000e+001661/1704 (97%)
text_code_colored.pngEPI531456A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA)2905.90.000000e+001661/1704 (97%)
text_code_colored.pngEPI681285A/duck/Zhejiang/727158/2014 (A/H5N6) segment 4 (HA)2900.40.000000e+001660/1704 (97%)
text_code_colored.pngEPI602477A/chicken/Shenzhen/715/2013 (A/H5N6) segment 4 (HA)2900.40.000000e+001660/1704 (97%)
text_code_colored.pngEPI599285A/chicken/Shenzhen/433/2013 (A/H5N6) segment 4 (HA)2900.40.000000e+001660/1704 (97%)
text_code_colored.pngEPI645049A/swine/Guangdong/1/2014 (A/H5N6) segment 4 (HA)2898.50.000000e+001659/1703 (97%)
text_code_colored.pngEPI681286A/goose/Zhejiang/727092/2014 (A/H5N6) segment 4 (HA)2894.80.000000e+001659/1704 (97%)
text_code_colored.pngEPI681279A/duck/Zhejiang/727041/2014 (A/H5N2) segment 4 (HA)2894.80.000000e+001659/1704 (97%)
text_code_colored.pngEPI602103A/chicken/Shenzhen/2072/2013 (A/H0) segment 4 (HA)2894.80.000000e+001659/1704 (97%)
text_code_colored.pngEPI593889A/Guangzhou/39715/2014 (A/H5N6) segment 4 (HA)2894.80.000000e+001659/1704 (97%)
text_code_colored.pngEPI590813A/duck/Jiangxi/NCDZT1126/2014 (A/H5N6) segment 4 (HA)2894.80.000000e+001659/1704 (97%)
text_code_colored.pngEPI530063A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA)2894.80.000000e+001659/1704 (97%)
text_code_colored.pngEPI645042A/swine/Guangdong/2/2014 (A/H5N6) segment 4 (HA)2893.00.000000e+001658/1703 (97%)
text_code_colored.pngEPI590806A/duck/Jiangxi/NCDZT1123/2014 (A/H5N6) segment 4 (HA)2889.30.000000e+001658/1704 (97%)
text_code_colored.pngEPI596610A/duck/Vietnam/LBM758/2014 (A/H5N6) segment 4 (HA)2885.60.000000e+001657/1704 (97%)
text_code_colored.pngEPI596598A/muscovy duck/Vietnam/LBM756/2014 (A/H5N6) segment 4 (HA)2883.70.000000e+001657/1704 (97%)
text_code_colored.pngEPI596592A/muscovy duck/Vietnam/LBM755/2014 (A/H5N6) segment 4 (HA)2883.70.000000e+001657/1704 (97%)
text_code_colored.pngEPI596586A/muscovy duck/Vietnam/LBM754/2014 (A/H5N6) segment 4 (HA)2883.70.000000e+001657/1704 (97%)
text_code_colored.pngEPI596580A/duck/Vietnam/LBM752/2014 (A/H5N6) segment 4 (HA)2883.70.000000e+001657/1704 (97%)
text_code_colored.pngEPI596574A/duck/Vietnam/LBM751/2014 (A/H5N6) segment 4 (HA)2883.70.000000e+001657/1704 (97%)
text_code_colored.pngEPI593896A/duck/Guangzhou/41227/2014 (A/H5N6) segment 4 (HA)2883.70.000000e+001657/1704 (97%)
text_code_colored.pngEPI596622A/duck/Vietnam/LBM760/2014 (A/H5N6) segment 4 (HA)2878.20.000000e+001656/1704 (97%)
text_code_colored.pngEPI596616A/duck/Vietnam/LBM759/2014 (A/H5N6) segment 4 (HA)2878.20.000000e+001656/1704 (97%)
text_code_colored.pngEPI596604A/muscovy duck/Vietnam/LBM757/2014 (A/H5N6) segment 4 (HA)2878.20.000000e+001656/1704 (97%)
text_code_colored.pngEPI586256A/Little egret/Vietnam/WBT210/2014 (A/H5N6) segment 4 (HA)2878.20.000000e+001656/1704 (97%)
text_code_colored.pngEPI586255A/Black-crowned night heron/Vietnam/WBT198/2014 (A/H5N6) segment 4 (HA)2878.20.000000e+001656/1704 (97%)
text_code_colored.pngEPI586254A/Spotted dove/Vietnam/WBT191/2014 (A/H5N6) segment 4 (HA)2878.20.000000e+001656/1704 (97%)
text_code_colored.pngEPI602484A/chicken/Shenzhen/1061/2013 (A/H5N6) segment 4 (HA)2872.70.000000e+001655/1704 (97%)
text_code_colored.pngEPI586258A/Chinese pond heron/Vietnam/WBT231/2014 (A/H5N6) segment 4 (HA)2872.70.000000e+001655/1704 (97%)
text_code_colored.pngEPI682912A/duck/Wuhan/WHYF03/2015 (A/H5N6) segment 4 (HA)2861.60.000000e+001653/1704 (97%)
text_code_colored.pngEPI682911A/duck/Wuhan/WHYF02/2015 (A/H5N6) segment 4 (HA)2861.60.000000e+001653/1704 (97%)
text_code_colored.pngEPI676398A/environment/GZ/76/2014 (A/H5N2) segment 4 (HA)2861.60.000000e+001654/1705 (97%)
text_code_colored.pngEPI682939A/turtledove/Wuhan/HKBJ07/2015 (A/H5N6) segment 4 (HA)2856.00.000000e+001653/1705 (96%)
text_code_colored.pngEPI682938A/turtledove/Wuhan/WHBJ26/2014 (A/H5N6) segment 4 (HA)2856.00.000000e+001653/1705 (96%)
text_code_colored.pngEPI682937A/turtledove/Wuhan/HKBJ43/2015 (A/H5N6) segment 4 (HA)2856.00.000000e+001653/1705 (96%)
text_code_colored.pngEPI682936A/turtledove/Wuhan/HKBJ27/2015 (A/H5N6) segment 4 (HA)2856.00.000000e+001653/1705 (96%)
text_code_colored.pngEPI682935A/turtledove/Wuhan/WHBJ28/2014 (A/H5N6) segment 4 (HA)2856.00.000000e+001653/1705 (96%)
text_code_colored.pngEPI681288A/goose/Zhejiang/925036/2014 (A/H5N6) segment 4 (HA)2856.00.000000e+001652/1704 (96%)
text_code_colored.pngEPI586257A/Common moorhen/Vietnam/WBT226/2014 (A/H5N6) segment 4 (HA)2856.00.000000e+001652/1704 (96%)
text_code_colored.pngEPI682934A/turtledove/Wuhan/WHBJ12/2014 (A/H5N6) segment 4 (HA)2850.50.000000e+001652/1705 (96%)
text_code_colored.pngEPI682914A/chicken/Wuhan/WHYJ02/2015 (A/H5N6) segment 4 (HA)2850.50.000000e+001651/1704 (96%)
text_code_colored.pngEPI682913A/chicken/Wuhan/WHYJ01/2015 (A/H5N6) segment 4 (HA)2850.50.000000e+001651/1704 (96%)
text_code_colored.pngEPI590898A/pigeon/Sichuan/NCXN29/2014 (A/H5N1) segment 4 (HA)2800.60.000000e+001642/1704 (96%)
text_code_colored.pngEPI590897A/duck/Sichuan/NCXN11/2014 (A/H5N1) segment 4 (HA)2800.60.000000e+001642/1704 (96%)
text_code_colored.pngEPI593747A/goose/Shandong/k1201/2009 (A/H5N1) segment 4 (HA)2795.10.000000e+001644/1707 (96%)
text_code_colored.pngEPI442017A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA)2795.10.000000e+001644/1707 (96%)
text_code_colored.pngEPI398966A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA)2795.10.000000e+001643/1706 (96%)
text_code_colored.pngEPI676397A/environment/GZ/75/2014 (A/H5N6) segment 4 (HA)2789.60.000000e+001643/1707 (96%)
text_code_colored.pngEPI590896A/duck/Sichuan/NCXN10/2014 (A/H5N1) segment 4 (HA)2789.60.000000e+001641/1705 (96%)
text_code_colored.pngEPI475579A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA)2789.60.000000e+001643/1707 (96%)
text_code_colored.pngEPI590116A/chicken/Tonghai/802/2014 (A/H5N1) segment 4 (HA)2784.00.000000e+001639/1704 (96%)
text_code_colored.pngEPI590115A/chicken/Tonghai/5/2014 (A/H5N1) segment 4 (HA)2784.00.000000e+001639/1704 (96%)
text_code_colored.pngEPI590114A/chicken/Tonghai/3/2014 (A/H5N1) segment 4 (HA)2784.00.000000e+001639/1704 (96%)
text_code_colored.pngEPI590109A/chicken/AnNing/1/2014 (A/H5N1) segment 4 (HA)2784.00.000000e+001639/1704 (96%)
text_code_colored.pngEPI585951A/chicken/TongHai/302/2014 (A/H5N1) segment 4 (HA)2784.00.000000e+001639/1704 (96%)
text_code_colored.pngEPI398965A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA)2778.50.000000e+001641/1707 (96%)
text_code_colored.pngEPI682917A/duck/Taizhou/TZYG12/2015 (A/H5N6) segment 4 (HA)2772.90.000000e+001639/1706 (96%)
text_code_colored.pngEPI682916A/duck/Wuhan/JXYFB22/2015 (A/H5N6) segment 4 (HA)2772.90.000000e+001637/1704 (96%)
text_code_colored.pngEPI590111A/chicken/AnNing/6/2014 (A/H5N1) segment 4 (HA)2772.90.000000e+001638/1705 (96%)
text_code_colored.pngEPI431456A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA)2772.90.000000e+001640/1707 (96%)
text_code_colored.pngEPI590110A/chicken/AnNing/4/2014 (A/H5N1) segment 4 (HA)2767.40.000000e+001636/1704 (96%)
text_code_colored.pngEPI591879A/duck/Jiangxi/23970/2013 (A/H0) segment 4 (HA)2756.30.000000e+001637/1707 (95%)
text_code_colored.pngEPI431448A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA)2752.60.000000e+001637/1708 (95%)
text_code_colored.pngEPI509698A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA)2750.80.000000e+001636/1707 (95%)
text_code_colored.pngEPI399960A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA)2750.80.000000e+001637/1708 (95%)
text_code_colored.pngEPI590113A/chicken/DaLi/502/2014 (A/H5N1) segment 4 (HA)2745.20.000000e+001633/1705 (95%)
text_code_colored.pngEPI590112A/chicken/DaLi/302/2014 (A/H5N1) segment 4 (HA)2745.20.000000e+001633/1705 (95%)
text_code_colored.pngEPI544892A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA)2745.20.000000e+001635/1707 (95%)
text_code_colored.pngEPI681300A/goose/Zhejiang/925104/2014 (A/H5N8) segment 4 (HA)2739.70.000000e+001634/1707 (95%)
text_code_colored.pngEPI681299A/goose/Zhejiang/925037/2014 (A/H5N8) segment 4 (HA)2739.70.000000e+001634/1707 (95%)
text_code_colored.pngEPI672795A/duck/Guangdong/s14044/2014 (A/H5N8) segment 4 (HA)2739.70.000000e+001634/1707 (95%)
text_code_colored.pngEPI672787A/goose/Guangdong/s13124/2013 (A/H5N8) segment 4 (HA)2739.70.000000e+001634/1707 (95%)
text_code_colored.pngEPI561495A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 4 (HA)2739.70.000000e+001634/1707 (95%)
text_code_colored.pngEPI493825A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA)2734.20.000000e+001636/1710 (95%)
text_code_colored.pngEPI602037A/duck/Ningbo/3262/2013 (A/H0) segment 4 (HA)2728.60.000000e+001632/1707 (95%)
text_code_colored.pngEPI583870A/duck/Shaoxing/5240/2013 (A/H0) segment 4 (HA)2728.60.000000e+001632/1707 (95%)
text_code_colored.pngEPI681280A/goose/Zhejiang/77166/2014 (A/H5N2) segment 4 (HA)2724.90.000000e+001630/1705 (95%)
text_code_colored.pngEPI602094A/chicken/Shenzhen/712/2013 (A/H0) segment 4 (HA)2723.10.000000e+001632/1708 (95%)
text_code_colored.pngEPI530986A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA)2723.10.000000e+001631/1707 (95%)
text_code_colored.pngEPI681290A/goose/Zhejiang/925106/2014 (A/H5N6) segment 4 (HA)2717.50.000000e+001630/1707 (95%)
text_code_colored.pngEPI530985A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA)2717.50.000000e+001630/1707 (95%)
text_code_colored.pngEPI682915A/duck/Wenzhou/YHQL22/2014 (A/H5N6) segment 4 (HA)2712.00.000000e+001629/1707 (95%)
text_code_colored.pngEPI681298A/duck/Zhejiang/925169/2014 (A/H5N8) segment 4 (HA)2712.00.000000e+001629/1707 (95%)
text_code_colored.pngEPI602113A/environment/Jiangxi/10170/2014 (A/H5N6) segment 4 (HA)2712.00.000000e+001630/1708 (95%)
text_code_colored.pngEPI601997A/black chicken/Jiangxi/10139/2014 (A/H0) segment 4 (HA)2712.00.000000e+001630/1708 (95%)
text_code_colored.pngEPI599369A/environment/Jiangxi/10171/2014 (A/H5N6) segment 4 (HA)2712.00.000000e+001630/1708 (95%)
text_code_colored.pngEPI599360A/environment/Jiangxi/10164/2014 (A/H5N6) segment 4 (HA)2712.00.000000e+001630/1708 (95%)
text_code_colored.pngEPI599353A/duck/Jiangxi/10160/2014 (A/H5N6) segment 4 (HA)2712.00.000000e+001630/1708 (95%)
text_code_colored.pngEPI585724A/cat/Sichuan/SC18/2014 (A/H5N6) segment 4 (HA)2712.00.000000e+001630/1708 (95%)
text_code_colored.pngEPI569711A/duck/Zhejiang/6D2/2013 (A/H5N6) segment 4 (HA)2712.00.000000e+001630/1708 (95%)
text_code_colored.pngEPI569710A/chicken/Zhejiang/6C2/2013 (A/H5N6) segment 4 (HA)2712.00.000000e+001630/1708 (95%)
text_code_colored.pngEPI533583A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA)2712.00.000000e+001630/1708 (95%)
text_code_colored.pngEPI507673A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA)2712.00.000000e+001629/1707 (95%)
text_code_colored.pngEPI499478A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA)2712.00.000000e+001629/1707 (95%)
text_code_colored.pngEPI493817A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA)2712.00.000000e+001634/1712 (95%)
text_code_colored.pngEPI602107A/black chicken/Jiangxi/10129/2014 (A/H5N6) segment 4 (HA)2706.50.000000e+001629/1708 (95%)
text_code_colored.pngEPI601986A/black chicken/Jiangxi/10136/2014 (A/H0) segment 4 (HA)2706.50.000000e+001629/1708 (95%)
text_code_colored.pngEPI601977A/black chicken/Jiangxi/10131/2014 (A/H0) segment 4 (HA)2706.50.000000e+001629/1708 (95%)
text_code_colored.pngEPI599306A/chicken/Shenzhen/1845/2013 (A/H5N6) segment 4 (HA)2706.50.000000e+001629/1708 (95%)
text_code_colored.pngEPI590894A/duck/Sichuan/NCXJ24/2014 (A/H5N6) segment 4 (HA)2706.50.000000e+001629/1708 (95%)
text_code_colored.pngEPI590893A/duck/Sichuan/NCXJ16/2014 (A/H5N6) segment 4 (HA)2706.50.000000e+001629/1708 (95%)
text_code_colored.pngEPI590890A/chicken/Sichuan/NCJPL1/2014 (A/H5N6) segment 4 (HA)2706.50.000000e+001629/1708 (95%)
text_code_colored.pngEPI547402A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA)2706.50.000000e+001629/1708 (95%)
text_code_colored.pngEPI602056A/chicken/Jiangxi/10122/2014 (A/H0) segment 4 (HA)2702.80.000000e+001628/1708 (95%)
text_code_colored.pngEPI681297A/duck/Zhejiang/925019/2014 (A/H5N8) segment 4 (HA)2700.90.000000e+001627/1707 (95%)
text_code_colored.pngEPI681281A/goose/Zhejiang/77167/2014 (A/H5N2) segment 4 (HA)2695.40.000000e+001627/1708 (95%)
text_code_colored.pngEPI681282A/goose/Zhejiang/77168/2014 (A/H5N2) segment 4 (HA)2689.80.000000e+001626/1708 (95%)
text_code_colored.pngEPI681278A/duck/Zhejiang/77138/2014 (A/H5N2) segment 4 (HA)2689.80.000000e+001626/1708 (95%)
text_code_colored.pngEPI676399A/environment/GZ/77/2014 (A/H5N6) segment 4 (HA)2689.80.000000e+001627/1709 (95%)
text_code_colored.pngEPI573197A/chicken/Korea/H881/2014 (A/H5N8) segment 4 (HA)2689.80.000000e+001627/1709 (95%)
text_code_colored.pngEPI561612A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA)2689.80.000000e+001627/1709 (95%)
text_code_colored.pngEPI590892A/duck/Sichuan/NCXJ15/2014 (A/H5N6) segment 4 (HA)2684.30.000000e+001625/1708 (95%)
text_code_colored.pngEPI590891A/duck/Sichuan/NCJPL7/2014 (A/H5N6) segment 4 (HA)2684.30.000000e+001625/1708 (95%)
text_code_colored.pngEPI585731A/swan goose/Jilin/JL01/2014 (A/H5N6) segment 4 (HA)2684.30.000000e+001625/1708 (95%)
text_code_colored.pngEPI585595A/baikal teal/Korea/2417/2014 (A/H5N8) segment 4 (HA)2684.30.000000e+001626/1709 (95%)
text_code_colored.pngEPI585589A/baikal teal/Korea/2399/2014 (A/H5N8) segment 4 (HA)2684.30.000000e+001626/1709 (95%)
text_code_colored.pngEPI585586A/baikal teal/Korea/1456/2014 (A/H5N8) segment 4 (HA)2684.30.000000e+001626/1709 (95%)
text_code_colored.pngEPI573242A/Common Teal/Korea/H844/2014 (A/H5N8) segment 4 (HA)2684.30.000000e+001626/1709 (95%)
text_code_colored.pngEPI561646A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA)2684.30.000000e+001626/1709 (95%)
text_code_colored.pngEPI561626A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA)2684.30.000000e+001626/1709 (95%)
text_code_colored.pngEPI561605A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA)2684.30.000000e+001626/1709 (95%)
text_code_colored.pngEPI561591A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA)2684.30.000000e+001626/1709 (95%)
text_code_colored.pngEPI561529A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA)2684.30.000000e+001626/1709 (95%)
text_code_colored.pngEPI561508A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA)2684.30.000000e+001626/1709 (95%)
text_code_colored.pngEPI561341A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA)2684.30.000000e+001626/1709 (95%)
text_code_colored.pngEPI602181A/duck/Jiangxi/13484/2014 (A/H5N6) segment 4 (HA)2678.80.000000e+001624/1708 (95%)
text_code_colored.pngEPI602167A/duck/Jiangxi/13469/2014 (A/H5N6) segment 4 (HA)2678.80.000000e+001624/1708 (95%)
text_code_colored.pngEPI590895A/environment/Sichuan/NCLL1/2014 (A/H5N6) segment 4 (HA)2678.80.000000e+001624/1708 (95%)
text_code_colored.pngEPI590889A/Anas_crecca/Hubei/Chenhu1623-5/2014 (A/H5N6) segment 4 (HA)2678.80.000000e+001624/1708 (95%)
text_code_colored.pngEPI585594A/baikal teal/Korea/2416/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI585592A/baikal teal/Korea/2406/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI585591A/baikal teal/Korea/2403/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI585590A/baikal teal/Korea/2402/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI585582A/baikal teal/Korea/1448/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI585581A/baikal teal/Korea/1447/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001626/1710 (95%)
text_code_colored.pngEPI585579A/baikal teal/Korea/1445/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI585577A/baikal teal/Korea/1437/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI573200A/Korean native chicken/Korea/H1139/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI573199A/breeder chicken/Korea/H1068/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001626/1710 (95%)
text_code_colored.pngEPI561674A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI561577A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI561570A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI561563A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI561542A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI561522A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA)2678.80.000000e+001625/1709 (95%)
text_code_colored.pngEPI328878A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA)2678.80.000000e+001627/1711 (95%)
text_code_colored.pngEPI681293A/goose/Zhejiang/1120132/2014 (A/H5N6) segment 4 (HA)2673.20.000000e+001623/1708 (95%)
text_code_colored.pngEPI602174A/duck/Jiangxi/13475/2014 (A/H5N6) segment 4 (HA)2673.20.000000e+001623/1708 (95%)
text_code_colored.pngEPI585593A/baikal teal/Korea/2414/2014 (A/H5N8) segment 4 (HA)2673.20.000000e+001624/1709 (95%)
text_code_colored.pngEPI585587A/baikal teal/Korea/1457/2014 (A/H5N8) segment 4 (HA)2673.20.000000e+001624/1709 (95%)
text_code_colored.pngEPI585584A/baikal teal/Korea/1452/2014 (A/H5N8) segment 4 (HA)2673.20.000000e+001624/1709 (95%)
text_code_colored.pngEPI585583A/baikal teal/Korea/1449/2014 (A/H5N8) segment 4 (HA)2673.20.000000e+001624/1709 (95%)
text_code_colored.pngEPI573192A/breeder chicken/Korea/H503/2014 (A/H5N8) segment 4 (HA)2673.20.000000e+001624/1709 (95%)
text_code_colored.pngEPI561705A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA)2673.20.000000e+001624/1709 (95%)
text_code_colored.pngEPI561667A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA)2673.20.000000e+001624/1709 (95%)
text_code_colored.pngEPI561653A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA)2673.20.000000e+001624/1709 (95%)
text_code_colored.pngEPI561633A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA)2673.20.000000e+001624/1709 (95%)
text_code_colored.pngEPI509709A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA)2673.20.000000e+001624/1709 (95%)
text_code_colored.pngEPI509704A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA)2673.20.000000e+001624/1709 (95%)
text_code_colored.pngEPI585585A/baikal teal/Korea/1454/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI585580A/baikal teal/Korea/1446/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI585578A/baikal teal/Korea/1441/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI585379A/duck/Vietnam/1144/2014 (A/H5N6) segment 4 (HA)2667.70.000000e+001622/1708 (94%)
text_code_colored.pngEPI585378A/duck/Vietnam/1434/2014 (A/H5N6) segment 4 (HA)2667.70.000000e+001622/1708 (94%)
text_code_colored.pngEPI585376A/duck/Vietnam/1507/2014 (A/H5N6) segment 4 (HA)2667.70.000000e+001622/1708 (94%)
text_code_colored.pngEPI585374A/duck/Vietnam/1152/2014 (A/H5N6) segment 4 (HA)2667.70.000000e+001622/1708 (94%)
text_code_colored.pngEPI573208A/gadwall/Korea/H1351/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001624/1710 (94%)
text_code_colored.pngEPI573196A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI573194A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI561697A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI561681A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI561660A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI561598A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI561515A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI561360A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI561348A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI561336A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI561204A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI561196A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI561187A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI517161A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA)2667.70.000000e+001623/1709 (94%)
text_code_colored.pngEPI681292A/goose/Zhejiang/112080/2014 (A/H5N6) segment 4 (HA)2662.10.000000e+001622/1709 (94%)
text_code_colored.pngEPI681289A/goose/Zhejiang/925105/2014 (A/H5N6) segment 4 (HA)2662.10.000000e+001622/1709 (94%)
text_code_colored.pngEPI585588A/baikal teal/Korea/1458/2014 (A/H5N8) segment 4 (HA)2662.10.000000e+001622/1709 (94%)
text_code_colored.pngEPI585377A/duck/Vietnam/1511/2014 (A/H5N6) segment 4 (HA)2662.10.000000e+001621/1708 (94%)
text_code_colored.pngEPI573207A/chicken/Korea/H1350/2014 (A/H5N8) segment 4 (HA)2662.10.000000e+001622/1709 (94%)
text_code_colored.pngEPI573201A/chicken/Korea/H1236/2014 (A/H5N8) segment 4 (HA)2662.10.000000e+001622/1709 (94%)
text_code_colored.pngEPI561690A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA)2662.10.000000e+001622/1709 (94%)
text_code_colored.pngEPI561556A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA)2662.10.000000e+001623/1710 (94%)
text_code_colored.pngEPI561549A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA)2662.10.000000e+001623/1710 (94%)
text_code_colored.pngEPI542628A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA)2662.10.000000e+001622/1709 (94%)
text_code_colored.pngEPI493833A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA)2660.30.000000e+001626/1714 (94%)
text_code_colored.pngEPI676400A/environment/GZ/NIOSH-187/2014 (A/H5N6) segment 4 (HA)2656.60.000000e+001620/1708 (94%)
text_code_colored.pngEPI589841A/duck/Nha Trang/75c131/2014 (A/H5N6) segment 4 (HA)2656.60.000000e+001620/1708 (94%)
text_code_colored.pngEPI589366A/muscovy duck/Quang Ninh/4c111/2013 (A/H5N6) segment 4 (HA)2656.60.000000e+001620/1708 (94%)
text_code_colored.pngEPI573240A/breeder duck/Korea/H345/2014 (A/H5N8) segment 4 (HA)2656.60.000000e+001621/1709 (94%)
text_code_colored.pngEPI573203A/chicken/Korea/H1292/2014 (A/H5N8) segment 4 (HA)2656.60.000000e+001622/1710 (94%)
text_code_colored.pngEPI573202A/chicken/Korea/H1268/2014 (A/H5N8) segment 4 (HA)2656.60.000000e+001621/1709 (94%)
text_code_colored.pngEPI573195A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA)2656.60.000000e+001621/1709 (94%)
text_code_colored.pngEPI585389A/duck/Vietnam/1151/2014 (A/H5N6) segment 4 (HA)2652.90.000000e+001614/1700 (94%)
text_code_colored.pngEPI681291A/goose/Zhejiang/925108/2014 (A/H5N6) segment 4 (HA)2651.10.000000e+001620/1709 (94%)
text_code_colored.pngEPI589373A/muscovy duck/Quang Ninh/5c112/2013 (A/H5N6) segment 4 (HA)2651.10.000000e+001619/1708 (94%)
text_code_colored.pngEPI561619A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA)2651.10.000000e+001620/1709 (94%)
text_code_colored.pngEPI573241A/breeder duck/Korea/H566/2014 (A/H5N8) segment 4 (HA)2645.50.000000e+001619/1709 (94%)
text_code_colored.pngEPI573205A/Korean native chicken/Korea/H1299/2014 (A/H5N8) segment 4 (HA)2645.50.000000e+001619/1709 (94%)
text_code_colored.pngEPI573204A/goose/Korea/H1296/2014 (A/H5N8) segment 4 (HA)2645.50.000000e+001619/1709 (94%)
text_code_colored.pngEPI328870A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA)2645.50.000000e+001621/1711 (94%)
text_code_colored.pngEPI593753A/goose/Yangzhou/ZG62/2011 (A/H5N5) segment 4 (HA)2640.00.000000e+001620/1711 (94%)
text_code_colored.pngEPI573198A/broiler duck/Korea/H959/2014 (A/H5N8) segment 4 (HA)2640.00.000000e+001618/1709 (94%)
text_code_colored.pngEPI328886A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA)2640.00.000000e+001620/1711 (94%)
text_code_colored.pngEPI573218A/Korean native chicken/Korea/H1687/2014 (A/H5N8) segment 4 (HA)2634.40.000000e+001617/1709 (94%)
text_code_colored.pngEPI573217A/broiler duck/Korea/H1685/2014 (A/H5N8) segment 4 (HA)2634.40.000000e+001617/1709 (94%)
text_code_colored.pngEPI573216A/broiler duck/Korea/H1683/2014 (A/H5N8) segment 4 (HA)2634.40.000000e+001617/1709 (94%)
text_code_colored.pngEPI573212A/Korean native chicken/Korea/H1554/2014 (A/H5N8) segment 4 (HA)2634.40.000000e+001618/1710 (94%)
text_code_colored.pngEPI573211A/goose/Korea/H1545/2014 (A/H5N8) segment 4 (HA)2634.40.000000e+001618/1710 (94%)
text_code_colored.pngEPI573210A/broiler duck/Korea/H1414/2014 (A/H5N8) segment 4 (HA)2634.40.000000e+001617/1709 (94%)
text_code_colored.pngEPI573209A/broiler duck/Korea/H1413/2014 (A/H5N8) segment 4 (HA)2634.40.000000e+001617/1709 (94%)
text_code_colored.pngEPI573206A/breeder duck/Korea/H1343/2014 (A/H5N8) segment 4 (HA)2634.40.000000e+001617/1709 (94%)
text_code_colored.pngEPI550849A/duck/England/36226/14 (A/H5N8) segment 4 (HA)2634.40.000000e+001617/1709 (94%)
text_code_colored.pngEPI550848A/duck/England/36038/14 (A/H5N8) segment 4 (HA)2634.40.000000e+001617/1709 (94%)
text_code_colored.pngEPI442025A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA)2632.60.000000e+001621/1714 (94%)
text_code_colored.pngEPI595055A/common teal/Korea/KU-12/2015 (A/H5N8) segment 4 (HA)2628.90.000000e+001617/1710 (94%)
text_code_colored.pngEPI588968A/chicken/Taiwan/a174/2015 (A/H5N3) segment 4 (HA)2628.90.000000e+001618/1711 (94%)
text_code_colored.pngEPI573638A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA)2628.90.000000e+001618/1711 (94%)
text_code_colored.pngEPI573219A/goose/Korea/H1689/2014 (A/H5N8) segment 4 (HA)2628.90.000000e+001616/1709 (94%)
text_code_colored.pngEPI573213A/broiler duck/Korea/H1556/2014 (A/H5N8) segment 4 (HA)2628.90.000000e+001617/1710 (94%)
text_code_colored.pngEPI553349A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA)2628.90.000000e+001616/1709 (94%)
text_code_colored.pngEPI576384A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 4 (HA)2625.20.000000e+001615/1709 (94%)
text_code_colored.pngEPI662744A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 4 (HA)2623.40.000000e+001616/1710 (94%)
text_code_colored.pngEPI662723A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 4 (HA)2623.40.000000e+001616/1710 (94%)
text_code_colored.pngEPI662688A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 4 (HA)2623.40.000000e+001616/1710 (94%)
text_code_colored.pngEPI595066A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 4 (HA)2623.40.000000e+001616/1710 (94%)
text_code_colored.pngEPI590740A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 4 (HA)2623.40.000000e+001616/1710 (94%)
text_code_colored.pngEPI576391A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 4 (HA)2623.40.000000e+001615/1709 (94%)
text_code_colored.pngEPI573235A/Korean native chicken/Korea/H1903/2014 (A/H5N8) segment 4 (HA)2623.40.000000e+001613/1707 (94%)
text_code_colored.pngEPI573228A/broiler duck/Korea/H1755/2014 (A/H5N8) segment 4 (HA)2623.40.000000e+001613/1707 (94%)
text_code_colored.pngEPI573227A/breeder duck/Korea/H1752/2014 (A/H5N8) segment 4 (HA)2623.40.000000e+001613/1707 (94%)
text_code_colored.pngEPI573222A/broiler duck/Korea/H1733/2014 (A/H5N8) segment 4 (HA)2623.40.000000e+001613/1707 (94%)
text_code_colored.pngEPI573220A/goose/Korea/H1698/2014 (A/H5N8) segment 4 (HA)2623.40.000000e+001615/1709 (94%)
text_code_colored.pngEPI573215A/breeder duck/Korea/H1596/2014 (A/H5N8) segment 4 (HA)2623.40.000000e+001615/1709 (94%)
text_code_colored.pngEPI573214A/broiler duck/Korea/H1582/2014 (A/H5N8) segment 4 (HA)2623.40.000000e+001615/1709 (94%)
text_code_colored.pngEPI573179A/duck/Netherlands/14015898/2014 (A/H5N8) segment 4 (HA)2623.40.000000e+001615/1709 (94%)
text_code_colored.pngEPI553343A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA)2623.40.000000e+001616/1710 (94%)
text_code_colored.pngEPI548493A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA)2623.40.000000e+001615/1709 (94%)
text_code_colored.pngEPI548485A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA)2623.40.000000e+001615/1709 (94%)
text_code_colored.pngEPI547673A/duck/England/36254/14 (A/H5N8) segment 4 (HA)2623.40.000000e+001616/1710 (94%)
text_code_colored.pngEPI586534A/chicken/BC/FAV22/2014 (A/H5N2) segment 4 (HA)2619.70.000000e+001617/1712 (94%)
text_code_colored.pngEPI662737A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 4 (HA)2617.80.000000e+001615/1710 (94%)
text_code_colored.pngEPI662701A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 4 (HA)2617.80.000000e+001616/1711 (94%)
text_code_colored.pngEPI620408A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 4 (HA)2617.80.000000e+001615/1710 (94%)
text_code_colored.pngEPI595138A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001615/1710 (94%)
text_code_colored.pngEPI595133A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001615/1710 (94%)
text_code_colored.pngEPI595124A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001615/1710 (94%)
text_code_colored.pngEPI595116A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001615/1710 (94%)
text_code_colored.pngEPI595107A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001615/1710 (94%)
text_code_colored.pngEPI595094A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001615/1710 (94%)
text_code_colored.pngEPI590726A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 4 (HA)2617.80.000000e+001615/1710 (94%)
text_code_colored.pngEPI590712A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 4 (HA)2617.80.000000e+001616/1711 (94%)
text_code_colored.pngEPI588960A/duck/Taiwan/a043/2015 (A/H5N2) segment 4 (HA)2617.80.000000e+001617/1712 (94%)
text_code_colored.pngEPI587521A/American wigeon/BC/050-31/2015 (A/H5N8) segment 4 (HA)2617.80.000000e+001617/1712 (94%)
text_code_colored.pngEPI586550A/chicken/BC/FAV24/2014 (A/H5N2) segment 4 (HA)2617.80.000000e+001617/1712 (94%)
text_code_colored.pngEPI586518A/chicken/BC/FAV20/2014 (A/H5N2) segment 4 (HA)2617.80.000000e+001617/1712 (94%)
text_code_colored.pngEPI586509A/poultry/BC/FAV19/2014 (A/H5N2) segment 4 (HA)2617.80.000000e+001617/1712 (94%)
text_code_colored.pngEPI585084A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 4 (HA)2617.80.000000e+001617/1712 (94%)
text_code_colored.pngEPI584079A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA)2617.80.000000e+001617/1712 (94%)
text_code_colored.pngEPI576477A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA)2617.80.000000e+001615/1710 (94%)
text_code_colored.pngEPI573654A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 4 (HA)2617.80.000000e+001616/1711 (94%)
text_code_colored.pngEPI573646A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 4 (HA)2617.80.000000e+001616/1711 (94%)
text_code_colored.pngEPI573298A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA)2617.80.000000e+001617/1712 (94%)
text_code_colored.pngEPI573239A/mallard/Korea/H1924-6/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001614/1709 (94%)
text_code_colored.pngEPI573229A/broiler duck/Korea/H1763/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001612/1707 (94%)
text_code_colored.pngEPI573226A/Korean native chicken/Korea/H1747/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001614/1709 (94%)
text_code_colored.pngEPI573224A/broiler duck/Korea/H1739/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001612/1707 (94%)
text_code_colored.pngEPI573187A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001614/1709 (94%)
text_code_colored.pngEPI573171A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 4 (HA)2617.80.000000e+001614/1709 (94%)
text_code_colored.pngEPI569383A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA)2617.80.000000e+001617/1712 (94%)
text_code_colored.pngEPI595146A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 4 (HA)2614.10.000000e+001614/1710 (94%)
text_code_colored.pngEPI595082A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 4 (HA)2614.10.000000e+001614/1710 (94%)
text_code_colored.pngEPI662709A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 4 (HA)2612.30.000000e+001614/1710 (94%)
text_code_colored.pngEPI595079A/mallard/Korea/N15-99/2015 (A/H5N8) segment 4 (HA)2612.30.000000e+001615/1711 (94%)
text_code_colored.pngEPI590733A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 4 (HA)2612.30.000000e+001616/1712 (94%)
text_code_colored.pngEPI590719A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 4 (HA)2612.30.000000e+001616/1712 (94%)
text_code_colored.pngEPI590685A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 4 (HA)2612.30.000000e+001614/1710 (94%)
text_code_colored.pngEPI588976A/duck/Taiwan/a068/2015 (A/H5N8) segment 4 (HA)2612.30.000000e+001616/1712 (94%)
text_code_colored.pngEPI586542A/chicken/BC/FAV23/2014 (A/H5N2) segment 4 (HA)2612.30.000000e+001616/1712 (94%)
text_code_colored.pngEPI586526A/chicken/BC/FAV21/2014 (A/H5N2) segment 4 (HA)2612.30.000000e+001617/1713 (94%)
text_code_colored.pngEPI586493A/poultry/BC/FAV15/2014 (A/H5N2) segment 4 (HA)2612.30.000000e+001616/1712 (94%)
text_code_colored.pngEPI585092A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 4 (HA)2612.30.000000e+001616/1712 (94%)
text_code_colored.pngEPI576470A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA)2612.30.000000e+001616/1712 (94%)
text_code_colored.pngEPI573664A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 4 (HA)2612.30.000000e+001615/1711 (94%)
text_code_colored.pngEPI573233A/Korean native chicken/Korea/H1847/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001613/1709 (94%)
text_code_colored.pngEPI573231A/broiler duck/Korea/H1839/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001611/1707 (94%)
text_code_colored.pngEPI573225A/broiler duck/Korea/H1745/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001611/1707 (94%)
text_code_colored.pngEPI573223A/broiler duck/Korea/H1734/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001611/1707 (94%)
text_code_colored.pngEPI573221A/broiler duck/Korea/H1731/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001611/1707 (94%)
text_code_colored.pngEPI573163A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001613/1709 (94%)
text_code_colored.pngEPI569390A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001616/1712 (94%)
text_code_colored.pngEPI569376A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001616/1712 (94%)
text_code_colored.pngEPI569372A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001616/1712 (94%)
text_code_colored.pngEPI553362A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001613/1709 (94%)
text_code_colored.pngEPI552746A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001613/1709 (94%)
text_code_colored.pngEPI547678A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA)2612.30.000000e+001613/1709 (94%)
text_code_colored.pngEPI662730A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 4 (HA)2606.70.000000e+001614/1711 (94%)
text_code_colored.pngEPI662716A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 4 (HA)2606.70.000000e+001613/1710 (94%)
text_code_colored.pngEPI662694A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 4 (HA)2606.70.000000e+001614/1711 (94%)
text_code_colored.pngEPI620422A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 4 (HA)2606.70.000000e+001614/1711 (94%)
text_code_colored.pngEPI590699A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 4 (HA)2606.70.000000e+001616/1713 (94%)
text_code_colored.pngEPI590692A/chicken/Washington/3490-18/2015 (A/H5N2) segment 4 (HA)2606.70.000000e+001615/1712 (94%)
text_code_colored.pngEPI587633A/chicken/Iowa/04-20/2015 (A/H5N2) segment 4 (HA)2606.70.000000e+001615/1712 (94%)
text_code_colored.pngEPI586501A/poultry/BC/FAV17/2014 (A/H5N2) segment 4 (HA)2606.70.000000e+001616/1713 (94%)
text_code_colored.pngEPI573680A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 4 (HA)2606.70.000000e+001614/1711 (94%)
text_code_colored.pngEPI573672A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 4 (HA)2606.70.000000e+001614/1711 (94%)
text_code_colored.pngEPI573281A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA)2606.70.000000e+001615/1712 (94%)
text_code_colored.pngEPI573238A/mallard/Korea/H2003/2014 (A/H5N8) segment 4 (HA)2606.70.000000e+001613/1710 (94%)
text_code_colored.pngEPI573237A/mallard/Korea/H1991/2014 (A/H5N8) segment 4 (HA)2606.70.000000e+001613/1710 (94%)
text_code_colored.pngEPI573236A/spot-billed duck/Korea/H1981/2014 (A/H5N8) segment 4 (HA)2606.70.000000e+001613/1710 (94%)
text_code_colored.pngEPI573230A/broiler duck/Korea/H1803/2014 (A/H5N8) segment 4 (HA)2606.70.000000e+001611/1708 (94%)
text_code_colored.pngEPI548623A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA)2606.70.000000e+001612/1709 (94%)
text_code_colored.pngEPI553208A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA)2604.90.000000e+001611/1707 (94%)
text_code_colored.pngEPI620436A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 4 (HA)2601.20.000000e+001613/1711 (94%)
text_code_colored.pngEPI586558A/chicken/BC/FAV25/2014 (A/H5N2) segment 4 (HA)2601.20.000000e+001614/1712 (94%)
text_code_colored.pngEPI573286A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA)2601.20.000000e+001615/1713 (94%)
text_code_colored.pngEPI573271A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA)2601.20.000000e+001614/1712 (94%)
text_code_colored.pngEPI573234A/broiler duck/Korea/H1864/2014 (A/H5N8) segment 4 (HA)2601.20.000000e+001609/1707 (94%)
text_code_colored.pngEPI573232A/broiler duck/Korea/H1840/2014 (A/H5N8) segment 4 (HA)2601.20.000000e+001609/1707 (94%)
text_code_colored.pngEPI662681A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 4 (HA)2595.70.000000e+001612/1711 (94%)
text_code_colored.pngEPI620457A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 4 (HA)2595.70.000000e+001612/1711 (94%)
text_code_colored.pngEPI620450A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 4 (HA)2595.70.000000e+001612/1711 (94%)
text_code_colored.pngEPI620443A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 4 (HA)2595.70.000000e+001612/1711 (94%)
text_code_colored.pngEPI620415A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 4 (HA)2595.70.000000e+001612/1711 (94%)
text_code_colored.pngEPI588952A/goose/Taiwan/a015/2015 (A/H5N8) segment 4 (HA)2595.70.000000e+001612/1711 (94%)
text_code_colored.pngEPI573276A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA)2595.70.000000e+001613/1712 (94%)
text_code_colored.pngEPI568474A/green-winged teal/Korea/KU-12/2015 (A/H5) segment 4 (HA)2595.70.000000e+001601/1695 (94%)
text_code_colored.pngEPI442001A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA)2595.70.000000e+001612/1711 (94%)
text_code_colored.pngEPI620429A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 4 (HA)2590.10.000000e+001611/1711 (94%)
text_code_colored.pngEPI590679A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 4 (HA)2590.10.000000e+001599/1695 (94%)
text_code_colored.pngEPI585111A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 4 (HA)2590.10.000000e+001599/1695 (94%)
text_code_colored.pngEPI544756A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA)2590.10.000000e+001601/1697 (94%)
text_code_colored.pngEPI596301A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA)2577.20.000000e+001592/1687 (94%)
text_code_colored.pngEPI552776A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA)2577.20.000000e+001592/1687 (94%)
text_code_colored.pngEPI442009A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA)2577.20.000000e+001611/1714 (93%)
text_code_colored.pngEPI596295A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 4 (HA)2571.70.000000e+001598/1697 (94%)
text_code_colored.pngEPI552768A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA)2571.70.000000e+001598/1697 (94%)
text_code_colored.pngEPI593754A/goose/Yangzhou/ZG60/2009 (A/H5N5) segment 4 (HA)2568.00.000000e+001608/1712 (93%)
text_code_colored.pngEPI543010A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA)2562.40.000000e+001537/1610 (95%)
text_code_colored.pngEPI127406A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA)2556.90.000000e+001605/1711 (93%)
text_code_colored.pngEPI439897A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA)2555.00.000000e+001603/1708 (93%)
text_code_colored.pngEPI399886A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA)2551.30.000000e+001605/1712 (93%)
text_code_colored.pngEPI279949A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA)2551.30.000000e+001604/1711 (93%)
text_code_colored.pngEPI181297A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA)2551.30.000000e+001604/1711 (93%)
text_code_colored.pngEPI597677A/duck/Hunan/316/2005 (A/H5N1) segment 4 (HA)2545.80.000000e+001603/1711 (93%)
text_code_colored.pngEPI542617A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA)2545.80.000000e+001534/1611 (95%)
text_code_colored.pngEPI227309A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA)2545.80.000000e+001603/1711 (93%)
text_code_colored.pngEPI127384A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA)2545.80.000000e+001603/1711 (93%)
text_code_colored.pngEPI596289A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 4 (HA)2542.10.000000e+001563/1653 (94%)
text_code_colored.pngEPI552760A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA)2542.10.000000e+001563/1653 (94%)
text_code_colored.pngEPI543002A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA)2540.30.000000e+001535/1612 (95%)
text_code_colored.pngEPI337076A/Sichuan/2/2006 (A/H5N1) segment 4 (HA)2540.30.000000e+001601/1710 (93%)
text_code_colored.pngEPI280104A/Guangdong/1/2006 (A/H5N1) segment 4 (HA)2540.30.000000e+001602/1711 (93%)
text_code_colored.pngEPI276046A/goose/Hubei/65/2005 (A/H5N1) segment 4 (HA)2540.30.000000e+001602/1711 (93%)
text_code_colored.pngEPI224777A/Shanghai/1/2006 (A/H5N1) segment 4 (HA)2540.30.000000e+001602/1711 (93%)
text_code_colored.pngEPI181301A/Guangdong/1/2006 (A/H5N1) segment 4 (HA)2540.30.000000e+001602/1711 (93%)
text_code_colored.pngEPI181298A/Sichuan/1/2006 (A/H5N1) segment 4 (HA)2540.30.000000e+001601/1710 (93%)
text_code_colored.pngEPI164232A/Sichuan/2/2006 (A/H5N1) segment 4 (HA)2540.30.000000e+001601/1710 (93%)
text_code_colored.pngEPI164224A/Sichuan/1/2006 (A/H5N1) segment 4 (HA)2540.30.000000e+001601/1710 (93%)
text_code_colored.pngEPI573523A/wildbird/Anhui/82/2005 (A/H5N1) segment 4 (HA)2534.70.000000e+001602/1712 (93%)
text_code_colored.pngEPI337107A/Shanghai/1/2006 (A/H5N1) segment 4 (HA)2534.70.000000e+001601/1711 (93%)
text_code_colored.pngEPI280112A/Shanghai/1/2006 (A/H5N1) segment 4 (HA)2534.70.000000e+001601/1711 (93%)
text_code_colored.pngEPI275982A/duck/Hubei/49/2005 (A/H5N1) segment 4 (HA)2534.70.000000e+001602/1712 (93%)
text_code_colored.pngEPI275966A/duck/Anhui/56/2005 (A/H5N1) segment 4 (HA)2534.70.000000e+001601/1711 (93%)
text_code_colored.pngEPI275958A/duck/Anhui/1/06 (A/H5N1) segment 4 (HA)2534.70.000000e+001602/1712 (93%)
text_code_colored.pngEPI275386A/Anhui/2/2005 (A/H5N1) segment 4 (HA)2534.70.000000e+001602/1712 (93%)
text_code_colored.pngEPI225081A/duck/Hai Phong /208/2006 (A/H5N1) segment 4 (HA)2534.70.000000e+001601/1711 (93%)
text_code_colored.pngEPI170615A/chicken/Vietnam/216/2005 (A/H5N1) segment 4 (HA)2534.70.000000e+001601/1711 (93%)
text_code_colored.pngEPI170607A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 4 (HA)2534.70.000000e+001601/1711 (93%)
text_code_colored.pngEPI170599A/duck/Vietnam/218/2005 (A/H5N1) segment 4 (HA)2534.70.000000e+001601/1711 (93%)
text_code_colored.pngEPI170591A/duck/Vietnam/219/2005 (A/H5N1) segment 4 (HA)2534.70.000000e+001601/1711 (93%)
text_code_colored.pngEPI107913A/goose/Yunnan/1144/2006 (A/H5N1) segment 4 (HA)2534.70.000000e+001595/1702 (93%)
text_code_colored.pngEPI107829A/goose/Guiyang/1304/2006 (A/H5N1) segment 4 (HA)2534.70.000000e+001595/1702 (93%)
text_code_colored.pngEPI551149A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA)2531.00.000000e+001573/1670 (94%)
text_code_colored.pngEPI275870A/chicken/Sichuan/81/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI275774A/chicken/Hunan/21/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI270188A/Vietnam/UT30850/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001598/1708 (93%)
text_code_colored.pngEPI227371A/muscovy duck/VietNam/209/2005 (A/H5) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI227010A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI181299A/Fujian/1/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001601/1712 (93%)
text_code_colored.pngEPI170742A/duck/Vietnam/215/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI170741A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI170740A/chicken/Vietnam/212/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI170739A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI170738A/duck/Vietnam/210/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI170714A/chicken/Vietnam/202/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI170690A/duck/Vietnam/205/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI170674A/duck/Vietnam/207/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI170658A/chicken/Vietnam/209/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI164250A/Fujian/1/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001601/1712 (93%)
text_code_colored.pngEPI164216A/Anhui/1/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001601/1712 (93%)
text_code_colored.pngEPI107769A/duck/Guangxi/288/2006 (A/H5N1) segment 4 (HA)2529.20.000000e+001594/1702 (93%)
text_code_colored.pngEPI107765A/duck/Guangxi/150/2006 (A/H5N1) segment 4 (HA)2529.20.000000e+001594/1702 (93%)
text_code_colored.pngEPI106243A/duck/Laos/3295/2006 (A/H5N1) segment 4 (HA)2529.20.000000e+001599/1709 (93%)
text_code_colored.pngEPI106026A/China/GD01/2006 (A/H5N1) segment 4 (HA)2529.20.000000e+001600/1711 (93%)
text_code_colored.pngEPI101917A/Anhui/1/2005 (A/H5N1) segment 4 (HA)2529.20.000000e+001601/1712 (93%)
text_code_colored.pngEPI97209A/Duck/Fujian/1734/05 (A/H5N1) segment 4 (HA)2525.50.000000e+001596/1706 (93%)
text_code_colored.pngEPI337959A/Guangxi/1/2005 (A/H5N1) segment 4 (HA)2523.60.000000e+001599/1711 (93%)
text_code_colored.pngEPI227293A/Mallard/Huadong/S/2005 (A/H5N1) segment 4 (HA)2523.60.000000e+001599/1711 (93%)
text_code_colored.pngEPI170666A/duck/Vietnam/208/2005 (A/H5N1) segment 4 (HA)2523.60.000000e+001599/1711 (93%)
text_code_colored.pngEPI164258A/Guangxi/1/2005 (A/H5N1) segment 4 (HA)2523.60.000000e+001599/1711 (93%)
text_code_colored.pngEPI108331A/goose/Guangxi/1633/2006 (A/H5N1) segment 4 (HA)2523.60.000000e+001592/1701 (93%)
text_code_colored.pngEPI107771A/chicken/Guangxi/463/2006 (A/H5N1) segment 4 (HA)2523.60.000000e+001593/1702 (93%)
text_code_colored.pngEPI276022A/duck/Jiangxi/80/2005 (A/H5N1) segment 4 (HA)2521.80.000000e+001601/1714 (93%)
text_code_colored.pngEPI439068A/domestic green-winged teal/Hunan/3450/2006 (A/H5N1) segment 4 (HA)2518.10.000000e+001599/1712 (93%)
text_code_colored.pngEPI337141A/Anhui/1/2006 (A/H5N1) segment 4 (HA)2518.10.000000e+001598/1711 (93%)
text_code_colored.pngEPI280032A/Anhui/1/2006 (A/H5N1) segment 4 (HA)2518.10.000000e+001598/1711 (93%)
text_code_colored.pngEPI224965A/chicken/Hong Kong/D-06-0947/2006 (A/H5N1) segment 4 (HA)2518.10.000000e+001599/1712 (93%)
text_code_colored.pngEPI180956A/duck/Laos/22/2006 (A/H5N1) segment 4 (HA)2518.10.000000e+001599/1712 (93%)
text_code_colored.pngEPI180951A/duck/Laos/25/2006 (A/H5N1) segment 4 (HA)2518.10.000000e+001599/1712 (93%)
text_code_colored.pngEPI164325A/goose/Yunnan/4985/2006 (A/H5N1) segment 4 (HA)2518.10.000000e+001596/1709 (93%)
text_code_colored.pngEPI164240A/Anhui/2/2005 (A/H5N1) segment 4 (HA)2518.10.000000e+001601/1714 (93%)
text_code_colored.pngEPI108329A/goose/Guangxi/1898/2006 (A/H5N1) segment 4 (HA)2518.10.000000e+001592/1702 (93%)
text_code_colored.pngEPI107865A/duck/Hunan/856/2006 (A/H5N1) segment 4 (HA)2518.10.000000e+001590/1699 (93%)
text_code_colored.pngEPI107799A/chicken/Guiyang/3721/2005 (A/H5N1) segment 4 (HA)2518.10.000000e+001593/1703 (93%)
text_code_colored.pngEPI107755A/duck/Guangxi/5270/2005 (A/H5N1) segment 4 (HA)2518.10.000000e+001592/1702 (93%)
text_code_colored.pngEPI107753A/duck/Guangxi/5165/2005 (A/H5N1) segment 4 (HA)2518.10.000000e+001592/1702 (93%)
text_code_colored.pngEPI107741A/duck/Guangxi/4428/2005 (A/H5N1) segment 4 (HA)2518.10.000000e+001592/1702 (93%)
text_code_colored.pngEPI101919A/Anhui/2/2005 (A/H5N1) segment 4 (HA)2518.10.000000e+001601/1714 (93%)
text_code_colored.pngEPI78021A/chicken/Malaysia/5223/2007 (A/H5N1) segment 4 (HA)2518.10.000000e+001591/1700 (93%)
text_code_colored.pngEPI337121A/Sichuan/3/2006 (A/H5N1) segment 4 (HA)2516.30.000000e+001597/1711 (93%)
text_code_colored.pngEPI280018A/Sichuan/3/2006 (A/H5N1) segment 4 (HA)2516.30.000000e+001597/1711 (93%)
text_code_colored.pngEPI406406A/Muscovy duck/Ca Mau/22/2007 (A/H5N1) segment 4 (HA)2512.60.000000e+001596/1710 (93%)
text_code_colored.pngEPI280096A/Hunan/1/2006 (A/H5N1) segment 4 (HA)2512.60.000000e+001598/1712 (93%)
text_code_colored.pngEPI275462A/Guangxi/1/2005 (A/H5N1) segment 4 (HA)2512.60.000000e+001597/1711 (93%)
text_code_colored.pngEPI222002A/environment/Hunan/1-8/2007 (A/H5N1) segment 4 (HA)2512.60.000000e+001597/1711 (93%)
text_code_colored.pngEPI181296A/Hunan/1/2006 (A/H5N1) segment 4 (HA)2512.60.000000e+001598/1712 (93%)
text_code_colored.pngEPI174656A/duck/Hunan/3340/2006 (A/H5N1) segment 4 (HA)2512.60.000000e+001597/1711 (93%)
text_code_colored.pngEPI164317A/goose/Yunnan/4389/2006 (A/H5N1) segment 4 (HA)2512.60.000000e+001596/1710 (93%)
text_code_colored.pngEPI164309A/goose/Yunnan/4371/2006 (A/H5N1) segment 4 (HA)2512.60.000000e+001596/1710 (93%)
text_code_colored.pngEPI164277A/duck/Yunnan/4873/2006 (A/H5N1) segment 4 (HA)2512.60.000000e+001596/1710 (93%)
text_code_colored.pngEPI107857A/duck/Hunan/5152/2005 (A/H5N1) segment 4 (HA)2512.60.000000e+001592/1703 (93%)
text_code_colored.pngEPI107855A/duck/Hunan/5106/2005 (A/H5N1) segment 4 (HA)2512.60.000000e+001592/1703 (93%)
text_code_colored.pngEPI107831A/duck/Guiyang/1418/2006 (A/H5N1) segment 4 (HA)2512.60.000000e+001592/1703 (93%)
text_code_colored.pngEPI107815A/duck/Guiyang/497/2006 (A/H5N1) segment 4 (HA)2512.60.000000e+001592/1703 (93%)
text_code_colored.pngEPI107747A/duck/Guangxi/4830/2005 (A/H5N1) segment 4 (HA)2512.60.000000e+001591/1702 (93%)
text_code_colored.pngEPI620814A/duck/Vietnam SonLa/NCVD-33/2007 (A/H5N1) segment 4 (HA)2507.00.000000e+001595/1710 (93%)
text_code_colored.pngEPI337154A/Anhui/1/2007 (A/H5N1) segment 4 (HA)2507.00.000000e+001596/1711 (93%)
text_code_colored.pngEPI286383A/chicken/Cao Bang/07-42/2007 (A/H5N1) segment 4 (HA)2507.00.000000e+001595/1710 (93%)
text_code_colored.pngEPI286381A/chicken/Nam Dinh/07-32/2007 (A/H5N1) segment 4 (HA)2507.00.000000e+001595/1710 (93%)
text_code_colored.pngEPI280136A/Fujian/1/2007 (A/H5N1) segment 4 (HA)2507.00.000000e+001596/1711 (93%)
text_code_colored.pngEPI280039A/Anhui/1/2007 (A/H5N1) segment 4 (HA)2507.00.000000e+001596/1711 (93%)
text_code_colored.pngEPI276070A/shrike/Tibet/13/2006 (A/H5N1) segment 4 (HA)2507.00.000000e+001596/1711 (93%)
text_code_colored.pngEPI222568A/scaly-breasted munia/Hong Kong/2433/2007 (A/H5N1) segment 4 (HA)2507.00.000000e+001596/1711 (93%)
text_code_colored.pngEPI222148A/lesser kestrel/Heilongjiang/194/2007 (A/H5N1) segment 4 (HA)2507.00.000000e+001596/1711 (93%)
text_code_colored.pngEPI181300A/Fujian/1/2007 (A/H5N1) segment 4 (HA)2507.00.000000e+001596/1711 (93%)
text_code_colored.pngEPI174653A/chicken/Hubei/3002/2007 (A/H5N1) segment 4 (HA)2507.00.000000e+001597/1712 (93%)
text_code_colored.pngEPI174646A/duck/Henan/1652/2006 (A/H5N1) segment 4 (HA)2507.00.000000e+001597/1712 (93%)
text_code_colored.pngEPI174642A/chicken/Anhui/1089/2007 (A/H5N1) segment 4 (HA)2507.00.000000e+001597/1712 (93%)
text_code_colored.pngEPI164285A/duck/Yunnan/5310/2006 (A/H5N1) segment 4 (HA)2507.00.000000e+001596/1711 (93%)
text_code_colored.pngEPI108515A/goose/Guangxi/532/2006 (A/H5N1) segment 4 (HA)2507.00.000000e+001590/1702 (93%)
text_code_colored.pngEPI108333A/chicken/Guangxi/1951/2006 (A/H5N1) segment 4 (HA)2507.00.000000e+001591/1703 (93%)
text_code_colored.pngEPI108327A/duck/Guangxi/1830/2006 (A/H5N1) segment 4 (HA)2507.00.000000e+001590/1702 (93%)
text_code_colored.pngEPI107833A/duck/Shantou/13323/2005 (A/H5N1) segment 4 (HA)2507.00.000000e+001591/1703 (93%)
text_code_colored.pngEPI107809A/duck/Guiyang/293/2006 (A/H5N1) segment 4 (HA)2507.00.000000e+001591/1703 (93%)
text_code_colored.pngEPI107803A/duck/Guiyang/3996/2005 (A/H5N1) segment 4 (HA)2507.00.000000e+001588/1698 (93%)
text_code_colored.pngEPI107743A/goose/Guangxi/4513/2005 (A/H5N1) segment 4 (HA)2507.00.000000e+001590/1702 (93%)
text_code_colored.pngEPI406392A/chicken/Cao Bang/20/2007 (A/H5N1) segment 4 (HA)2503.30.000000e+001594/1710 (93%)
text_code_colored.pngEPI337128A/Guangdong/2/2006 (A/H5N1) segment 4 (HA)2501.50.000000e+001596/1712 (93%)
text_code_colored.pngEPI337114A/Hubei/1/2006 (A/H5N1) segment 4 (HA)2501.50.000000e+001596/1712 (93%)
text_code_colored.pngEPI280120A/Hubei/1/2006 (A/H5N1) segment 4 (HA)2501.50.000000e+001596/1712 (93%)
text_code_colored.pngEPI280025A/Guangdong/2/2006 (A/H5N1) segment 4 (HA)2501.50.000000e+001596/1712 (93%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI641395A/chicken/Yunnan/22/2015 (A/H5N6) segment 6 (NA)2549.50.000000e+001380/1380 (100%)
text_code_colored.pngEPI641393A/chicken/Yunnan/19/2015 (A/H5N6) segment 6 (NA)2549.50.000000e+001380/1380 (100%)
text_code_colored.pngEPI641397A/chicken/Yunnan/25A/2015 (A/H5N6) segment 6 (NA)2527.30.000000e+001376/1380 (99%)
text_code_colored.pngEPI641400A/Yunnan/0127/2015 (A/H5N6) segment 6 (NA)2521.80.000000e+001375/1380 (99%)
text_code_colored.pngEPI602414A/chicken/Dongguan/2690/2013 (A/H5N6) segment 6 (NA)2499.60.000000e+001371/1380 (99%)
text_code_colored.pngEPI601944A/chicken/Dongguan/1100/2014 (A/H0) segment 6 (NA)2499.60.000000e+001371/1380 (99%)
text_code_colored.pngEPI599294A/chicken/Shenzhen/552/2013 (A/H5N6) segment 6 (NA)2499.60.000000e+001371/1380 (99%)
text_code_colored.pngEPI530056A/duck/Jiangxi/95/2014 (A/H5N6) segment 6 (NA)2499.60.000000e+001371/1380 (99%)
text_code_colored.pngEPI602493A/chicken/Shenzhen/2269/2013 (A/H5N6) segment 6 (NA)2494.10.000000e+001370/1380 (99%)
text_code_colored.pngEPI599322A/chicken/Shenzhen/2464/2013 (A/H5N6) segment 6 (NA)2494.10.000000e+001370/1380 (99%)
text_code_colored.pngEPI550765A/duck/Laos/XBY004/2014 (A/H5N6) segment 6 (NA)2494.10.000000e+001370/1380 (99%)
text_code_colored.pngEPI550754A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 6 (NA)2494.10.000000e+001370/1380 (99%)
text_code_colored.pngEPI601070A/chicken/Jiangxi/13259/2014 (A/H0) segment 6 (NA)2488.60.000000e+001370/1381 (99%)
text_code_colored.pngEPI599315A/chicken/Shenzhen/2396/2013 (A/H5N6) segment 6 (NA)2488.60.000000e+001369/1380 (99%)
text_code_colored.pngEPI602319A/chicken/Jiangxi/13205/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602312A/chicken/Jiangxi/13201/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602305A/chicken/Jiangxi/13199/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602298A/chicken/Jiangxi/13197/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602274A/chicken/Jiangxi/13238/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602267A/chicken/Jiangxi/13235/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602260A/chicken/Jiangxi/13231/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602253A/chicken/Jiangxi/13221/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602236A/chicken/Jiangxi/13264/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602229A/chicken/Jiangxi/13258/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602222A/chicken/Jiangxi/13251/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602208A/chicken/Jiangxi/13247/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602201A/chicken/Jiangxi/13241/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602155A/chicken/Jiangxi/13266/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602048A/chicken/Dongguan/2818/2013 (A/H0) segment 6 (NA)2483.00.000000e+001368/1380 (99%)
text_code_colored.pngEPI601464A/chicken/Jiangxi/13211/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601453A/chicken/Jiangxi/13198/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601443A/chicken/Jiangxi/13196/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601406A/chicken/Jiangxi/13253/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601394A/chicken/Jiangxi/13237/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601342A/chicken/Jiangxi/13272/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601197A/chicken/Jiangxi/13216/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601190A/chicken/Jiangxi/13215/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601180A/chicken/Jiangxi/13212/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601171A/chicken/Jiangxi/13206/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601162A/chicken/Jiangxi/13204/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601152A/chicken/Jiangxi/13246/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601126A/chicken/Jiangxi/13228/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601117A/chicken/Jiangxi/13219/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601099A/chicken/Jiangxi/13271/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI601080A/chicken/Jiangxi/13260/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI600276A/chicken/Jiangxi/13275/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI600269A/chicken/Jiangxi/13263/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI600255A/chicken/Jiangxi/13248/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI600241A/chicken/Jiangxi/13222/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI600234A/chicken/Jiangxi/13218/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI600220A/chicken/Jiangxi/13208/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI600199A/chicken/Jiangxi/12782/2014 (A/H10N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI599657A/goose/Shantou/1791/2014 (A/H5N6) segment 6 (NA)2483.00.000000e+001368/1380 (99%)
text_code_colored.pngEPI593183A/chicken/Jiangxi/14535/2014 (A/H7N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI593140A/chicken/Jiangxi/14510/2014 (A/H0) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI593123A/chicken/Jiangxi/14501/2014 (A/H7N6) segment 6 (NA)2483.00.000000e+001369/1381 (99%)
text_code_colored.pngEPI602246A/chicken/Jiangxi/13217/2014 (A/H10N6) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI602239A/chicken/Jiangxi/13213/2014 (A/H10N6) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI602215A/chicken/Jiangxi/13249/2014 (A/H10N6) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI602162A/chicken/Jiangxi/13274/2014 (A/H10N6) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI601474A/chicken/Jiangxi/13232/2014 (A/H0) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI601145A/chicken/Jiangxi/13244/2014 (A/H0) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI601135A/chicken/Jiangxi/13233/2014 (A/H0) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI601088A/chicken/Jiangxi/13262/2014 (A/H0) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI600248A/chicken/Jiangxi/13242/2014 (A/H10N6) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI600227A/chicken/Jiangxi/13214/2014 (A/H10N6) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI600213A/chicken/Jiangxi/13202/2014 (A/H10N6) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI600192A/chicken/Jiangxi/12272/2014 (A/H10N6) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI599650A/goose/Shantou/1763/2014 (A/H5N6) segment 6 (NA)2477.50.000000e+001367/1380 (99%)
text_code_colored.pngEPI599329A/duck/Dongguan/2685/2013 (A/H5N6) segment 6 (NA)2477.50.000000e+001367/1380 (99%)
text_code_colored.pngEPI599301A/chicken/Shenzhen/1395/2013 (A/H5N6) segment 6 (NA)2477.50.000000e+001367/1380 (99%)
text_code_colored.pngEPI592609A/chicken/Jiangxi/13554/2014 (A/H0) segment 6 (NA)2477.50.000000e+001368/1381 (99%)
text_code_colored.pngEPI602194A/chicken/Jiangxi/13240/2014 (A/H10N6) segment 6 (NA)2471.90.000000e+001367/1381 (98%)
text_code_colored.pngEPI602190A/chicken/Jiangxi/14512/2014 (A/H10N6) segment 6 (NA)2471.90.000000e+001367/1381 (98%)
text_code_colored.pngEPI601242A/chicken/Jiangxi/13203/2014 (A/H0) segment 6 (NA)2471.90.000000e+001367/1381 (98%)
text_code_colored.pngEPI600262A/chicken/Jiangxi/13256/2014 (A/H10N6) segment 6 (NA)2471.90.000000e+001367/1381 (98%)
text_code_colored.pngEPI600206A/chicken/Jiangxi/13200/2014 (A/H10N6) segment 6 (NA)2471.90.000000e+001367/1381 (98%)
text_code_colored.pngEPI599664A/goose/Shantou/1806/2014 (A/H5N6) segment 6 (NA)2471.90.000000e+001366/1380 (98%)
text_code_colored.pngEPI599341A/duck/Dongguan/3069/2013 (A/H5N6) segment 6 (NA)2471.90.000000e+001366/1380 (98%)
text_code_colored.pngEPI599335A/silkie chicken/Dongguan/2809/2013 (A/H5N6) segment 6 (NA)2471.90.000000e+001366/1380 (98%)
text_code_colored.pngEPI602479A/chicken/Shenzhen/715/2013 (A/H5N6) segment 6 (NA)2466.40.000000e+001365/1380 (98%)
text_code_colored.pngEPI599287A/chicken/Shenzhen/433/2013 (A/H5N6) segment 6 (NA)2466.40.000000e+001365/1380 (98%)
text_code_colored.pngEPI531458A/duck/Guangdong/GD01/2014 (A/H5N6) segment 6 (NA)2466.40.000000e+001365/1380 (98%)
text_code_colored.pngEPI602421A/chicken/Dongguan/3363/2013 (A/H5N6) segment 6 (NA)2460.90.000000e+001365/1381 (98%)
text_code_colored.pngEPI602032A/chicken/Dongguan/4190/2013 (A/H0) segment 6 (NA)2460.90.000000e+001365/1381 (98%)
text_code_colored.pngEPI602019A/chicken/Shenzhen/2072/2013 (A/H0) segment 6 (NA)2460.90.000000e+001365/1381 (98%)
text_code_colored.pngEPI599348A/chicken/Dongguan/4259/2013 (A/H5N6) segment 6 (NA)2460.90.000000e+001364/1380 (98%)
text_code_colored.pngEPI596624A/duck/Vietnam/LBM760/2014 (A/H5N6) segment 6 (NA)2460.90.000000e+001364/1380 (98%)
text_code_colored.pngEPI596618A/duck/Vietnam/LBM759/2014 (A/H5N6) segment 6 (NA)2460.90.000000e+001364/1380 (98%)
text_code_colored.pngEPI596612A/duck/Vietnam/LBM758/2014 (A/H5N6) segment 6 (NA)2460.90.000000e+001364/1380 (98%)
text_code_colored.pngEPI596606A/muscovy duck/Vietnam/LBM757/2014 (A/H5N6) segment 6 (NA)2460.90.000000e+001364/1380 (98%)
text_code_colored.pngEPI596600A/muscovy duck/Vietnam/LBM756/2014 (A/H5N6) segment 6 (NA)2460.90.000000e+001364/1380 (98%)
text_code_colored.pngEPI596594A/muscovy duck/Vietnam/LBM755/2014 (A/H5N6) segment 6 (NA)2460.90.000000e+001364/1380 (98%)
text_code_colored.pngEPI596588A/muscovy duck/Vietnam/LBM754/2014 (A/H5N6) segment 6 (NA)2460.90.000000e+001364/1380 (98%)
text_code_colored.pngEPI596576A/duck/Vietnam/LBM751/2014 (A/H5N6) segment 6 (NA)2460.90.000000e+001364/1380 (98%)
text_code_colored.pngEPI530065A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 6 (NA)2460.90.000000e+001364/1380 (98%)
text_code_colored.pngEPI596582A/duck/Vietnam/LBM752/2014 (A/H5N6) segment 6 (NA)2457.20.000000e+001363/1380 (98%)
text_code_colored.pngEPI602486A/chicken/Shenzhen/1061/2013 (A/H5N6) segment 6 (NA)2455.30.000000e+001363/1380 (98%)
text_code_colored.pngEPI601415A/chicken/Jiangxi/13257/2014 (A/H0) segment 6 (NA)2455.30.000000e+001364/1381 (98%)
text_code_colored.pngEPI681352A/chicken/Zhejiang/727022/2014 (A/H5N6) segment 6 (NA)2449.80.000000e+001362/1380 (98%)
text_code_colored.pngEPI645044A/swine/Guangdong/2/2014 (A/H5N6) segment 6 (NA)2449.80.000000e+001362/1380 (98%)
text_code_colored.pngEPI645037A/swine/Guangdong/1/2014 (A/H5N6) segment 6 (NA)2449.80.000000e+001362/1380 (98%)
text_code_colored.pngEPI681353A/chicken/Zhejiang/727026/2014 (A/H5N6) segment 6 (NA)2444.20.000000e+001361/1380 (98%)
text_code_colored.pngEPI681344A/goose/Zhejiang/727092/2014 (A/H5N6) segment 6 (NA)2438.70.000000e+001360/1380 (98%)
text_code_colored.pngEPI681343A/duck/Zhejiang/727158/2014 (A/H5N6) segment 6 (NA)2438.70.000000e+001360/1380 (98%)
text_code_colored.pngEPI593898A/duck/Guangzhou/41227/2014 (A/H5N6) segment 6 (NA)2438.70.000000e+001361/1381 (98%)
text_code_colored.pngEPI681354A/chicken/Zhejiang/727155/2014 (A/H5N6) segment 6 (NA)2433.20.000000e+001359/1380 (98%)
text_code_colored.pngEPI681346A/goose/Zhejiang/925036/2014 (A/H5N6) segment 6 (NA)2433.20.000000e+001359/1380 (98%)
text_code_colored.pngEPI590815A/duck/Jiangxi/NCDZT1126/2014 (A/H5N6) segment 6 (NA)2433.20.000000e+001359/1380 (98%)
text_code_colored.pngEPI590808A/duck/Jiangxi/NCDZT1123/2014 (A/H5N6) segment 6 (NA)2433.20.000000e+001359/1380 (98%)
text_code_colored.pngEPI683020A/duck/Wuhan/JXYFB22/2015 (A/H5N6) segment 6 (NA)2427.60.000000e+001358/1380 (98%)
text_code_colored.pngEPI683016A/chicken/Wuhan/WHYJ02/2015 (A/H5N6) segment 6 (NA)2427.60.000000e+001358/1380 (98%)
text_code_colored.pngEPI683015A/chicken/Wuhan/WHYJ01/2015 (A/H5N6) segment 6 (NA)2427.60.000000e+001358/1380 (98%)
text_code_colored.pngEPI615107A/duck/Guangxi/175D12/2014 (A/H3N6) segment 6 (NA)2427.60.000000e+001358/1380 (98%)
text_code_colored.pngEPI683018A/duck/Wuhan/WHYF03/2015 (A/H5N6) segment 6 (NA)2416.50.000000e+001356/1380 (98%)
text_code_colored.pngEPI683017A/duck/Wuhan/WHYF02/2015 (A/H5N6) segment 6 (NA)2416.50.000000e+001356/1380 (98%)
text_code_colored.pngEPI683011A/turtledove/Wuhan/WHBJ12/2014 (A/H5N6) segment 6 (NA)2416.50.000000e+001356/1380 (98%)
text_code_colored.pngEPI683014A/turtledove/Wuhan/HKBJ43/2015 (A/H5N6) segment 6 (NA)2411.00.000000e+001355/1380 (98%)
text_code_colored.pngEPI683013A/turtledove/Wuhan/HKBJ27/2015 (A/H5N6) segment 6 (NA)2411.00.000000e+001355/1380 (98%)
text_code_colored.pngEPI683012A/turtledove/Wuhan/WHBJ28/2014 (A/H5N6) segment 6 (NA)2411.00.000000e+001355/1380 (98%)
text_code_colored.pngEPI683009A/turtledove/Wuhan/WHBJ26/2014 (A/H5N6) segment 6 (NA)2411.00.000000e+001355/1380 (98%)
text_code_colored.pngEPI681348A/goose/Zhejiang/925106/2014 (A/H5N6) segment 6 (NA)2411.00.000000e+001355/1380 (98%)
text_code_colored.pngEPI593891A/Guangzhou/39715/2014 (A/H5N6) segment 6 (NA)2411.00.000000e+001355/1380 (98%)
text_code_colored.pngEPI683010A/turtledove/Wuhan/HKBJ07/2015 (A/H5N6) segment 6 (NA)2409.20.000000e+001354/1380 (98%)
text_code_colored.pngEPI681345A/goose/Zhejiang/727110/2014 (A/H5N6) segment 6 (NA)2377.80.000000e+001350/1381 (97%)
text_code_colored.pngEPI314283A/swine/Guangdong/K6/2010 (A/H6N6) segment 6 (NA)2361.10.000000e+001346/1380 (97%)
text_code_colored.pngEPI500957A/Duck/Guangdong/S1419/2011 (A/H6N6) segment 6 (NA)2344.50.000000e+001343/1380 (97%)
text_code_colored.pngEPI602040A/duck/Ningbo/3262/2013 (A/H0) segment 6 (NA)2283.60.000000e+001332/1380 (96%)
text_code_colored.pngEPI501037A/Duck/Guangdong/S4251/2010 (A/H6N6) segment 6 (NA)2267.00.000000e+001330/1381 (96%)
text_code_colored.pngEPI364045A/duck/Shantou/1984/2007 (A/H6N6) segment 6 (NA)2250.30.000000e+001327/1381 (96%)
text_code_colored.pngEPI550758A/duck/Laos/LPQ002/2014 (A/H5N6) segment 6 (NA)2228.20.000000e+001220/1227 (99%)
text_code_colored.pngEPI550760A/chicken/Laos/XBY003/2014 (A/H5N6) segment 6 (NA)2198.60.000000e+001200/1205 (99%)
text_code_colored.pngEPI364271A/duck/Shantou/12958/2006 (A/H6N6) segment 6 (NA)2191.20.000000e+001318/1382 (95%)
text_code_colored.pngEPI268291A/duck/Fujian/11661/2005 (A/H6N6) segment 6 (NA)2145.10.000000e+001311/1384 (94%)
text_code_colored.pngEPI363773A/duck/Fujian/958/2006 (A/H6N6) segment 6 (NA)2139.50.000000e+001310/1384 (94%)
text_code_colored.pngEPI550769A/duck/Laos/XBY004/2014 (A/H5N6) segment 6 (NA)2119.20.000000e+001155/1159 (99%)
text_code_colored.pngEPI268294A/mallard/Shantou/972/2005 (A/H6N6) segment 6 (NA)1956.70.000000e+001161/1211 (95%)
text_code_colored.pngEPI268297A/duck/Shantou/6233/2004 (A/H6N6) segment 6 (NA)1940.10.000000e+001158/1211 (95%)
text_code_colored.pngEPI364732A/duck/Shantou/9350/2006 (A/H6N6) segment 6 (NA)1930.90.000000e+001158/1213 (95%)
text_code_colored.pngEPI364554A/duck/Shantou/2798/2006 (A/H6N6) segment 6 (NA)1930.90.000000e+001158/1213 (95%)
text_code_colored.pngEPI364227A/duck/Shantou/3389/2006 (A/H6N6) segment 6 (NA)1930.90.000000e+001158/1213 (95%)
text_code_colored.pngEPI268292A/duck/Shantou/11392/2005 (A/H6N6) segment 6 (NA)1929.00.000000e+001156/1211 (95%)
text_code_colored.pngEPI364728A/duck/Shantou/7429/2006 (A/H6N6) segment 6 (NA)1925.30.000000e+001157/1213 (95%)
text_code_colored.pngEPI364331A/duck/Shantou/19616/2006 (A/H6N6) segment 6 (NA)1925.30.000000e+001157/1213 (95%)
text_code_colored.pngEPI364303A/duck/Shantou/16158/2006 (A/H6N6) segment 6 (NA)1925.30.000000e+001157/1213 (95%)
text_code_colored.pngEPI364301A/duck/Shantou/16124/2006 (A/H6N6) segment 6 (NA)1925.30.000000e+001157/1213 (95%)
text_code_colored.pngEPI364287A/duck/Shantou/14877/2006 (A/H6N6) segment 6 (NA)1925.30.000000e+001157/1213 (95%)
text_code_colored.pngEPI364277A/duck/Shantou/13655/2006 (A/H6N6) segment 6 (NA)1925.30.000000e+001157/1213 (95%)
text_code_colored.pngEPI364267A/duck/Shantou/11228/2006 (A/H6N6) segment 6 (NA)1925.30.000000e+001157/1213 (95%)
text_code_colored.pngEPI364265A/duck/Shantou/11034/2006 (A/H6N6) segment 6 (NA)1925.30.000000e+001157/1213 (95%)
text_code_colored.pngEPI364256A/duck/Shantou/9702/2006 (A/H6N6) segment 6 (NA)1925.30.000000e+001157/1213 (95%)
text_code_colored.pngEPI364254A/duck/Shantou/9374/2006 (A/H6N6) segment 6 (NA)1925.30.000000e+001157/1213 (95%)
text_code_colored.pngEPI363681A/duck/Shantou/14841/2006 (A/H6N6) segment 6 (NA)1925.30.000000e+001157/1213 (95%)
text_code_colored.pngEPI268293A/duck/Shantou/8365/2005 (A/H6N6) segment 6 (NA)1923.50.000000e+001155/1211 (95%)
text_code_colored.pngEPI364861A/duck/Shantou/18088/2006 (A/H6N6) segment 6 (NA)1919.80.000000e+001157/1214 (95%)
text_code_colored.pngEPI364804A/duck/Shantou/15048/2006 (A/H6N6) segment 6 (NA)1919.80.000000e+001156/1213 (95%)
text_code_colored.pngEPI364784A/duck/Shantou/14531/2006 (A/H6N6) segment 6 (NA)1919.80.000000e+001156/1213 (95%)
text_code_colored.pngEPI364770A/duck/Shantou/10143/2006 (A/H6N6) segment 6 (NA)1919.80.000000e+001156/1213 (95%)
text_code_colored.pngEPI364299A/duck/Shantou/15940/2006 (A/H6N6) segment 6 (NA)1919.80.000000e+001157/1214 (95%)
text_code_colored.pngEPI364263A/duck/Shantou/10284/2006 (A/H6N6) segment 6 (NA)1919.80.000000e+001156/1213 (95%)
text_code_colored.pngEPI364244A/duck/Shantou/5697/2006 (A/H6N6) segment 6 (NA)1919.80.000000e+001156/1213 (95%)
text_code_colored.pngEPI268289A/goose/Shantou/18647/2005 (A/H6N6) segment 6 (NA)1919.80.000000e+001156/1213 (95%)
text_code_colored.pngEPI365031A/duck/Fujian/1641/2006 (A/H6N6) segment 6 (NA)1917.90.000000e+001154/1211 (95%)
text_code_colored.pngEPI364444A/duck/Fujian/3046/2006 (A/H6N6) segment 6 (NA)1917.90.000000e+001154/1211 (95%)
text_code_colored.pngEPI364339A/duck/Fujian/2292/2006 (A/H6N6) segment 6 (NA)1917.90.000000e+001154/1211 (95%)
text_code_colored.pngEPI364273A/duck/Shantou/13252/2006 (A/H6N6) segment 6 (NA)1917.90.000000e+001152/1208 (95%)
text_code_colored.pngEPI363837A/duck/Fujian/6708/2006 (A/H6N6) segment 6 (NA)1917.90.000000e+001154/1211 (95%)
text_code_colored.pngEPI364810A/duck/Shantou/16147/2006 (A/H6N6) segment 6 (NA)1914.20.000000e+001156/1214 (95%)
text_code_colored.pngEPI364634A/duck/Shantou/5051/2006 (A/H6N6) segment 6 (NA)1914.20.000000e+001156/1214 (95%)
text_code_colored.pngEPI364626A/duck/Shantou/5041/2006 (A/H6N6) segment 6 (NA)1914.20.000000e+001156/1214 (95%)
text_code_colored.pngEPI364297A/duck/Shantou/15798/2006 (A/H6N6) segment 6 (NA)1914.20.000000e+001155/1213 (95%)
text_code_colored.pngEPI364283A/duck/Shantou/14607/2006 (A/H6N6) segment 6 (NA)1914.20.000000e+001155/1213 (95%)
text_code_colored.pngEPI364279A/duck/Shantou/14163/2006 (A/H6N6) segment 6 (NA)1914.20.000000e+001155/1213 (95%)
text_code_colored.pngEPI364235A/duck/Shantou/4414/2006 (A/H6N6) segment 6 (NA)1914.20.000000e+001156/1214 (95%)
text_code_colored.pngEPI363593A/duck/Shantou/1165/2006 (A/H6N6) segment 6 (NA)1914.20.000000e+001155/1213 (95%)
text_code_colored.pngEPI268288A/duck/Shantou/20313/2005 (A/H6N6) segment 6 (NA)1914.20.000000e+001155/1213 (95%)
text_code_colored.pngEPI365123A/duck/Fujian/2087/2007 (A/H6N6) segment 6 (NA)1912.40.000000e+001153/1211 (95%)
text_code_colored.pngEPI365058A/duck/Fujian/2606/2006 (A/H6N6) segment 6 (NA)1912.40.000000e+001153/1211 (95%)
text_code_colored.pngEPI364530A/duck/Fujian/6860/2007 (A/H6N6) segment 6 (NA)1912.40.000000e+001154/1212 (95%)
text_code_colored.pngEPI364450A/duck/Fujian/6222/2006 (A/H6N6) segment 6 (NA)1912.40.000000e+001153/1211 (95%)
text_code_colored.pngEPI364448A/duck/Fujian/4008/2006 (A/H6N6) segment 6 (NA)1912.40.000000e+001153/1211 (95%)
text_code_colored.pngEPI364337A/duck/Fujian/1904/2006 (A/H6N6) segment 6 (NA)1912.40.000000e+001153/1211 (95%)
text_code_colored.pngEPI363829A/duck/Fujian/5498/2006 (A/H6N6) segment 6 (NA)1912.40.000000e+001153/1211 (95%)
text_code_colored.pngEPI268299A/wild duck/Shantou/192/2004 (A/H6N6) segment 6 (NA)1912.40.000000e+001153/1211 (95%)
text_code_colored.pngEPI268290A/duck/Fujian/12035/2005 (A/H6N6) segment 6 (NA)1912.40.000000e+001153/1211 (95%)
text_code_colored.pngEPI364844A/duck/Shantou/17036/2006 (A/H6N6) segment 6 (NA)1908.70.000000e+001154/1213 (95%)
text_code_colored.pngEPI364812A/duck/Shantou/16144/2006 (A/H6N6) segment 6 (NA)1908.70.000000e+001154/1213 (95%)
text_code_colored.pngEPI364586A/duck/Shantou/4129/2006 (A/H6N6) segment 6 (NA)1908.70.000000e+001155/1214 (95%)
text_code_colored.pngEPI364293A/duck/Shantou/15479/2006 (A/H6N6) segment 6 (NA)1908.70.000000e+001154/1213 (95%)
text_code_colored.pngEPI364289A/duck/Shantou/15037/2006 (A/H6N6) segment 6 (NA)1908.70.000000e+001154/1213 (95%)
text_code_colored.pngEPI364281A/duck/Shantou/14565/2006 (A/H6N6) segment 6 (NA)1908.70.000000e+001154/1213 (95%)
text_code_colored.pngEPI364239A/duck/Shantou/4980/2006 (A/H6N6) segment 6 (NA)1908.70.000000e+001155/1214 (95%)
text_code_colored.pngEPI364237A/duck/Shantou/4938/2006 (A/H6N6) segment 6 (NA)1908.70.000000e+001154/1213 (95%)
text_code_colored.pngEPI364037A/duck/Shantou/1240/2007 (A/H6N6) segment 6 (NA)1908.70.000000e+001155/1214 (95%)
text_code_colored.pngEPI363601A/wild duck/Shantou/2441/2006 (A/H6N6) segment 6 (NA)1908.70.000000e+001154/1213 (95%)
text_code_colored.pngEPI365155A/duck/Fujian/2749/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI365131A/duck/Fujian/2278/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI365115A/duck/Fujian/1879/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI365107A/duck/Fujian/912/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI365103A/duck/Fujian/816/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI365095A/duck/Fujian/402/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI365074A/duck/Fujian/6955/2006 (A/H6N6) segment 6 (NA)1906.90.000000e+001152/1211 (95%)
text_code_colored.pngEPI365066A/duck/Fujian/6605/2006 (A/H6N6) segment 6 (NA)1906.90.000000e+001152/1211 (95%)
text_code_colored.pngEPI365050A/duck/Fujian/2281/2006 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI365042A/duck/Fujian/1674/2006 (A/H6N6) segment 6 (NA)1906.90.000000e+001152/1211 (95%)
text_code_colored.pngEPI364497A/duck/Fujian/2582/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI364494A/duck/Fujian/1772/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI364492A/duck/Fujian/1600/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI364480A/duck/Fujian/576/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI364474A/duck/Fujian/118/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI364470A/duck/Fujian/10706/2006 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI364460A/duck/Fujian/7830/2006 (A/H6N6) segment 6 (NA)1906.90.000000e+001152/1211 (95%)
text_code_colored.pngEPI364458A/duck/Fujian/7652/2006 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI364446A/duck/Fujian/3574/2006 (A/H6N6) segment 6 (NA)1906.90.000000e+001152/1211 (95%)
text_code_colored.pngEPI364076A/duck/Fujian/1565/2007 (A/H6N6) segment 6 (NA)1906.90.000000e+001153/1212 (95%)
text_code_colored.pngEPI363805A/duck/Fujian/3354/2006 (A/H6N6) segment 6 (NA)1906.90.000000e+001152/1211 (95%)
text_code_colored.pngEPI363781A/duck/Fujian/1651/2006 (A/H6N6) segment 6 (NA)1906.90.000000e+001152/1211 (95%)
text_code_colored.pngEPI364092A/duck/Fujian/2018/2007 (A/H6N6) segment 6 (NA)1905.00.000000e+001152/1211 (95%)
text_code_colored.pngEPI363797A/duck/Fujian/2854/2006 (A/H6N6) segment 6 (NA)1905.00.000000e+001151/1210 (95%)
text_code_colored.pngEPI364870A/duck/Shantou/18729/2006 (A/H6N6) segment 6 (NA)1903.20.000000e+001154/1214 (95%)
text_code_colored.pngEPI364852A/duck/Shantou/17081/2006 (A/H6N6) segment 6 (NA)1903.20.000000e+001154/1214 (95%)
text_code_colored.pngEPI364329A/duck/Shantou/19369/2006 (A/H6N6) segment 6 (NA)1903.20.000000e+001154/1214 (95%)
text_code_colored.pngEPI364317A/duck/Shantou/18070/2006 (A/H6N6) segment 6 (NA)1903.20.000000e+001154/1214 (95%)
text_code_colored.pngEPI364315A/duck/Shantou/17800/2006 (A/H6N6) segment 6 (NA)1903.20.000000e+001154/1214 (95%)
text_code_colored.pngEPI364309A/duck/Shantou/16810/2006 (A/H6N6) segment 6 (NA)1903.20.000000e+001154/1214 (95%)
text_code_colored.pngEPI364305A/duck/Shantou/16440/2006 (A/H6N6) segment 6 (NA)1903.20.000000e+001154/1214 (95%)
text_code_colored.pngEPI364013A/duck/Shantou/358/2007 (A/H6N6) segment 6 (NA)1903.20.000000e+001153/1213 (95%)
text_code_colored.pngEPI363757A/duck/Shantou/19597/2006 (A/H6N6) segment 6 (NA)1903.20.000000e+001154/1214 (95%)
text_code_colored.pngEPI363689A/duck/Shantou/17058/2006 (A/H6N6) segment 6 (NA)1903.20.000000e+001154/1214 (95%)
text_code_colored.pngEPI363633A/duck/Shantou/4636/2006 (A/H6N6) segment 6 (NA)1903.20.000000e+001153/1213 (95%)
text_code_colored.pngEPI365139A/duck/Fujian/2356/2007 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI365088A/duck/Fujian/145/2007 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364532A/duck/Fujian/6908/2007 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364514A/duck/Fujian/4185/2007 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364512A/duck/Fujian/3756/2007 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364510A/duck/Fujian/3460/2007 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364490A/duck/Fujian/1322/2007 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364468A/duck/Fujian/9308/2006 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364464A/duck/Fujian/8388/2006 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364462A/duck/Fujian/8114/2006 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364454A/duck/Fujian/6908/2006 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364335A/duck/Fujian/1348/2006 (A/H6N6) segment 6 (NA)1901.30.000000e+001151/1211 (95%)
text_code_colored.pngEPI364117A/duck/Fujian/3264/2007 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364060A/duck/Fujian/378/2007 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI363877A/duck/Fujian/11418/2006 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI363853A/duck/Fujian/9062/2006 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI363739A/duck/Fujian/2787/2007 (A/H6N6) segment 6 (NA)1901.30.000000e+001152/1212 (95%)
text_code_colored.pngEPI364325A/duck/Shantou/19097/2006 (A/H6N6) segment 6 (NA)1897.60.000000e+001152/1213 (94%)
text_code_colored.pngEPI364323A/duck/Shantou/18765/2006 (A/H6N6) segment 6 (NA)1897.60.000000e+001152/1213 (94%)
text_code_colored.pngEPI364321A/duck/Shantou/18709/2006 (A/H6N6) segment 6 (NA)1897.60.000000e+001153/1214 (94%)
 

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI602494A/chicken/Shenzhen/2269/2013 (A/H5N6) segment 7 (MP)1783.10.000000e+00977/983 (99%)
text_code_colored.pngEPI602415A/chicken/Dongguan/2690/2013 (A/H5N6) segment 7 (MP)1783.10.000000e+00977/983 (99%)
text_code_colored.pngEPI599295A/chicken/Shenzhen/552/2013 (A/H5N6) segment 7 (MP)1783.10.000000e+00977/983 (99%)
text_code_colored.pngEPI593892A/Guangzhou/39715/2014 (A/H5N6) segment 7 (MP)1783.10.000000e+00977/983 (99%)
text_code_colored.pngEPI550766A/duck/Laos/XBY004/2014 (A/H5N6) segment 7 (MP)1783.10.000000e+00977/983 (99%)
text_code_colored.pngEPI550755A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 7 (MP)1783.10.000000e+00977/983 (99%)
text_code_colored.pngEPI530057A/duck/Jiangxi/95/2014 (A/H5N6) segment 7 (MP)1783.10.000000e+00977/983 (99%)
text_code_colored.pngEPI602487A/chicken/Shenzhen/1061/2013 (A/H5N6) segment 7 (MP)1777.60.000000e+00976/983 (99%)
text_code_colored.pngEPI602480A/chicken/Shenzhen/715/2013 (A/H5N6) segment 7 (MP)1777.60.000000e+00976/983 (99%)
text_code_colored.pngEPI599323A/chicken/Shenzhen/2464/2013 (A/H5N6) segment 7 (MP)1777.60.000000e+00976/983 (99%)
text_code_colored.pngEPI599316A/chicken/Shenzhen/2396/2013 (A/H5N6) segment 7 (MP)1777.60.000000e+00976/983 (99%)
text_code_colored.pngEPI599288A/chicken/Shenzhen/433/2013 (A/H5N6) segment 7 (MP)1777.60.000000e+00976/983 (99%)
text_code_colored.pngEPI682963A/turtledove/Wuhan/WHBJ26/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI645043A/swine/Guangdong/2/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI602422A/chicken/Dongguan/3363/2013 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI599349A/chicken/Dongguan/4259/2013 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI599342A/duck/Dongguan/3069/2013 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI596548A/duck/Vietnam/LBM760/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI596541A/duck/Vietnam/LBM759/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI596537A/duck/Vietnam/LBM758/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI596533A/muscovy duck/Vietnam/LBM757/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI596529A/muscovy duck/Vietnam/LBM756/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI596525A/muscovy duck/Vietnam/LBM755/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI596518A/muscovy duck/Vietnam/LBM754/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI596517A/duck/Vietnam/LBM752/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI596513A/duck/Vietnam/LBM751/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI593899A/duck/Guangzhou/41227/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI590816A/duck/Jiangxi/NCDZT1126/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI531459A/duck/Guangdong/GD01/2014 (A/H5N6) segment 7 (MP)1772.10.000000e+00975/983 (99%)
text_code_colored.pngEPI682972A/duck/Wuhan/WHYF03/2015 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI682971A/chicken/Wuhan/WHYJ02/2015 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI682970A/duck/Wuhan/WHYF02/2015 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI682969A/chicken/Wuhan/WHYJ01/2015 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI682968A/turtledove/Wuhan/HKBJ43/2015 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI682967A/turtledove/Wuhan/HKBJ27/2015 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI682966A/turtledove/Wuhan/WHBJ28/2014 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI682965A/turtledove/Wuhan/WHBJ12/2014 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI682964A/turtledove/Wuhan/HKBJ07/2015 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI681375A/goose/Zhejiang/925036/2014 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI645036A/swine/Guangdong/1/2014 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI599658A/goose/Shantou/1791/2014 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI599651A/goose/Shantou/1763/2014 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI599336A/silkie chicken/Dongguan/2809/2013 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI599330A/duck/Dongguan/2685/2013 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI599302A/chicken/Shenzhen/1395/2013 (A/H5N6) segment 7 (MP)1766.50.000000e+00974/983 (99%)
text_code_colored.pngEPI682973A/duck/Wuhan/JXYFB22/2015 (A/H5N6) segment 7 (MP)1761.00.000000e+00973/983 (98%)
text_code_colored.pngEPI681382A/chicken/Zhejiang/727026/2014 (A/H5N6) segment 7 (MP)1761.00.000000e+00973/983 (98%)
text_code_colored.pngEPI681381A/chicken/Zhejiang/727022/2014 (A/H5N6) segment 7 (MP)1761.00.000000e+00973/983 (98%)
text_code_colored.pngEPI681373A/goose/Zhejiang/727092/2014 (A/H5N6) segment 7 (MP)1761.00.000000e+00973/983 (98%)
text_code_colored.pngEPI681372A/duck/Zhejiang/727158/2014 (A/H5N6) segment 7 (MP)1761.00.000000e+00973/983 (98%)
text_code_colored.pngEPI599665A/goose/Shantou/1806/2014 (A/H5N6) segment 7 (MP)1761.00.000000e+00973/983 (98%)
text_code_colored.pngEPI590809A/duck/Jiangxi/NCDZT1123/2014 (A/H5N6) segment 7 (MP)1761.00.000000e+00973/983 (98%)
text_code_colored.pngEPI530066A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 7 (MP)1761.00.000000e+00974/984 (98%)
text_code_colored.pngEPI424667A/duck/Vietnam/NCVD-1940/2012 (A/H5N1) segment 7 (MP)1761.00.000000e+00973/983 (98%)
text_code_colored.pngEPI681374A/goose/Zhejiang/727110/2014 (A/H5N6) segment 7 (MP)1755.40.000000e+00972/983 (98%)
text_code_colored.pngEPI590906A/duck/Sichuan/NCXN10/2014 (A/H5N1) segment 7 (MP)1755.40.000000e+00972/983 (98%)
text_code_colored.pngEPI590858A/pigeon/Sichuan/NCXN29/2014 (A/H5N1) segment 7 (MP)1755.40.000000e+00972/983 (98%)
text_code_colored.pngEPI681383A/chicken/Zhejiang/727155/2014 (A/H5N6) segment 7 (MP)1749.90.000000e+00972/984 (98%)
text_code_colored.pngEPI590857A/duck/Sichuan/NCXN11/2014 (A/H5N1) segment 7 (MP)1749.90.000000e+00971/983 (98%)
text_code_colored.pngEPI585964A/chicken/AnNing/1/2014 (A/H5N1) segment 7 (MP)1749.90.000000e+00971/983 (98%)
text_code_colored.pngEPI585971A/chicken/DaLi/302/2014 (A/H5N1) segment 7 (MP)1744.40.000000e+00970/983 (98%)
text_code_colored.pngEPI585954A/chicken/TongHai/302/2014 (A/H5N1) segment 7 (MP)1744.40.000000e+00970/983 (98%)
text_code_colored.pngEPI438172A/Shenzhen/1/2011 (A/H5N1) segment 7 (MP)1744.40.000000e+00970/983 (98%)
text_code_colored.pngEPI622554A/duck/Vietnam/NCVD-672/2011 (A/H5N1) segment 7 (MP)1738.80.000000e+00969/983 (98%)
text_code_colored.pngEPI461758A/duck/Hunan/S4220/2011 (A/H5N1) segment 7 (MP)1738.80.000000e+00969/983 (98%)
text_code_colored.pngEPI425283A/duck/Vietnam/NCVD-674/2011 (A/H5N1) segment 7 (MP)1738.80.000000e+00969/983 (98%)
text_code_colored.pngEPI425275A/duck/Vietnam/NCVD-673/2011 (A/H5N1) segment 7 (MP)1738.80.000000e+00969/983 (98%)
text_code_colored.pngEPI405131A/duck/Vietnam/NCVD-672/2011 (A/H5N1) segment 7 (MP)1738.80.000000e+00969/983 (98%)
text_code_colored.pngEPI559179A/duck/Vietnam/NCVD-A672/2011 (A/H5N1) segment 7 (MP)1735.10.000000e+00967/981 (98%)
text_code_colored.pngEPI438232A/oriental magpie robin/Hong Kong/470.1/2011 (A/H5N1) segment 7 (MP)1733.30.000000e+00968/983 (98%)
text_code_colored.pngEPI337023A/duck/Zhejiang/2248/2011 (A/H5N1) segment 7 (MP)1733.30.000000e+00968/983 (98%)
text_code_colored.pngEPI337021A/duck/Zhejiang/2244/2011 (A/H5N1) segment 7 (MP)1733.30.000000e+00968/983 (98%)
text_code_colored.pngEPI337020A/duck/Zhejiang/2243/2011 (A/H5N1) segment 7 (MP)1733.30.000000e+00968/983 (98%)
text_code_colored.pngEPI337019A/duck/Zhejiang/2242/2011 (A/H5N1) segment 7 (MP)1733.30.000000e+00968/983 (98%)
text_code_colored.pngEPI337018A/duck/Zhejiang/224/2011 (A/H5N1) segment 7 (MP)1733.30.000000e+00968/983 (98%)
text_code_colored.pngEPI681366A/duck/Zhejiang/727041/2014 (A/H5N2) segment 7 (MP)1727.70.000000e+00968/984 (98%)
text_code_colored.pngEPI600479A/quail/Nanchang/6631/2013 (A/H5N1) segment 7 (MP)1727.70.000000e+00967/983 (98%)
text_code_colored.pngEPI589596A/muscovy duck/Quang Ninh/7c121/2013 (A/H5N1) segment 7 (MP)1727.70.000000e+00967/983 (98%)
text_code_colored.pngEPI559173A/chicken/Vietnam/NCVD-KA423/2013 (A/H5N1) segment 7 (MP)1727.70.000000e+00967/983 (98%)
text_code_colored.pngEPI459250A/muscovy duck/Quanh Ninh/9/2013 (A/H5N1) segment 7 (MP)1727.70.000000e+00967/983 (98%)
text_code_colored.pngEPI459242A/muscovy duck/Quanh Ninh/6/2013 (A/H5N1) segment 7 (MP)1727.70.000000e+00967/983 (98%)
text_code_colored.pngEPI438234A/large billed crow/Hong Kong/497/2011 (A/H5N1) segment 7 (MP)1727.70.000000e+00967/983 (98%)
text_code_colored.pngEPI438233A/brown-headed gull/Hong Kong/709/2011 (A/H5N1) segment 7 (MP)1727.70.000000e+00967/983 (98%)
text_code_colored.pngEPI425902A/chicken/Vietnam/NCVD-1254/2011 (A/H5N1) segment 7 (MP)1727.70.000000e+00967/983 (98%)
text_code_colored.pngEPI424389A/duck/Vietnam/NCVD-1283/2012 (A/H5N1) segment 7 (MP)1727.70.000000e+00967/983 (98%)
text_code_colored.pngEPI375434A/Hong Kong/5923/2012 (A/H5N1) segment 7 (MP)1727.70.000000e+00967/983 (98%)
text_code_colored.pngEPI337017A/duck/Zhejiang/213/2011 (A/H5N1) segment 7 (MP)1727.70.000000e+00967/983 (98%)
text_code_colored.pngEPI347306A/Guangdong-Shenzhen/1/2011(H5N1) (A/H5N1) segment 7 (MP)1725.90.000000e+00953/963 (98%)
text_code_colored.pngEPI610337A/chicken/Fujian/FZ02/2011 (A/H9N2) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI600486A/duck/Nanchang/9789/2013 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI589812A/duck/Quang Ninh/15c111/2013 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI567040A/muscovy duck/Quang Ninh/48c1-4-1/2013 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI559161A/duck/Vietnam/NCVD-KA25/2011 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI475610A/wild duck/Fujian/2/2011 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI475606A/wild duck/Fujian/1/2011 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI461539A/muscovy duck/Vietnam/LBM344/2013 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI461491A/duck/Quanh Ninh/53/2013 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI461025A/duck/Vietnam/QB1207/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI460935A/muscovy duck/Quanh Ninh/49/2013 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI460733A/muscovy duck/Vietnam/LBM335/2013 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI459867A/muscovy duck/Vietnam/LBM330/2013 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425926A/duck/Vietnam/NCVD-1544/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425918A/duck/Vietnam/NCVD-1547/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425870A/duck/Vietnam/NCVD-1163/2011 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425862A/duck/Vietnam/NCVD-1162/2011 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425854A/duck/Vietnam/NCVD-1161/2011 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425683A/duck/Vietnam/NCVD-1602/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425675A/duck/Vietnam/NCVD-1593/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425635A/duck/Vietnam/NCVD-1931/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425227A/duck/Vietnam/NCVD-1160/2011 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425179A/duck/Vietnam/NCVD-1944/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425171A/chicken/Vietnam/NCVD-1942/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425147A/duck/Vietnam/NCVD-1935/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425139A/duck/Vietnam/NCVD-1933/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI425107A/duck/Vietnam/NCVD-1943/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI424987A/duck/Vietnam/NCVD-1607/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI424979A/duck/Vietnam/NCVD-1584/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI424939A/duck/Vietnam/NCVD-885/2010 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI424731A/chicken/Vietnam/NCVD-1927/2012 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI387938A/muscovy duck/Vietnam/LBM66/2011 (A/H5N1) segment 7 (MP)1722.20.000000e+00966/983 (98%)
text_code_colored.pngEPI647788A/muscovy duck/Vietnam/HU1-1144/2014 (A/H5N6) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI647787A/duck/Vietnam/HU1-1511/2014 (A/H5N6) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI647785A/duck/Vietnam/HU1-1507/2014 (A/H5N6) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI589816A/duck/Nha Trang/75c131/2014 (A/H5N6) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI589485A/muscovy duck/Quang Ninh/5c112/2013 (A/H5N6) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI589400A/muscovy duck/Quang Ninh/4c111/2013 (A/H5N6) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI585734A/swan goose/Jilin/JL01/2014 (A/H5N6) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI559174A/chicken/Vietnam/NCVD-KA432/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI559171A/duck/Vietnam/NCVD-KA311/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI559168A/duck/Vietnam/NCVD-KA262/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI559165A/duck/Vietnam/NCVD-KA250/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI545542A/duck/Khanhhoa/CVVI-23/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI545541A/duck/Khanhhoa/CVVI-22/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI545536A/duck/Khanhhoa/CVVI-17/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI545532A/chicken/Khanhhoa/CVVI-13/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI545527A/duck/Khanhhoa/CVVI-08/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI545525A/duck/Khanhhoa/CVVI-06/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI545524A/duck/Khanhhoa/CVVI-05/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI545523A/duck/Khanhhoa/CVVI-04/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI545522A/duck/Khanhhoa/CVVI-03/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI545521A/chicken/Khanhhoa/CVVI-02/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI545520A/duck/Khanhhoa/CVVI-01/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI471176A/muscovy duck/Vietnam/LBM436/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI471134A/muscovy duck/Vietnam/LBM438/2013 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI438170A/swine/Guangxi/ns592/2011 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425651A/duck/Vietnam/NCVD-1968/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425643A/duck/Vietnam/NCVD-1936/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425627A/duck/Vietnam/NCVD-1928/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425619A/duck/Vietnam/NCVD-1930/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425595A/duck/Vietnam/NCVD-1463/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425315A/duck/Vietnam/NCVD-1217/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425307A/duck/Vietnam/NCVD-1904/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425267A/duck/Vietnam/NCVD-1901/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425195A/duck/Vietnam/NCVD129-7/2011 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425155A/duck/Vietnam/NCVD-1937/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425011A/duck/Vietnam/NCVD-1878/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI425003A/chicken/Vietnam/NCVD-1437/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI424867A/duck/Vietnam/NCVD-1026/2011 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI424859A/duck/Vietnam/NCVD-1025/2011 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI424739A/duck/Vietnam/NCVD-1932/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI424723A/duck/Vietnam/NCVD-1898/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI424699A/duck/Vietnam/NCVD-1869/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI424683A/duck/Vietnam/NCVD-1974/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI424191A/muscovy duck/Vietnam/LBM229/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI424183A/muscovy duck/Vietnam/LBM228/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI424175A/muscovy duck/Vietnam/LBM227/2012 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI321506A/chicken/Vietnam/27262/2009 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI320683A/Muscovy duck/Vietnam/18151/2009 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI168059A/magpie robin/Hong Kong/1897/2008 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI168043A/grey heron/Hong Kong/1046/2008 (A/H5N1) segment 7 (MP)1716.70.000000e+00965/983 (98%)
text_code_colored.pngEPI251433A/Guangxi/1/2009 (A/H5N1) segment 7 (MP)1713.00.000000e+00964/983 (98%)
text_code_colored.pngEPI681368A/goose/Zhejiang/77167/2014 (A/H5N2) segment 7 (MP)1711.10.000000e+00965/984 (98%)
text_code_colored.pngEPI681367A/goose/Zhejiang/77166/2014 (A/H5N2) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI590901A/duck/Sichuan/NCJPL7/2014 (A/H5N6) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI585727A/cat/Sichuan/SC18/2014 (A/H5N6) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI567014A/duck/Quang Ninh/13c1-2-1/2013 (A/H5N2) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI567006A/duck/Vietnam/LBM360c1-4-1/2013 (A/H5N6) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI559175A/chicken/Vietnam/NCVD-KA435/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI547405A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI545540A/duck/Khanhhoa/CVVI-21/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI545539A/duck/Khanhhoa/CVVI-20/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI545538A/duck/Khanhhoa/CVVI-19/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI545534A/duck/Khanhhoa/CVVI-15/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI545533A/duck/Khanhhoa/CVVI-14/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI545531A/chicken/Khanhhoa/CVVI-12/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI545529A/duck/Khanhhoa/CVVI-10/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI545526A/duck/Khanhhoa/CVVI-07/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI516034A/chicken/Yinmarbin/A295/2010 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI515018A/duck/Hunan/749/2011 (A/H0) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI503719A/Japanese white-eye/Taoyuan/Q454/2012 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI489680A/tiger/Jiangsu/01/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI460951A/muscovy duck/Vietnam/LBM399/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI460943A/muscovy duck/Vietnam/LBM398/2013 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI438245A/chicken/Viet Nam/3/2010 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI438237A/barn swallow/Hong Kong/1161/2010 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI425942A/chicken/Vietnam/NCVD-715/2011 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI425667A/duck/Vietnam/NCVD-1905/2012 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI425483A/duck/Vietnam/NCVD-927/2011 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI425443A/duck/Vietnam/NCVD-1219/2012 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI425299A/duck/Vietnam/NCVD-1902/2012 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI425131A/duck/Vietnam/NCVD-1899/2012 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI425123A/duck/Vietnam/NCVD-1872/2012 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI425019A/duck/Vietnam/NCVD-1884/2012 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI424891A/chicken/Vietnam/NCVD-921/2011 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI424883A/duck/Vietnam/NCVD-920/2011 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI424875A/duck/Vietnam/NCVD-1029/2011 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI424843A/duck/Vietnam/NCVD-1018/2011 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI424779A/duck/Vietnam/NCVD-861/2011 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI424715A/duck/Vietnam/NCVD-1897/2012 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI424707A/duck/Vietnam/NCVD-1896/2012 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI424199A/muscovy duck/Vietnam/LBM230/2012 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI351364A/duck/Vietnam/NCVD-423/2010 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI350153A/chicken/Vietnam/NCVD-390/2009 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI350146A/chicken/Vietnam/NCVD-389/2009 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI348918A/duck/Vietnam/NCVD-431/2010 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI348855A/duck/Vietnam/NCVD-449/2010 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI321591A/duck/Vietnam/27354/2009 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI321498A/chicken/Vietnam/20346/2009 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI168035A/great egret/Hong Kong/807/2008 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI168011A/grey heron/Hong Kong/3088/2007 (A/H5N1) segment 7 (MP)1711.10.000000e+00964/983 (98%)
text_code_colored.pngEPI601981A/black chicken/Jiangxi/10131/2014 (A/H0) segment 7 (MP)1707.40.000000e+00964/984 (97%)
text_code_colored.pngEPI681369A/goose/Zhejiang/77168/2014 (A/H5N2) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI681362A/pigeon/Zhejiang/727097/2014 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI681361A/goose/Zhejiang/727098/2014 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI622528A/chicken/Vietnam/NCVD-398/2010 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI602116A/environment/Jiangxi/10170/2014 (A/H5N6) segment 7 (MP)1705.60.000000e+00964/984 (97%)
text_code_colored.pngEPI602110A/black chicken/Jiangxi/10129/2014 (A/H5N6) segment 7 (MP)1705.60.000000e+00964/984 (97%)
text_code_colored.pngEPI601993A/black chicken/Jiangxi/10136/2014 (A/H0) segment 7 (MP)1705.60.000000e+00964/984 (97%)
text_code_colored.pngEPI599372A/environment/Jiangxi/10171/2014 (A/H5N6) segment 7 (MP)1705.60.000000e+00964/984 (97%)
text_code_colored.pngEPI599363A/environment/Jiangxi/10164/2014 (A/H5N6) segment 7 (MP)1705.60.000000e+00964/984 (97%)
text_code_colored.pngEPI599356A/duck/Jiangxi/10160/2014 (A/H5N6) segment 7 (MP)1705.60.000000e+00964/984 (97%)
text_code_colored.pngEPI590905A/environment/Sichuan/NCLL1/2014 (A/H5N6) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI590900A/chicken/Sichuan/NCJPL1/2014 (A/H5N6) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI545555A/duck/Khanhhoa/CVVI-36/2014 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI545530A/chicken/Khanhhoa/CVVI-11/2013 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI545528A/chicken/Khanhhoa/CVVI-09/2013 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI539363A/Viet Nam/CM32/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI533589A/Sichuan/26221/2014 (A/H5N6) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI531376A/hill myna/Heilongjiang/0704/2012 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI461691A/duck/Hunan/S4030/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI459260A/duck/Quanh Ninh/21/2013 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI427345A/chicken/Vietnam/NCVD-700/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425950A/chicken/Vietnam/NCVD-1038/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425934A/duck/Vietnam/NCVD-1875/2012 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425806A/duck/Vietnam/NCVD-1048/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425798A/duck/Vietnam/NCVD-1044/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425790A/duck/Vietnam/NCVD-1042/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425782A/chicken/Vietnam/NCVD-1040/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425555A/duck/Vietnam/NCVD-645/2010 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425531A/duck/Vietnam/NCVD-815/2010 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425523A/chicken/Vietnam/NCVD-802/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425243A/chicken/Vietnam/NCVD-1177/2012 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425051A/duck/Vietnam/NCVD-760/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425043A/duck/Vietnam/NCVD-759/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI425035A/duck/Vietnam/NCVD-758/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI424995A/duck/Vietnam/NCVD-714/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI424971A/chicken/Vietnam/NCVD-710/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI424963A/chicken/Vietnam/NCVD-709/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI424955A/duck/Vietnam/NCVD-891/2010 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI424947A/duck/Vietnam/NCVD-890/2010 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI424827A/duck/Vietnam/NCVD-711/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI424819A/duck/Vietnam/NCVD-806/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI424811A/duck/Vietnam/NCVD-712/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI424771A/duck/Vietnam/NCVD-859/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI424763A/duck/Vietnam/NCVD-851/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI424397A/chicken/Vietnam/NCVD-699/2011 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI350440A/chicken/Vietnam/NCVD-399/2010 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI350432A/chicken/Vietnam/NCVD-398/2010 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI348862A/duck/Vietnam/NCVD-456/2010 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI348785A/duck/Vietnam/NCVD-458/2010 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI168051A/magpie robin/Hong Kong/1097/2008 (A/H5N1) segment 7 (MP)1705.60.000000e+00963/983 (97%)
text_code_colored.pngEPI348890A/duck/Vietnam/NCVD-461/2010 (A/H5N1) segment 7 (MP)1703.70.000000e+00964/984 (97%)
text_code_colored.pngEPI348883A/duck/Vietnam/NCVD-460/2010 (A/H5N1) segment 7 (MP)1703.70.000000e+00964/984 (97%)
text_code_colored.pngEPI348876A/chicken/Vietnam/NCVD-459/2010 (A/H5N1) segment 7 (MP)1703.70.000000e+00964/984 (97%)
text_code_colored.pngEPI681378A/goose/Zhejiang/925108/2014 (A/H5N6) segment 7 (MP)1700.00.000000e+00963/984 (97%)
text_code_colored.pngEPI681376A/goose/Zhejiang/925105/2014 (A/H5N6) segment 7 (MP)1700.00.000000e+00963/984 (97%)
text_code_colored.pngEPI621179A/chicken/Jiangsu/2477/2014 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI621167A/chicken/Jiangsu/927/2013 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI620941A/chicken/Vietnam/NCVD-421/2010 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI602184A/duck/Jiangxi/13484/2014 (A/H5N6) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI602177A/duck/Jiangxi/13475/2014 (A/H5N6) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI602170A/duck/Jiangxi/13469/2014 (A/H5N6) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI590904A/duck/Sichuan/NCXJ24/2014 (A/H5N6) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI590903A/duck/Sichuan/NCXJ16/2014 (A/H5N6) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI590902A/duck/Sichuan/NCXJ15/2014 (A/H5N6) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI590899A/Anas_crecca/Hubei/Chenhu1623-5/2014 (A/H5N6) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI559208A/duck/Vietnam/NCVD-KA415/2012 (A/H5N2) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI559167A/duck/Vietnam/NCVD-KA261/2012 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI559162A/duck/Vietnam/NCVD-KA30/2012 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI545552A/duck/Khanhhoa/CVVI-33/2014 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI545535A/duck/Khanhhoa/CVVI-16/2013 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI500772A/Alberta/01/2014 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI438153A/muscovy duck/Vietnam/LBM295/2012 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI427338A/chicken/Vietnam/NCVD-686/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425846A/duck/Vietnam/NCVD3-31/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425838A/duck/Vietnam/NCVD3-8/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425814A/muscovy duck/Vietnam/NCVD-1049/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425547A/duck/Vietnam/NCVD-850/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425467A/chicken/Vietnam/NCVD-1247/2012 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425419A/duck/Vietnam/NCVD-1312/2012 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425387A/duck/Vietnam/NCVD-1253/2012 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425379A/chicken/Vietnam/NCVD-1248/2012 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425339A/chicken/Vietnam/NCVD-753/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425331A/duck/Vietnam/NCVD-1221/2012 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425251A/dove/Vietnam/NCVD-1178/2012 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425219A/duck/Vietnam/NCVD1-48/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425059A/duck/Vietnam/NCVD-1252/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI425027A/duck/Vietnam/NCVD-754/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI424931A/chicken/Vietnam/NCVD-752/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI424923A/duck/Vietnam/NCVD-947/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI424899A/duck/Vietnam/NCVD-935/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI424851A/duck/Vietnam/NCVD-1022/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI424835A/duck/Vietnam/NCVD-952/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI424691A/duck/Vietnam/NCVD-948/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI424429A/chicken/Vietnam/NCVD-705/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI424405A/chicken/Vietnam/NCVD-702/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI424381A/chicken/Vietnam/NCVD-685/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI387924A/muscovy duck/Vietnam/LBM14/2011 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI350487A/chicken/Vietnam/NCVD-421/2010 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI348841A/duck/Vietnam/NCVD-432/2010 (A/H5N1) segment 7 (MP)1700.00.000000e+00962/983 (97%)
text_code_colored.pngEPI545551A/duck/Khanhhoa/CVVI-32/2014 (A/H5N1) segment 7 (MP)1698.20.000000e+00963/984 (97%)
text_code_colored.pngEPI681380A/goose/Zhejiang/1120132/2014 (A/H5N6) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI681365A/duck/Zhejiang/77138/2014 (A/H5N2) segment 7 (MP)1694.50.000000e+00962/984 (97%)
text_code_colored.pngEPI620909A/chicken/Vietnam/NCVD-675/2011 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI603548A/Falcon/Dubai/AR3430-2293/2014 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI599309A/chicken/Shenzhen/1845/2013 (A/H5N6) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI560208A/enviroment/Henan/SMX1/2015(H5N1) (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI559928A/whooper swan/Henan/SMX9/2015(H5N1) (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI559811A/whooper swan/Henan/SMX4/2015(H5N1) (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI559773A/whooper swan/Henan/SMX3/2015(H5N1) (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI559730A/whooper swan/Henan/SMX1/2015(H5N1) (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI559169A/duck/Vietnam/NCVD-KA309/2012 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI553222A/Chicken/Shandong/J01/2009 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI438145A/muscovy duck/Vietnam/LBM315/2012 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI427352A/chicken/Vietnam/NCVD-668/2010 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI427331A/chicken/Vietnam/NCVD-675/2011 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI425910A/duck/Vietnam/NCVD-1304/2012 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI425894A/duck/Vietnam/NCVD-1251/2011 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI425766A/duck/Vietnam/NCVD-671/2011 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI425499A/duck/Vietnam/NCVD-946/2011 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI425491A/duck/Vietnam/NCVD-931/2011 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI425427A/duck/Vietnam/NCVD-1207/2012 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI425411A/duck/Vietnam/NCVD-1306/2012 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI425291A/duck/Vietnam/NCVD-669/2011 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI425099A/duck/Vietnam/NCVD-1497/2012 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI424421A/chicken/Vietnam/NCVD-704/2011 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI424413A/chicken/Vietnam/NCVD-703/2011 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI424357A/duck/Vietnam/NCVD-1206/2012 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI395174A/muscovy duck/Vietnam/LBM14/2011 (H3N2) (A/H3N2) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI389933A/duck/Vietnam/LBM136/2012 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI389925A/duck/Vietnam/LBM133/2012 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI389917A/duck/Vietnam/LBM132/2012 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI387931A/muscovy duck/Vietnam/LBM57/2011 (A/H5N1) segment 7 (MP)1694.50.000000e+00961/983 (97%)
text_code_colored.pngEPI559180A/chicken/Vietnam/NCVD-A675/2011 (A/H5N1) segment 7 (MP)1690.80.000000e+00959/981 (97%)
text_code_colored.pngEPI681379A/goose/Zhejiang/112080/2014 (A/H5N6) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI681364A/pigeon/Zhejiang/112090/2014 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI681360A/goose/Zhejiang/112071/2014 (A/H5N1) segment 7 (MP)1689.00.000000e+00962/985 (97%)
text_code_colored.pngEPI567299A/chicken/Nigeria/15VIR339-2/2015 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI567073A/muscovy duck/Vietnam/LBM670/2014 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI567053A/muscovy duck/Vietnam/LBM669/2014 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI567047A/muscovy duck/Vietnam/LBM668/2014 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI545547A/chicken/Khanhhoa/CVVI-28/2014 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI432711A/muscovy duck/Vietnam/LBM260/2012 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI432703A/muscovy duck/Vietnam/LBM258/2012 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI425878A/duck/Vietnam/NCVD-1182/2012 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI425822A/chicken/Vietnam/NCVD-1059/2011 (A/H5N1) segment 7 (MP)1689.00.000000e+00961/984 (97%)
text_code_colored.pngEPI425774A/chicken/Vietnam/NCVD-1034/2011 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI425603A/chicken/Vietnam/NCVD-1963/2012 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI425539A/duck/Vietnam/NCVD-825/2011 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI425403A/duck/Vietnam/NCVD-1269/2012 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI425371A/duck/Vietnam/NCVD-1234/2012 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI425363A/duck/Vietnam/NCVD-1232/2012 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI425347A/chicken/Vietnam/NCVD-1223/2012 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI425235A/duck/Vietnam/NCVD-1171/2012 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI424915A/duck/Vietnam/NCVD-945/2011 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI424373A/duck/Vietnam/NCVD-680/2011 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI424365A/duck/Vietnam/NCVD-664/2010 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI399720A/environment/Hunan/3/2011 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI389956A/muscovy duck/Vietnam/LBM113/2012 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI389941A/duck/Vietnam/LBM139/2012 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI167995A/little egret/Hong Kong/8550/2007 (A/H5N1) segment 7 (MP)1689.00.000000e+00960/983 (97%)
text_code_colored.pngEPI364349A/duck/Vietnam/OIE-2533/2011 (A/H5N1) segment 7 (MP)1687.10.000000e+00959/982 (97%)
text_code_colored.pngEPI389949A/duck/Vietnam/LBM140/2012 (A/H5N1) segment 7 (MP)1685.30.000000e+00959/983 (97%)
text_code_colored.pngEPI681363A/pigeon/Zhejiang/112089/2014 (A/H5N1) segment 7 (MP)1683.40.000000e+00960/984 (97%)
text_code_colored.pngEPI631922A/rook/Dovolnoe/50/2015 (A/H5N1) segment 7 (MP)1683.40.000000e+00960/984 (97%)
text_code_colored.pngEPI631914A/rook/Chany/32/2015 (A/H5N1) segment 7 (MP)1683.40.000000e+00960/984 (97%)
text_code_colored.pngEPI623558A/Duck/Dubai/2459/2014 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI623550A/Hoabara/Dubai/2455.5/2014 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI567119A/muscovy duck/Long An/90/2014 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI567112A/muscovy duck/Long An/89/2014 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI567092A/muscovy duck/Long An/88/2014 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI567080A/muscovy duck/Long An/86/2014 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI567061A/muscovy duck/Long An/87/2014 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI559172A/duck/Vietnam/NCVD-KA368/2012 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI559170A/duck/Vietnam/NCVD-KA310/2012 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI559166A/duck/Vietnam/NCVD-KA260/2012 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI545537A/chicken/Khanhhoa/CVVI-18/2013 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI542952A/environment/Cambodia/C373W11M4/2013 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI542876A/chicken/Cambodia/X0124310/2013 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI542853A/duck/Cambodia/143W4M4/2013 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI425886A/duck/Vietnam/NCVD-1212/2012 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI425611A/chicken/Vietnam/NCVD-1488/2012 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI425563A/chicken/Vietnam/NCVD-857/2011 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI425435A/duck/Vietnam/NCVD-1210/2012 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI425395A/muscovy duck/Vietnam/NCVD-1256/2012 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI425211A/duck/Vietnam/NCVD1-37/2011 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI425163A/chicken/Vietnam/NCVD-854/2011 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI424675A/duck/Vietnam/NCVD-1494/2012 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI424659A/chicken/Vietnam/NCVD-1255/2012 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI337234A/Hubei/1/2010 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI267027A/Hubei/1/2010 (A/H5N1) segment 7 (MP)1683.40.000000e+00959/983 (97%)
text_code_colored.pngEPI643196A/chicken/Ghana/FJ152511/2015 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI631930A/rook/Sartlan/42/2015 (A/H5N1) segment 7 (MP)1677.90.000000e+00959/984 (97%)
text_code_colored.pngEPI623566A/Falcon/Dubai/2506/2014 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI603572A/Quail/Dubai/AR3445-25043/2014 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI603564A/Stone curlew/Dubai/AR3444-25042/2014 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI603556A/Sea Gull/Dubai/AR3443-25041/2014 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542959A/environment/Cambodia/C303W9M2/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542956A/environment/Cambodia/E375W11M4/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542955A/environment/Cambodia/E316W9M3/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542949A/duck/Cambodia/141W4M4/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542948A/duck/Cambodia/58W3M1/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542946A/duck/Cambodia/298W9M1/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542945A/duck/Cambodia/23W2M2/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542909A/chicken/Cambodia/X0305302/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542903A/civet cat/Cambodia/X0313307/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00957/982 (97%)
text_code_colored.pngEPI542893A/environment/Cambodia/E73W3M3/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542868A/duck/Cambodia/250W7M1/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542831A/Cambodia/X0212301/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI542815A/Cambodia/X0123312/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI531269A/Cambodia/X0628313/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI485584A/Cambodia/X0125302/2013 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI425323A/muscovy duck/Vietnam/NCVD-1220/2012 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI424907A/duck/Vietnam/NCVD-943/2011 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI405776A/chicken/Vietnam/OIE-2215/2012 (A/H5N2) segment 7 (MP)1677.90.000000e+00935/949 (98%)
text_code_colored.pngEPI251424A/Guangdong/2/2006 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI221747A/chicken/Hunan/3/2007 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI126692A/human/China/GD02/2006 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI113318A/Shenzhen/406H/2006 (A/H5N1) segment 7 (MP)1677.90.000000e+00958/983 (97%)
text_code_colored.pngEPI545561A/chicken/Khanhhoa/CVVI-42/2014 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI545558A/chicken/Khanhhoa/CVVI-39/2014 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI545545A/duck/Khanhhoa/CVVI-26/2014 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI545543A/duck/Khanhhoa/CVVI-24/2013 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI542970A/environment/Cambodia/E591W16M2/2013 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI542947A/duck/Cambodia/311W9M2/2013 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI542895A/environment/Cambodia/E99W4M1/2013 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI542861A/duck/Cambodia/191W5M4/2013 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI542839A/Cambodia/X0219301/2013 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI542823A/Cambodia/X0207301/2013 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI542807A/Cambodia/X0123311/2013 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI537645A/Cambodia/X1030304/2013 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI531285A/chicken/Cambodia/X0815301/2013 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI531277A/Cambodia/X0808305/2013 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI337306A/water/Xinjiang/3/2009 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI280251A/water/Xinjiang/3/2009 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI251438A/Xinjiang/1/2009 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI221900A/duck/Hunan/3/2007 (A/H5N1) segment 7 (MP)1672.30.000000e+00957/983 (97%)
text_code_colored.pngEPI682975A/duck/Taizhou/TZYG12/2015 (A/H5N6) segment 7 (MP)1670.50.000000e+00958/984 (97%)
text_code_colored.pngEPI682974A/duck/Wenzhou/YHQL22/2014 (A/H5N6) segment 7 (MP)1670.50.000000e+00958/984 (97%)
text_code_colored.pngEPI585391A/duck/Vietnam/1151/2014 (A/H5N6) segment 7 (MP)1670.50.000000e+00940/958 (98%)
text_code_colored.pngEPI351431A/muscovy duck/Vietnam/NCVD-079/2008 (A/H5N1) segment 7 (MP)1670.50.000000e+00958/984 (97%)
text_code_colored.pngEPI337274A/environment/Guizhou/2/2009 (A/H5N1) segment 7 (MP)1670.50.000000e+00958/984 (97%)
text_code_colored.pngEPI275465A/Guangxi/1/2005 (A/H5N1) segment 7 (MP)1670.50.000000e+00958/984 (97%)
text_code_colored.pngEPI164553A/duck/Laos/P0050/2007 (A/H5N1) segment 7 (MP)1670.50.000000e+00958/984 (97%)
text_code_colored.pngEPI111533A/chicken/Hong Kong/947/2006 (A/H5N1) segment 7 (MP)1670.50.000000e+00958/984 (97%)
text_code_colored.pngEPI111530A/little egret/Hong Kong/718/2006 (A/H5N1) segment 7 (MP)1670.50.000000e+00958/984 (97%)
text_code_colored.pngEPI111515A/magpie robin/Hong Kong/75/2006 (A/H5N1) segment 7 (MP)1670.50.000000e+00958/984 (97%)
text_code_colored.pngEPI639609A/Vietnam/VP39/2013 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI624933A/Vietnam/VP13-28H/2013 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI624925A/Vietnam/14012902/2014 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI624917A/Vietnam/14011801/2014 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI545563A/chicken/Khanhhoa/CVVI-44/2014 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI545562A/chicken/Khanhhoa/CVVI-43/2014 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI545560A/chicken/Khanhhoa/CVVI-41/2014 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI545559A/chicken/Khanhhoa/CVVI-40/2014 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI545554A/duck/Khanhhoa/CVVI-35/2014 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI545546A/chicken/Khanhhoa/CVVI-27/2014 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI531335A/Cambodia/X1024307/2013 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI531309A/Cambodia/X0810301/2013 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI531297A/Cambodia/X0817302/2013 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI485590A/Cambodia/X0810301/2013 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI222029A/environment/Hunan/5-25/2007 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI221583A/Daurian starling/Hong Kong/1532/2007 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI220274A/black-crowned night heron/Hong Kong/659/2008 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI167987A/house crow/Hong Kong/5288/2007 (A/H5N1) segment 7 (MP)1666.80.000000e+00956/983 (97%)
text_code_colored.pngEPI537686A/Environment/East Java/LBM-LM13/2012 (A/H5N1) segment 7 (MP)1665.00.000000e+00941/961 (97%)
text_code_colored.pngEPI448902A/chicken/Bangladesh/3012/2011 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI408140A/village chicken/Kyaing Tong/2433/2007 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI351438A/muscovy duck/Vietnam/NCVD-082/2008 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI351336A/muscovy duck/Vietnam/NCVD-034/2008 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI350690A/duck/Vietnam/NCVD-116/2007 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI349938A/chicken/Vietnam/NCVD-083/2008 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI349850A/chicken/Vietnam/NCVD-035/2008 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI280219A/environment/Guizhou/2/2009 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI270191A/Vietnam/UT30850/2005 (A/H5N1) segment 7 (MP)1665.00.000000e+00955/981 (97%)
text_code_colored.pngEPI180914A/chicken/Laos/16/2008 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI180890A/chicken/Laos/P0130/2007 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI123805A/Chicken/Laos/Xaythiani 32/2006 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI111935A/duck/Guangxi/2143/2006 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)
text_code_colored.pngEPI111611A/duck/Guangxi/288/2006 (A/H5N1) segment 7 (MP)1665.00.000000e+00957/984 (97%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI683148A/chicken/Wenzhou/YHQL04/2014 (A/H9N2) segment 2 (PB1)3978.80.000000e+002235/2275 (98%)
text_code_colored.pngEPI529267A/chicken/Shanghai/B/2010 (A/H9N2) segment 2 (PB1)3967.70.000000e+002232/2274 (98%)
text_code_colored.pngEPI469294A/chicken/Hong Kong/FY64W/2010 (A/H9N2) segment 2 (PB1)3967.70.000000e+002232/2274 (98%)
text_code_colored.pngEPI457651A/environment/Shanghai/S1439/2013 (A/H7N9) segment 2 (PB1)3967.70.000000e+002233/2275 (98%)
text_code_colored.pngEPI576593A/chicken/Guangdong/SD1/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI576592A/chicken/Guangdong/G3/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI576591A/chicken/Guangdong/G2/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI568751A/goose/Jiangsu/1027/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI545787A/chicken/Suzhou/040201H/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI542310A/Shanghai/MH01/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI508925A/tree sparrow/Shanghai/01/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI504720A/Shanghai/5190T/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI498096A/Xuzhou/1/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI497916A/Nanjing/7/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI497908A/Suzhou/5/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI497900A/Nanjing/6/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI497871A/Wuxi/4/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI469192A/chicken/Rizhao/515/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI467303A/Wuxi/1/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI460773A/Nanjing/5/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI457883A/chicken/Guangdong/SD641/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI457875A/chicken/Jiangsu/S002/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI457851A/chicken/Jiangsu/SC537/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI457779A/chicken/Shanghai/S1410/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI457747A/chicken/Zhejiang/SD033/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI457675A/environment/Shanghai/S1436/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI457659A/environment/Shanghai/S1438/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI457643A/homing pigeon/Jiangsu/SD184/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI457627A/pigeon/Shanghai/S1423/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI447960A/Shanghai/3/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI447950A/Shanghai/4/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI447876A/Jiangsu/02/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI447777A/Shanghai/14/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI447762A/Shanghai/8/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI447657A/Jiangsu/09/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI447636A/Anhui/03/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI440691A/Environment/Shanghai/S1088/2013 (A/H7N9) segment 2 (PB1)3962.20.000000e+002232/2275 (98%)
text_code_colored.pngEPI683160A/chicken/Wenzhou/WZTSLG02/2015 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI680703A/chicken/Zhejiang/C19/2013 (A/H9N2) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI680699A/chicken/Zhejiang/C1/2013 (A/H9N2) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI663470A/pigeon/Wuxi/0405007/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI663469A/duck/Wuxi/0405006/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI663465A/chicken/Wuxi/04030201/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI663464A/chicken/Wuxi/0405005/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636949A/Anhui/1-YK_RG39/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636942A/Anhui/1-YK_RG38/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636935A/Anhui/1-YK_RG37/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636927A/Anhui/1-YK_RG36/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636919A/Anhui/1-YK_RG35/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636912A/Anhui/1-YK_RG34/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636882A/Anhui/1-YK_RG30/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636875A/Anhui/1-YK_RG29/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636868A/Anhui/1-YK_RG28/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636861A/Anhui/1-YK_RG27/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636854A/Anhui/1-YK_RG26/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636845A/Anhui/1-YK_RG25/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636838A/Anhui/1-YK_RG24/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636831A/Anhui/1-YK_RG23/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636824A/Anhui/1-YK_RG22/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636817A/Anhui/1-YK_RG21/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636810A/Anhui/1-YK_RG20/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636802A/Anhui/1-YK_RG19/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636792A/Anhui/1-YK_RG18/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636785A/Anhui/1-YK_RG17/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636778A/Anhui/1-YK_RG16/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636771A/Anhui/1-YK_RG15/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636764A/Anhui/1-YK_RG14/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636757A/Anhui/1-YK_RG13/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636750A/Anhui/1-YK_RG12/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636743A/Anhui/1-YK_RG10/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636735A/Anhui/1-YK_RG09/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636727A/Anhui/1-YK_RG08/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636720A/Anhui/1-YK_RG07/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636713A/Anhui/1-YK_RG06/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636706A/Anhui/1-YK_RG05/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636699A/Anhui/1-YK_RG04/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636692A/Anhui/1-YK_RG03/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636685A/Anhui/1-YK_RG02/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI636678A/Anhui/1-YK_RG01/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620197A/Anhui/1-JCVI1_RG3/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620190A/Anhui/1-JCVI1_RG2/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620183A/Anhui/1-JCVI1_RG1/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620172A/Anhui/1-BALF_RG9/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620165A/Anhui/1-BALF_RG8/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620158A/Anhui/1-BALF_RG7/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620151A/Anhui/1-BALF_RG6/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620140A/Anhui/1-BALF_RG19/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620133A/Anhui/1-BALF_RG18/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620126A/Anhui/1-BALF_RG17/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620123A/Anhui/1-BALF_RG32/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620116A/Anhui/1-BALF_RG31/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620109A/Anhui/1-BALF_RG29/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620102A/Anhui/1-BALF_RG21/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620097A/Anhui/1-BALF_RG44/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620090A/Anhui/1-BALF_RG43/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620083A/Anhui/1-BALF_RG42/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620076A/Anhui/1-BALF_RG41/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620069A/Anhui/1-BALF_RG40/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620058A/Anhui/1-BALF_RG1/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620051A/Anhui/1-BALF_RG45/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620044A/Anhui/1-BALF_RG5/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620037A/Anhui/1-BALF_RG4/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620030A/Anhui/1-BALF_RG3/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI620023A/Anhui/1-BALF_RG2/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI619993A/Anhui/1-BALF_RG33/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI613833A/Anhui/DEWH72-04/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI613819A/Anhui/DEWH72-02/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI613812A/Anhui/DEWH72-01/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI613781A/Anhui/DEWH72-07/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI613774A/Anhui/DEWH72-06/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI613767A/Anhui/DEWH72-05/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI576590A/chicken/Guangdong/G1/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI576541A/Shanghai/PD-01/2014 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI568704A/Shanghai/02/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI545801A/pigeon/Wuxi/0405007G/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI532272A/chicken/Zhejiang/C481/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI531123A/Anhui/1-DEWH730/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI515786A/Chicken/Nanjing/761/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI497863A/Wuxi/3/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI497820A/Nanjing/4/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI469194A/chicken/Rizhao/871/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI469193A/chicken/Rizhao/867/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI466480A/chicken/Jiangsu/HA2/2013 (A/H9N2) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI460749A/Nanjing/f0874/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI457867A/chicken/Jiangsu/SC035/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI457835A/chicken/Shanghai/S1055/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI457739A/duck/Anhui/SC702/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI457723A/environment/Fujian/SC337/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI457635A/pigeon/Shanghai/S1421/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI457619A/wild pigeon/Jiangsu/SD001/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI453478A/Zhejiang/HZ1/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI448934A/Shanghai/02/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI447822A/Shanghai/06-A/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI447793A/Shanghai/12/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI447769A/Shanghai/17/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI447748A/Zhejiang/02/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI447741A/Shanghai/15/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI447643A/Anhui/02/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI446964A/Shanghai/4664T/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI443040A/Zhejiang/2/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI442719A/chicken/Zhejiang/DTID-ZJU01/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI441800A/Zhejiang/DTID-ZJU01/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI440683A/Chicken/Shanghai/S1053/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI439508A/Anhui/1/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI439501A/Shanghai/2/2013 (A/H7N9) segment 2 (PB1)3956.60.000000e+002231/2275 (98%)
text_code_colored.pngEPI492283A/environment/Zhejiang/15/2013 (A/H9N2) segment 2 (PB1)3954.80.000000e+002230/2274 (98%)
text_code_colored.pngEPI473791A/environment/Hangzhou/34-2/2013(H9N2) (A/H9N2) segment 2 (PB1)3954.80.000000e+002230/2274 (98%)
text_code_colored.pngEPI443570A/environment/Hangzhou/34-1/2013(H7N9) (A/H7N9) segment 2 (PB1)3954.80.000000e+002230/2274 (98%)
text_code_colored.pngEPI447889A/chicken/Anhui-Chuzhou/01/2013 (A/H7N9) segment 2 (PB1)3953.00.000000e+002230/2275 (98%)
text_code_colored.pngEPI680697A/chicken/Zhejiang/C71921/2013 (A/H9N2) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI680694A/chicken/Zhejiang/C7199/2013 (A/H9N2) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI680671A/quail/Zhejiang/A2/2013 (A/H9N2) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637680A/Anhui/1-YK_RG140/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637673A/Anhui/1-YK_RG139/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637666A/Anhui/1-YK_RG138/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637659A/Anhui/1-YK_RG137/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637652A/Anhui/1-YK_RG136/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637645A/Anhui/1-YK_RG135/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637638A/Anhui/1-YK_RG134/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637631A/Anhui/1-YK_RG133/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637624A/Anhui/1-YK_RG132/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637617A/Anhui/1-YK_RG131/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637610A/Anhui/1-YK_RG130/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637603A/Anhui/1-YK_RG129/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637596A/Anhui/1-YK_RG128/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637589A/Anhui/1-YK_RG127/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637582A/Anhui/1-YK_RG126/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637554A/Anhui/1-YK_RG122/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637547A/Anhui/1-YK_RG121/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637540A/Anhui/1-YK_RG120/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637533A/Anhui/1-YK_RG119/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637526A/Anhui/1-YK_RG118/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637519A/Anhui/1-YK_RG117/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637512A/Anhui/1-YK_RG116/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637505A/Anhui/1-YK_RG115/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637498A/Anhui/1-YK_RG114/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637430A/Anhui/1-YK_RG105/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637273A/Anhui/1-YK_RG83/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637266A/Anhui/1-YK_RG82/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637257A/Anhui/1-YK_RG81/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637250A/Anhui/1-YK_RG80/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637243A/Anhui/1-YK_RG79/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637236A/Anhui/1-YK_RG78/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637229A/Anhui/1-YK_RG77/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637222A/Anhui/1-YK_RG76/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637203A/Anhui/1-YK_RG75/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637196A/Anhui/1-YK_RG74/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637189A/Anhui/1-YK_RG73/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637167A/Anhui/1-YK_RG70/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637159A/Anhui/1-YK_RG69/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637152A/Anhui/1-YK_RG68/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637145A/Anhui/1-YK_RG67/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637138A/Anhui/1-YK_RG66/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637131A/Anhui/1-YK_RG65/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637124A/Anhui/1-YK_RG64/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637117A/Anhui/1-YK_RG63/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637110A/Anhui/1-YK_RG62/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637103A/Anhui/1-YK_RG61/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637096A/Anhui/1-YK_RG60/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637089A/Anhui/1-YK_RG59/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637082A/Anhui/1-YK_RG58/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637075A/Anhui/1-YK_RG57/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637061A/Anhui/1-YK_RG55/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637054A/Anhui/1-YK_RG54/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637047A/Anhui/1-YK_RG53/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637019A/Anhui/1-YK_RG49/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637012A/Anhui/1-YK_RG48/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI637005A/Anhui/1-YK_RG47/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI636998A/Anhui/1-YK_RG46/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI636991A/Anhui/1-YK_RG45/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI636984A/Anhui/1-YK_RG44/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI636977A/Anhui/1-YK_RG43/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI636970A/Anhui/1-YK_RG42/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI636963A/Anhui/1-YK_RG41/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI636956A/Anhui/1-YK_RG40/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI636905A/Anhui/1-YK_RG33/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI636898A/Anhui/1-YK_RG32/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI636890A/Anhui/1-YK_RG31/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI613826A/Anhui/DEWH72-03/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI613795A/Anhui/DEWH72-09/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI613788A/Anhui/DEWH72-08/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI594359A/chicken/Qingdao/2044/2013 (A/H9N2) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI585983A/Shanghai/ION/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI583739A/chicken/Yantai/2468/2013 (A/H9N2) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI583114A/chicken/Shaoxing/5146/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI583101A/silkie chicken/Shaoxing/5130/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI550523A/Shanghai/Mix1/2014 (A/H0) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI504730A/Shanghai/5190T/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI498082A/environment/Suzhou/14/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI490977A/Environment/Guangdong/C13281030/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI490969A/Environment/Guangdong/C13281025/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI469195A/chicken/Rizhao/875/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI467311A/Wuxi/2/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI457771A/chicken/Shanghai/S1413/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI457755A/chicken/Zhejiang/SD019/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002231/2276 (98%)
text_code_colored.pngEPI453648A/Nanjing/M2/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI447836A/Beijing/01-A/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI447755A/Shanghai/9/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI447713A/Fujian/01/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI447699A/Hunan/01/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI447685A/Jiangsu/05/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI447664A/Jiangsu/08/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI446450A/Hangzhou/2/2013 (A/H7N9) segment 2 (PB1)3951.10.000000e+002230/2275 (98%)
text_code_colored.pngEPI492290A/environment/Zhejiang/16/2013 (A/H9N2) segment 2 (PB1)3949.30.000000e+002229/2274 (98%)
text_code_colored.pngEPI683159A/chicken/Wenzhou/HATSLG01/2015 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI680698A/chicken/Zhejiang/C71926/2013 (A/H9N2) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637491A/Anhui/1-YK_RG113/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637479A/Anhui/1-YK_RG112/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637472A/Anhui/1-YK_RG111/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637465A/Anhui/1-YK_RG110/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637458A/Anhui/1-YK_RG109/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637451A/Anhui/1-YK_RG108/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637444A/Anhui/1-YK_RG107/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637437A/Anhui/1-YK_RG106/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637423A/Anhui/1-YK_RG104/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637416A/Anhui/1-YK_RG103/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637409A/Anhui/1-YK_RG102/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637182A/Anhui/1-YK_RG72/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637040A/Anhui/1-YK_RG52/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637033A/Anhui/1-YK_RG51/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI637026A/Anhui/1-YK_RG50/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI620147A/Anhui/1-BALF_RG20/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI594380A/chicken/Yantai/2303/2013 (A/H9N2) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI583783A/chicken/Yantai/2469/2013 (A/H9N2) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI583107A/chicken/Shaoxing/5136/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002228/2274 (97%)
text_code_colored.pngEPI578028A/Shenzhen/SP118/2014 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI576589A/chicken/Guangdong/3640/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI576588A/chicken/Guangdong/3135/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI531474A/Shanghai/01/2014 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI530823A/Taiwan/1/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI507145A/tree sparrow/Shanghai/01/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002230/2276 (97%)
text_code_colored.pngEPI497892A/Suzhou/3/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI497827A/environment/Suzhou/8/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI453621A/environment/Nanjing/2913/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI447942A/Zhejiang/01/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI447850A/Jiangsu/04/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI447678A/Jiangsu/06/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI445910A/Taiwan/1/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI443032A/Zhejiang/1/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI441600A/Hangzhou/1/2013 (A/H7N9) segment 2 (PB1)3945.60.000000e+002229/2275 (97%)
text_code_colored.pngEPI492276A/environment/Zhejiang/14/2013 (A/H9N2) segment 2 (PB1)3943.70.000000e+002228/2274 (97%)
text_code_colored.pngEPI583143A/chicken/Shaoxing/5227/2013 (A/H7N9) segment 2 (PB1)3941.90.000000e+002228/2275 (97%)
text_code_colored.pngEPI582339A/chicken/Shaoxing/2417/2013 (A/H7N9) segment 2 (PB1)3941.90.000000e+002227/2274 (97%)
text_code_colored.pngEPI683158A/chicken/Taizhou/TZJF02/2015 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI680695A/chicken/Zhejiang/C71914/2013 (A/H9N2) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI680693A/chicken/Zhejiang/C7195/2013 (A/H9N2) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI680679A/quail/Zhejiang/2A5/2013 (A/H9N2) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI638030A/Anhui/1-YK_RG191/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI638023A/Anhui/1-YK_RG190/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI638016A/Anhui/1-YK_RG189/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI638009A/Anhui/1-YK_RG188/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI638002A/Anhui/1-YK_RG187/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637995A/Anhui/1-YK_RG186/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637988A/Anhui/1-YK_RG185/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637981A/Anhui/1-YK_RG184/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637974A/Anhui/1-YK_RG183/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637967A/Anhui/1-YK_RG182/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637960A/Anhui/1-YK_RG181/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637953A/Anhui/1-YK_RG180/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637939A/Anhui/1-YK_RG178/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637918A/Anhui/1-YK_RG174/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637855A/Anhui/1-YK_RG165/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637848A/Anhui/1-YK_RG164/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637841A/Anhui/1-YK_RG163/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637834A/Anhui/1-YK_RG162/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637827A/Anhui/1-YK_RG161/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637820A/Anhui/1-YK_RG160/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637813A/Anhui/1-YK_RG159/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637806A/Anhui/1-YK_RG158/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637799A/Anhui/1-YK_RG157/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637792A/Anhui/1-YK_RG156/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637785A/Anhui/1-YK_RG155/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637778A/Anhui/1-YK_RG154/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637771A/Anhui/1-YK_RG153/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637764A/Anhui/1-YK_RG152/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637750A/Anhui/1-YK_RG150/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637743A/Anhui/1-YK_RG149/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637736A/Anhui/1-YK_RG148/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637729A/Anhui/1-YK_RG147/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637722A/Anhui/1-YK_RG146/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637715A/Anhui/1-YK_RG145/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637708A/Anhui/1-YK_RG144/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637701A/Anhui/1-YK_RG143/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637694A/Anhui/1-YK_RG142/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637687A/Anhui/1-YK_RG141/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637575A/Anhui/1-YK_RG125/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637568A/Anhui/1-YK_RG124/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637561A/Anhui/1-YK_RG123/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637402A/Anhui/1-YK_RG101/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637395A/Anhui/1-YK_RG100/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637388A/Anhui/1-YK_RG99/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637381A/Anhui/1-YK_RG98/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637374A/Anhui/1-YK_RG97/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637367A/Anhui/1-YK_RG96/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637360A/Anhui/1-YK_RG95/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637353A/Anhui/1-YK_RG94/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637345A/Anhui/1-YK_RG93/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637338A/Anhui/1-YK_RG92/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637331A/Anhui/1-YK_RG91/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637324A/Anhui/1-YK_RG90/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637295A/Anhui/1-YK_RG86/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637288A/Anhui/1-YK_RG85/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637280A/Anhui/1-YK_RG84/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637175A/Anhui/1-YK_RG71/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI637068A/Anhui/1-YK_RG56/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI594396A/chicken/Yantai/2529/2013 (A/H0) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI583853A/chicken/Rizhao/3052/2013 (A/H9N2) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI583150A/silkie chicken/Shaoxing/5235/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI583136A/chicken/Shaoxing/5224/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI583121A/chicken/Shaoxing/5186/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI583094A/chicken/Shaoxing/5087/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI583071A/chicken/Jiaxing/4490/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI576618A/Shanghai/PD-02/2014 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI569589A/chicken/Jiangsu/TM38/2013 (A/H9N2) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI532273A/chicken/Zhejiang/C483/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI497855A/Zhenjiang/1/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI497812A/Nanjing/2/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI477408A/Zhejiang/22/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI447863A/jiangsu/03/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI447801A/Shanghai/11/2013 (A/H7N9) segment 2 (PB1)3940.00.000000e+002228/2275 (97%)
text_code_colored.pngEPI681066A/chicken/Zhejiang/727198/2014 (A/H9N2) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI680720A/chicken/Zhejiang/3C31/2013 (A/H9N2) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI680719A/chicken/Zhejiang/3C22/2013 (A/H9N2) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI680718A/chicken/Zhejiang/3C19/2013 (A/H9N2) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI663463A/duck/Sunan/040802/2013 (A/H0) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI638107A/Anhui/1-YK_RG202/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI638100A/Anhui/1-YK_RG201/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI638093A/Anhui/1-YK_RG200/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI638086A/Anhui/1-YK_RG199/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI638079A/Anhui/1-YK_RG198/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI638072A/Anhui/1-YK_RG197/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI638065A/Anhui/1-YK_RG196/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI638058A/Anhui/1-YK_RG195/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI638051A/Anhui/1-YK_RG194/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI638044A/Anhui/1-YK_RG193/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI638037A/Anhui/1-YK_RG192/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637946A/Anhui/1-YK_RG179/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637911A/Anhui/1-YK_RG173/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637904A/Anhui/1-YK_RG172/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637897A/Anhui/1-YK_RG171/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637890A/Anhui/1-YK_RG170/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637883A/Anhui/1-YK_RG169/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637876A/Anhui/1-YK_RG168/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637869A/Anhui/1-YK_RG167/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637862A/Anhui/1-YK_RG166/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637757A/Anhui/1-YK_RG151/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637317A/Anhui/1-YK_RG89/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637310A/Anhui/1-YK_RG88/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI637303A/Anhui/1-YK_RG87/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI599780A/chicken/Jiangxi/34682/2013 (A/H9N2) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI596689A/chicken/Ningbo/2929/2013 (A/H9N2) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI594408A/chicken/Rizhao/2658/2013 (A/H9N2) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI594373A/chicken/Yantai/2243/2013 (A/H9N2) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI591928A/chicken/Huzhou/3892/2013 (A/H9N2) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI583129A/chicken/Shaoxing/5201/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI583043A/silkie chicken/Huzhou/4213/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI583035A/silkie chicken/Huzhou/4208/2013 (A/H0) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI582965A/chicken/Huzhou/4074/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI582958A/chicken/Huzhou/4073/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI582943A/chicken/Huzhou/4067/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI582936A/chicken/Huzhou/4045/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI582360A/chicken/Huzhou/3802/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI582353A/chicken/Huzhou/3791/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI582346A/chicken/Huzhou/3765/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI545794A/duck/Sunan/040802G/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI541772A/Taiwan/3/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002227/2275 (97%)
text_code_colored.pngEPI500860A/Chicken/Guangdong/S1312/2010 (A/H6N2) segment 2 (PB1)3934.50.000000e+002226/2274 (97%)
text_code_colored.pngEPI500852A/Chicken/Guangdong/S1311/2010 (A/H6N6) segment 2 (PB1)3934.50.000000e+002226/2274 (97%)
text_code_colored.pngEPI471846A/chicken/Shanghai/017/2013 (A/H7N9) segment 2 (PB1)3934.50.000000e+002228/2276 (97%)
text_code_colored.pngEPI683150A/chicken/Taizhou/TZJF05/2015 (A/H9N2) segment 2 (PB1)3928.90.000000e+002227/2276 (97%)
text_code_colored.pngEPI680702A/chicken/Zhejiang/C16/2013 (A/H9N2) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI639586A/chicken/Hangzhou/174/2013 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI601410A/chicken/Jiangxi/13257/2014 (A/H0) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI593284A/chicken/Jiangxi/15526/2014 (A/H0) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI593259A/chicken/Jiangxi/15510/2014 (A/H0) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592624A/chicken/Jiangxi/13564/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592617A/chicken/Jiangxi/13556/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592598A/chicken/Jiangxi/13551/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592584A/chicken/Jiangxi/13544/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592553A/chicken/Jiangxi/13536/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592546A/chicken/Jiangxi/13530/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592431A/chicken/Jiangxi/12273/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592424A/chicken/Jiangxi/12265/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592409A/chicken/Jiangxi/12260/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592402A/chicken/Jiangxi/12256/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592388A/chicken/Jiangxi/12248/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592367A/chicken/Jiangxi/12239/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592353A/chicken/Jiangxi/12222/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592346A/chicken/Jiangxi/12219/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592339A/chicken/Jiangxi/12217/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592332A/chicken/Jiangxi/12208/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592325A/chicken/Jiangxi/12201/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592257A/chicken/Jiangxi/13519/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592236A/chicken/Jiangxi/13510/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592215A/chicken/Jiangxi/13491/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592164A/chicken/Jiangxi/13268/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592150A/chicken/Jiangxi/13250/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592114A/chicken/Jiangxi/12240/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592107A/chicken/Jiangxi/13209/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592093A/chicken/Jiangxi/12768/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592086A/chicken/Jiangxi/12274/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592072A/chicken/Jiangxi/12254/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592065A/chicken/Jiangxi/12249/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592058A/chicken/Jiangxi/12245/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592051A/chicken/Jiangxi/12223/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592044A/chicken/Jiangxi/12221/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592037A/chicken/Jiangxi/12216/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592030A/chicken/Jiangxi/12210/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI592023A/chicken/Jiangxi/12206/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI591955A/chicken/Jiaxing/4713/2013 (A/H9N2) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI582982A/chicken/Huzhou/4076/2013 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI569591A/chicken/Jiangsu/TM55/2013 (A/H9N2) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI560120A/chicken/Anhui/1/2008 (A/H9N2) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI547408A/chicken/Changzhou/C08/2013 (A/H9N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI535129A/Jiaxing/20/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI528400A/Chicken/Jilin/13200/2014 (A/H9N2) segment 2 (PB1)3928.90.000000e+002227/2276 (97%)
text_code_colored.pngEPI528392A/Chicken/Jilin/13204/2014 (A/H9N2) segment 2 (PB1)3928.90.000000e+002227/2276 (97%)
text_code_colored.pngEPI528352A/Chicken/Jilin/13199/2014 (A/H7N9) segment 2 (PB1)3928.90.000000e+002227/2276 (97%)
text_code_colored.pngEPI469320A/silkie chicken/Hong Kong/YU595W/2011 (A/H9N2) segment 2 (PB1)3928.90.000000e+002225/2274 (97%)
text_code_colored.pngEPI467334A/environment/Wuxi/1/2013 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI439489A/Shanghai/1/2013 (A/H7N9) segment 2 (PB1)3928.90.000000e+002226/2275 (97%)
text_code_colored.pngEPI447809A/Shanghai/10/2013 (A/H7N9) segment 2 (PB1)3927.10.000000e+002223/2271 (97%)
text_code_colored.pngEPI447734A/Shanghai/16/2013 (A/H7N9) segment 2 (PB1)3927.10.000000e+002223/2271 (97%)
text_code_colored.pngEPI528368A/Chicken/Jilin/13203/2014 (A/H7N9) segment 2 (PB1)3925.30.000000e+002226/2276 (97%)
text_code_colored.pngEPI680721A/chicken/Zhejiang/4C91/2013 (A/H9N2) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI680715A/chicken/Zhejiang/W41/2013 (A/H9N2) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI680710A/chicken/Zhejiang/C52/2013 (A/H9N2) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI672866A/chicken/Shandong/Li-2/2010 (A/H9N2) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI663471A/chicken/Suzhou/04020102/2013 (A/H7N9) segment 2 (PB1)3923.40.000000e+002211/2254 (98%)
text_code_colored.pngEPI637932A/Anhui/1-YK_RG177/2013 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI637925A/Anhui/1-YK_RG176/2013 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI601420A/chicken/Jiangxi/13270/2014 (A/H0) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI601157A/chicken/Jiangxi/13259/2014 (A/H0) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI593180A/chicken/Jiangxi/14535/2014 (A/H7N6) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI593145A/chicken/Jiangxi/14513/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI593137A/chicken/Jiangxi/14510/2014 (A/H0) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI593120A/chicken/Jiangxi/14501/2014 (A/H7N6) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592644A/chicken/Jiangxi/14479/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592638A/chicken/Jiangxi/14033/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592560A/chicken/Jiangxi/13537/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592445A/chicken/Jiangxi/13252/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592438A/chicken/Jiangxi/13210/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592417A/chicken/Jiangxi/12264/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592395A/chicken/Jiangxi/12251/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592381A/chicken/Jiangxi/12247/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592374A/chicken/Jiangxi/12243/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592360A/chicken/Jiangxi/12232/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592157A/chicken/Jiangxi/13255/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592143A/chicken/Jiangxi/13239/2014 (A/H0) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592135A/chicken/Jiangxi/13230/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592128A/chicken/Jiangxi/13223/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592121A/chicken/Jiangxi/13220/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592100A/chicken/Jiangxi/13207/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI592079A/chicken/Jiangxi/12261/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI583165A/chicken/Shaoxing/5479/2013 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI583087A/chicken/Shaoxing/5086/2013 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI583006A/chicken/Huzhou/4083/2013 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI576608A/chicken/Shanghai/PD-CN-02/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI569517A/chicken/Jiangsu/07/2009 (A/H9N2) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)
text_code_colored.pngEPI535121A/Hangzhou/19/2014 (A/H7N9) segment 2 (PB1)3923.40.000000e+002225/2275 (97%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI549735A/duck/Laos/XBY004/2014 (A/H5N6) segment 3 (PA)3928.90.000000e+002143/2151 (99%)
text_code_colored.pngEPI549734A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 3 (PA)3927.10.000000e+002142/2150 (99%)
text_code_colored.pngEPI599279A/chicken/Shenzhen/552/2013 (A/H5N6) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI599256A/chicken/Shenzhen/2464/2013 (A/H5N6) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI598628A/chicken/Dongguan/2690/2013 (A/H5N6) segment 3 (PA)3884.60.000000e+002135/2151 (99%)
text_code_colored.pngEPI599255A/chicken/Shenzhen/2396/2013 (A/H5N6) segment 3 (PA)3879.10.000000e+002134/2151 (99%)
text_code_colored.pngEPI598627A/chicken/Shenzhen/2269/2013 (A/H5N6) segment 3 (PA)3879.10.000000e+002134/2151 (99%)
text_code_colored.pngEPI599260A/chicken/Dongguan/4259/2013 (A/H5N6) segment 3 (PA)3873.50.000000e+002133/2151 (99%)
text_code_colored.pngEPI530053A/duck/Jiangxi/95/2014 (A/H5N6) segment 3 (PA)3873.50.000000e+002133/2151 (99%)
text_code_colored.pngEPI644692A/swine/Guangdong/1/2014 (A/H5N6) segment 3 (PA)3868.00.000000e+002132/2151 (99%)
text_code_colored.pngEPI599258A/silkie chicken/Dongguan/2809/2013 (A/H5N6) segment 3 (PA)3868.00.000000e+002132/2151 (99%)
text_code_colored.pngEPI598629A/chicken/Dongguan/3363/2013 (A/H5N6) segment 3 (PA)3868.00.000000e+002132/2151 (99%)
text_code_colored.pngEPI568439A/goose/Shantou/1806/2014 (A/H5N6) segment 3 (PA)3868.00.000000e+002132/2151 (99%)
text_code_colored.pngEPI598626A/chicken/Shenzhen/1061/2013 (A/H5N6) segment 3 (PA)3862.50.000000e+002131/2151 (99%)
text_code_colored.pngEPI568438A/goose/Shantou/1791/2014 (A/H5N6) segment 3 (PA)3862.50.000000e+002131/2151 (99%)
text_code_colored.pngEPI568437A/goose/Shantou/1763/2014 (A/H5N6) segment 3 (PA)3862.50.000000e+002131/2151 (99%)
text_code_colored.pngEPI599253A/chicken/Shenzhen/1395/2013 (A/H5N6) segment 3 (PA)3858.80.000000e+002130/2151 (99%)
text_code_colored.pngEPI599259A/duck/Dongguan/3069/2013 (A/H5N6) segment 3 (PA)3856.90.000000e+002130/2151 (99%)
text_code_colored.pngEPI599257A/duck/Dongguan/2685/2013 (A/H5N6) segment 3 (PA)3856.90.000000e+002130/2151 (99%)
text_code_colored.pngEPI681266A/chicken/Zhejiang/727026/2014 (A/H5N6) segment 3 (PA)3851.40.000000e+002129/2151 (98%)
text_code_colored.pngEPI644693A/swine/Guangdong/2/2014 (A/H5N6) segment 3 (PA)3851.40.000000e+002129/2151 (98%)
text_code_colored.pngEPI596609A/duck/Vietnam/LBM758/2014 (A/H5N6) segment 3 (PA)3851.40.000000e+002129/2151 (98%)
text_code_colored.pngEPI596597A/muscovy duck/Vietnam/LBM756/2014 (A/H5N6) segment 3 (PA)3847.70.000000e+002128/2151 (98%)
text_code_colored.pngEPI596591A/muscovy duck/Vietnam/LBM755/2014 (A/H5N6) segment 3 (PA)3847.70.000000e+002128/2151 (98%)
text_code_colored.pngEPI596579A/duck/Vietnam/LBM752/2014 (A/H5N6) segment 3 (PA)3847.70.000000e+002128/2151 (98%)
text_code_colored.pngEPI596573A/duck/Vietnam/LBM751/2014 (A/H5N6) segment 3 (PA)3847.70.000000e+002128/2151 (98%)
text_code_colored.pngEPI681265A/chicken/Zhejiang/727022/2014 (A/H5N6) segment 3 (PA)3845.80.000000e+002128/2151 (98%)
text_code_colored.pngEPI681257A/goose/Zhejiang/727092/2014 (A/H5N6) segment 3 (PA)3845.80.000000e+002128/2151 (98%)
text_code_colored.pngEPI599252A/chicken/Shenzhen/433/2013 (A/H5N6) segment 3 (PA)3845.80.000000e+002128/2151 (98%)
text_code_colored.pngEPI598625A/chicken/Shenzhen/715/2013 (A/H5N6) segment 3 (PA)3845.80.000000e+002128/2151 (98%)
text_code_colored.pngEPI596621A/duck/Vietnam/LBM760/2014 (A/H5N6) segment 3 (PA)3845.80.000000e+002128/2151 (98%)
text_code_colored.pngEPI596615A/duck/Vietnam/LBM759/2014 (A/H5N6) segment 3 (PA)3845.80.000000e+002128/2151 (98%)
text_code_colored.pngEPI596603A/muscovy duck/Vietnam/LBM757/2014 (A/H5N6) segment 3 (PA)3845.80.000000e+002128/2151 (98%)
text_code_colored.pngEPI596585A/muscovy duck/Vietnam/LBM754/2014 (A/H5N6) segment 3 (PA)3845.80.000000e+002128/2151 (98%)
text_code_colored.pngEPI576170A/duck/Guangzhou/41227/2014 (A/H5N6) segment 3 (PA)3845.80.000000e+002128/2151 (98%)
text_code_colored.pngEPI681267A/chicken/Zhejiang/727155/2014 (A/H5N6) segment 3 (PA)3834.80.000000e+002126/2151 (98%)
text_code_colored.pngEPI681258A/goose/Zhejiang/727110/2014 (A/H5N6) segment 3 (PA)3834.80.000000e+002126/2151 (98%)
text_code_colored.pngEPI681256A/duck/Zhejiang/727158/2014 (A/H5N6) segment 3 (PA)3834.80.000000e+002126/2151 (98%)
text_code_colored.pngEPI531455A/duck/Guangdong/GD01/2014 (A/H5N6) segment 3 (PA)3834.80.000000e+002126/2151 (98%)
text_code_colored.pngEPI590803A/duck/Jiangxi/NCDZT1126/2014 (A/H5N6) segment 3 (PA)3829.20.000000e+002125/2151 (98%)
text_code_colored.pngEPI590802A/duck/Jiangxi/NCDZT1123/2014 (A/H5N6) segment 3 (PA)3829.20.000000e+002125/2151 (98%)
text_code_colored.pngEPI576169A/Guangzhou/39715/2014 (A/H5N6) segment 3 (PA)3829.20.000000e+002126/2152 (98%)
text_code_colored.pngEPI590835A/pigeon/Sichuan/NCXN29/2014 (A/H5N1) segment 3 (PA)3812.60.000000e+002122/2151 (98%)
text_code_colored.pngEPI585975A/chicken/AnNing/1/2014 (A/H5N1) segment 3 (PA)3812.60.000000e+002122/2151 (98%)
text_code_colored.pngEPI590834A/duck/Sichuan/NCXN11/2014 (A/H5N1) segment 3 (PA)3807.10.000000e+002121/2151 (98%)
text_code_colored.pngEPI585957A/chicken/TongHai/302/2014 (A/H5N1) segment 3 (PA)3807.10.000000e+002121/2151 (98%)
text_code_colored.pngEPI424668A/duck/Vietnam/NCVD-1940/2012 (A/H5N1) segment 3 (PA)3801.50.000000e+002121/2152 (98%)
text_code_colored.pngEPI681250A/duck/Zhejiang/727041/2014 (A/H5N2) segment 3 (PA)3790.40.000000e+002118/2151 (98%)
text_code_colored.pngEPI681259A/goose/Zhejiang/925036/2014 (A/H5N6) segment 3 (PA)3779.40.000000e+002117/2152 (98%)
text_code_colored.pngEPI590833A/duck/Sichuan/NCXN10/2014 (A/H5N1) segment 3 (PA)3779.40.000000e+002117/2152 (98%)
text_code_colored.pngEPI585978A/chicken/DaLi/302/2014 (A/H5N1) segment 3 (PA)3779.40.000000e+002116/2151 (98%)
text_code_colored.pngEPI557749A/chicken/Vietnam/NCVD-KA423/2013 (A/H5N1) segment 3 (PA)3779.40.000000e+002117/2152 (98%)
text_code_colored.pngEPI461825A/duck/Hunan/S4220/2011 (A/H5N1) segment 3 (PA)3779.40.000000e+002117/2152 (98%)
text_code_colored.pngEPI598311A/quail/Nanchang/6631/2013 (A/H5N1) segment 3 (PA)3773.80.000000e+002116/2152 (98%)
text_code_colored.pngEPI375503A/Hong Kong/5923/2012 (A/H5N1) segment 3 (PA)3773.80.000000e+002116/2152 (98%)
text_code_colored.pngEPI598312A/duck/Nanchang/9789/2013 (A/H5N1) segment 3 (PA)3762.70.000000e+002114/2152 (98%)
text_code_colored.pngEPI599263A/environment/Jiangxi/10171/2014 (A/H5N6) segment 3 (PA)3751.70.000000e+002111/2151 (98%)
text_code_colored.pngEPI599262A/environment/Jiangxi/10164/2014 (A/H5N6) segment 3 (PA)3751.70.000000e+002111/2151 (98%)
text_code_colored.pngEPI599261A/duck/Jiangxi/10160/2014 (A/H5N6) segment 3 (PA)3751.70.000000e+002111/2151 (98%)
text_code_colored.pngEPI568709A/chicken/Zhejiang/6C2/2013 (A/H5N6) segment 3 (PA)3751.70.000000e+002111/2151 (98%)
text_code_colored.pngEPI568398A/black chicken/Jiangxi/10131/2014 (A/H0) segment 3 (PA)3751.70.000000e+002111/2151 (98%)
text_code_colored.pngEPI568382A/environment/Jiangxi/10170/2014 (A/H5N6) segment 3 (PA)3751.70.000000e+002111/2151 (98%)
text_code_colored.pngEPI568381A/black chicken/Jiangxi/10129/2014 (A/H5N6) segment 3 (PA)3751.70.000000e+002111/2151 (98%)
text_code_colored.pngEPI492512A/barn swallow/Hong Kong/1161/2010 (A/H5N1) segment 3 (PA)3751.70.000000e+002112/2152 (98%)
text_code_colored.pngEPI599254A/chicken/Shenzhen/1845/2013 (A/H5N6) segment 3 (PA)3746.10.000000e+002110/2151 (98%)
text_code_colored.pngEPI569709A/duck/Zhejiang/6D2/2013 (A/H5N6) segment 3 (PA)3746.10.000000e+002110/2151 (98%)
text_code_colored.pngEPI568399A/black chicken/Jiangxi/10136/2014 (A/H0) segment 3 (PA)3746.10.000000e+002110/2151 (98%)
text_code_colored.pngEPI425276A/duck/Vietnam/NCVD-673/2011 (A/H5N1) segment 3 (PA)3746.10.000000e+002111/2152 (98%)
text_code_colored.pngEPI405132A/duck/Vietnam/NCVD-672/2011 (A/H5N1) segment 3 (PA)3746.10.000000e+002111/2152 (98%)
text_code_colored.pngEPI681262A/goose/Zhejiang/925108/2014 (A/H5N6) segment 3 (PA)3740.60.000000e+002109/2151 (98%)
text_code_colored.pngEPI681260A/goose/Zhejiang/925105/2014 (A/H5N6) segment 3 (PA)3740.60.000000e+002109/2151 (98%)
text_code_colored.pngEPI681249A/duck/Zhejiang/77138/2014 (A/H5N2) segment 3 (PA)3740.60.000000e+002109/2151 (98%)
text_code_colored.pngEPI590827A/chicken/Sichuan/NCJPL1/2014 (A/H5N6) segment 3 (PA)3740.60.000000e+002109/2151 (98%)
text_code_colored.pngEPI557755A/duck/Vietnam/NCVD-A672/2011 (A/H5N1) segment 3 (PA)3740.60.000000e+002110/2152 (98%)
text_code_colored.pngEPI547394A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 3 (PA)3740.60.000000e+002109/2151 (98%)
text_code_colored.pngEPI347460A/Guangdong-Shenzhen/1/2011(H5N1) (A/H5N1) segment 3 (PA)3738.70.000000e+002100/2138 (98%)
text_code_colored.pngEPI590831A/duck/Sichuan/NCXJ16/2014 (A/H5N6) segment 3 (PA)3735.00.000000e+002108/2151 (98%)
text_code_colored.pngEPI590830A/duck/Sichuan/NCXJ24/2014 (A/H5N6) segment 3 (PA)3735.00.000000e+002108/2151 (98%)
text_code_colored.pngEPI590829A/duck/Sichuan/NCXJ15/2014 (A/H5N6) segment 3 (PA)3735.00.000000e+002108/2151 (98%)
text_code_colored.pngEPI681251A/goose/Zhejiang/77166/2014 (A/H5N2) segment 3 (PA)3729.50.000000e+002107/2151 (97%)
text_code_colored.pngEPI590832A/environment/Sichuan/NCLL1/2014 (A/H5N6) segment 3 (PA)3729.50.000000e+002107/2151 (97%)
text_code_colored.pngEPI585721A/swan goose/Jilin/JL01/2014 (A/H5N6) segment 3 (PA)3729.50.000000e+002107/2151 (97%)
text_code_colored.pngEPI438916A/duck/Vietnam/NCVD-927/2011 (A/H5N1) segment 3 (PA)3729.50.000000e+002108/2152 (97%)
text_code_colored.pngEPI425871A/duck/Vietnam/NCVD-1163/2011 (A/H5N1) segment 3 (PA)3729.50.000000e+002109/2153 (97%)
text_code_colored.pngEPI425228A/duck/Vietnam/NCVD-1160/2011 (A/H5N1) segment 3 (PA)3729.50.000000e+002109/2153 (97%)
text_code_colored.pngEPI337216A/Guangxi/1/2009 (A/H5N1) segment 3 (PA)3729.50.000000e+002108/2152 (97%)
text_code_colored.pngEPI336995A/duck/Zhejiang/2248/2011 (A/H5N1) segment 3 (PA)3729.50.000000e+002108/2152 (97%)
text_code_colored.pngEPI336993A/duck/Zhejiang/2244/2011 (A/H5N1) segment 3 (PA)3729.50.000000e+002108/2152 (97%)
text_code_colored.pngEPI336992A/duck/Zhejiang/2243/2011 (A/H5N1) segment 3 (PA)3729.50.000000e+002108/2152 (97%)
text_code_colored.pngEPI336991A/duck/Zhejiang/2242/2011 (A/H5N1) segment 3 (PA)3729.50.000000e+002108/2152 (97%)
text_code_colored.pngEPI336990A/duck/Zhejiang/224/2011 (A/H5N1) segment 3 (PA)3729.50.000000e+002108/2152 (97%)
text_code_colored.pngEPI280084A/Guangxi/1/2009 (A/H5N1) segment 3 (PA)3729.50.000000e+002108/2152 (97%)
text_code_colored.pngEPI424884A/duck/Vietnam/NCVD-920/2011 (A/H5N1) segment 3 (PA)3725.80.000000e+002107/2152 (97%)
text_code_colored.pngEPI568379A/duck/Jiangxi/13484/2014 (A/H5N6) segment 3 (PA)3724.00.000000e+002106/2151 (97%)
text_code_colored.pngEPI568378A/duck/Jiangxi/13475/2014 (A/H5N6) segment 3 (PA)3724.00.000000e+002106/2151 (97%)
text_code_colored.pngEPI557737A/duck/Vietnam/NCVD-KA25/2011 (A/H5N1) segment 3 (PA)3724.00.000000e+002108/2153 (97%)
text_code_colored.pngEPI533587A/Sichuan/26221/2014 (A/H5N6) segment 3 (PA)3724.00.000000e+002106/2151 (97%)
text_code_colored.pngEPI425863A/duck/Vietnam/NCVD-1162/2011 (A/H5N1) segment 3 (PA)3724.00.000000e+002108/2153 (97%)
text_code_colored.pngEPI425855A/duck/Vietnam/NCVD-1161/2011 (A/H5N1) segment 3 (PA)3724.00.000000e+002108/2153 (97%)
text_code_colored.pngEPI424868A/duck/Vietnam/NCVD-1026/2011 (A/H5N1) segment 3 (PA)3724.00.000000e+002107/2152 (97%)
text_code_colored.pngEPI424860A/duck/Vietnam/NCVD-1025/2011 (A/H5N1) segment 3 (PA)3724.00.000000e+002107/2152 (97%)
text_code_colored.pngEPI168039A/grey heron/Hong Kong/1046/2008 (A/H5N1) segment 3 (PA)3724.00.000000e+002107/2152 (97%)
text_code_colored.pngEPI610341A/chicken/Fujian/FZ02/2011 (A/H9N2) segment 3 (PA)3718.40.000000e+002107/2153 (97%)
text_code_colored.pngEPI590826A/Anas_crecca/Hubei/Chenhu1623-5/2014 (A/H5N6) segment 3 (PA)3718.40.000000e+002105/2151 (97%)
text_code_colored.pngEPI568377A/duck/Jiangxi/13469/2014 (A/H5N6) segment 3 (PA)3718.40.000000e+002105/2151 (97%)
text_code_colored.pngEPI424940A/duck/Vietnam/NCVD-885/2010 (A/H5N1) segment 3 (PA)3718.40.000000e+002106/2152 (97%)
text_code_colored.pngEPI424892A/chicken/Vietnam/NCVD-921/2011 (A/H5N1) segment 3 (PA)3718.40.000000e+002106/2152 (97%)
text_code_colored.pngEPI585720A/cat/Sichuan/SC18/2014 (A/H5N6) segment 3 (PA)3712.90.000000e+002104/2151 (97%)
text_code_colored.pngEPI425596A/duck/Vietnam/NCVD-1463/2012 (A/H5N1) segment 3 (PA)3712.90.000000e+002106/2153 (97%)
text_code_colored.pngEPI425196A/duck/Vietnam/NCVD129-7/2011 (A/H5N1) segment 3 (PA)3712.90.000000e+002106/2153 (97%)
text_code_colored.pngEPI336989A/duck/Zhejiang/213/2011 (A/H5N1) segment 3 (PA)3712.90.000000e+002105/2152 (97%)
text_code_colored.pngEPI681253A/goose/Zhejiang/77168/2014 (A/H5N2) segment 3 (PA)3707.30.000000e+002103/2151 (97%)
text_code_colored.pngEPI681252A/goose/Zhejiang/77167/2014 (A/H5N2) segment 3 (PA)3707.30.000000e+002103/2151 (97%)
text_code_colored.pngEPI590828A/duck/Sichuan/NCJPL7/2014 (A/H5N6) segment 3 (PA)3707.30.000000e+002103/2151 (97%)
text_code_colored.pngEPI589840A/duck/Nha Trang/75c131/2014 (A/H5N6) segment 3 (PA)3707.30.000000e+002103/2151 (97%)
text_code_colored.pngEPI589372A/muscovy duck/Quang Ninh/5c112/2013 (A/H5N6) segment 3 (PA)3707.30.000000e+002103/2151 (97%)
text_code_colored.pngEPI589348A/muscovy duck/Quang Ninh/4c111/2013 (A/H5N6) segment 3 (PA)3707.30.000000e+002103/2151 (97%)
text_code_colored.pngEPI475602A/wild duck/Fujian/1/2011 (A/H5N1) segment 3 (PA)3707.30.000000e+002104/2152 (97%)
text_code_colored.pngEPI425903A/chicken/Vietnam/NCVD-1254/2011 (A/H5N1) segment 3 (PA)3707.30.000000e+002105/2153 (97%)
text_code_colored.pngEPI424390A/duck/Vietnam/NCVD-1283/2012 (A/H5N1) segment 3 (PA)3707.30.000000e+002105/2153 (97%)
text_code_colored.pngEPI475614A/wild duck/Fujian/2/2011 (A/H5N1) segment 3 (PA)3701.80.000000e+002103/2152 (97%)
text_code_colored.pngEPI425004A/chicken/Vietnam/NCVD-1437/2012 (A/H5N1) segment 3 (PA)3701.80.000000e+002104/2153 (97%)
text_code_colored.pngEPI168055A/magpie robin/Hong Kong/1897/2008 (A/H5N1) segment 3 (PA)3701.80.000000e+002103/2152 (97%)
text_code_colored.pngEPI168047A/magpie robin/Hong Kong/1097/2008 (A/H5N1) segment 3 (PA)3701.80.000000e+002103/2152 (97%)
text_code_colored.pngEPI168007A/grey heron/Hong Kong/3088/2007 (A/H5N1) segment 3 (PA)3701.80.000000e+002103/2152 (97%)
text_code_colored.pngEPI585375A/duck/Vietnam/1151/2014 (A/H5N6) segment 3 (PA)3696.30.000000e+002101/2151 (97%)
text_code_colored.pngEPI681264A/goose/Zhejiang/1120132/2014 (A/H5N6) segment 3 (PA)3685.20.000000e+002099/2151 (97%)
text_code_colored.pngEPI168031A/great egret/Hong Kong/807/2008 (A/H5N1) segment 3 (PA)3679.60.000000e+002099/2152 (97%)
text_code_colored.pngEPI645775A/muscovy duck/Vietnam/HU1-1144/2014 (A/H5N6) segment 3 (PA)3668.60.000000e+002096/2151 (97%)
text_code_colored.pngEPI620868A/chicken/Vietnam/NCVD-398/2010 (A/H5N1) segment 3 (PA)3657.50.000000e+002095/2152 (97%)
text_code_colored.pngEPI350441A/chicken/Vietnam/NCVD-399/2010 (A/H5N1) segment 3 (PA)3657.50.000000e+002095/2152 (97%)
text_code_colored.pngEPI681263A/goose/Zhejiang/112080/2014 (A/H5N6) segment 3 (PA)3651.90.000000e+002093/2151 (97%)
text_code_colored.pngEPI620844A/chicken/Vietnam/NCVD-421/2010 (A/H5N1) segment 3 (PA)3651.90.000000e+002094/2152 (97%)
text_code_colored.pngEPI350488A/chicken/Vietnam/NCVD-421/2010 (A/H5N1) segment 3 (PA)3651.90.000000e+002094/2152 (97%)
text_code_colored.pngEPI350433A/chicken/Vietnam/NCVD-398/2010 (A/H5N1) segment 3 (PA)3650.10.000000e+002093/2152 (97%)
text_code_colored.pngEPI337230A/Hubei/1/2010 (A/H5N1) segment 3 (PA)3646.40.000000e+002093/2152 (97%)
text_code_colored.pngEPI267028A/Hubei/1/2010 (A/H5N1) segment 3 (PA)3646.40.000000e+002093/2152 (97%)
text_code_colored.pngEPI348919A/duck/Vietnam/NCVD-431/2010 (A/H5N1) segment 3 (PA)3640.90.000000e+002092/2152 (97%)
text_code_colored.pngEPI425428A/duck/Vietnam/NCVD-1207/2012 (A/H5N1) segment 3 (PA)3635.30.000000e+002091/2152 (97%)
text_code_colored.pngEPI350147A/chicken/Vietnam/NCVD-389/2009 (A/H5N1) segment 3 (PA)3635.30.000000e+002091/2152 (97%)
text_code_colored.pngEPI427349A/chicken/Vietnam/NCVD-668/2010 (A/H5N1) segment 3 (PA)3629.80.000000e+002090/2152 (97%)
text_code_colored.pngEPI425767A/duck/Vietnam/NCVD-671/2011 (A/H5N1) segment 3 (PA)3629.80.000000e+002090/2152 (97%)
text_code_colored.pngEPI425500A/duck/Vietnam/NCVD-946/2011 (A/H5N1) segment 3 (PA)3629.80.000000e+002091/2153 (97%)
text_code_colored.pngEPI425292A/duck/Vietnam/NCVD-669/2011 (A/H5N1) segment 3 (PA)3629.80.000000e+002090/2152 (97%)
text_code_colored.pngEPI424358A/duck/Vietnam/NCVD-1206/2012 (A/H5N1) segment 3 (PA)3629.80.000000e+002090/2152 (97%)
text_code_colored.pngEPI351365A/duck/Vietnam/NCVD-423/2010 (A/H5N1) segment 3 (PA)3629.80.000000e+002091/2153 (97%)
text_code_colored.pngEPI515025A/duck/Hunan/749/2011 (A/H0) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI515022A/duck/Hunan/747/2011 (A/H0) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI424956A/duck/Vietnam/NCVD-891/2010 (A/H5N1) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI424948A/duck/Vietnam/NCVD-890/2010 (A/H5N1) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI424916A/duck/Vietnam/NCVD-945/2011 (A/H5N1) segment 3 (PA)3624.20.000000e+002090/2153 (97%)
text_code_colored.pngEPI387934A/muscovy duck/Vietnam/LBM66/2011 (A/H5N1) segment 3 (PA)3624.20.000000e+002090/2153 (97%)
text_code_colored.pngEPI348891A/duck/Vietnam/NCVD-461/2010 (A/H5N1) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI348884A/duck/Vietnam/NCVD-460/2010 (A/H5N1) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI337127A/Guangdong/2/2006 (A/H5N1) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI280021A/Guangdong/2/2006 (A/H5N1) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI126697A/human/China/GD02/2006 (A/H5N1) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI113326A/Shenzhen/406H/2006 (A/H5N1) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI113026A/little egret/Hong Kong/718/2006 (A/H5N1) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI530061A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 3 (PA)3618.70.000000e+002089/2153 (97%)
text_code_colored.pngEPI427342A/chicken/Vietnam/NCVD-700/2011 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI425532A/duck/Vietnam/NCVD-815/2010 (A/H5N1) segment 3 (PA)3618.70.000000e+002089/2153 (97%)
text_code_colored.pngEPI425236A/duck/Vietnam/NCVD-1171/2012 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI424996A/duck/Vietnam/NCVD-714/2011 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI424964A/chicken/Vietnam/NCVD-709/2011 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI424828A/duck/Vietnam/NCVD-711/2011 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI424812A/duck/Vietnam/NCVD-712/2011 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI424382A/chicken/Vietnam/NCVD-685/2011 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI424374A/duck/Vietnam/NCVD-680/2011 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI387927A/muscovy duck/Vietnam/LBM57/2011 (A/H5N1) segment 3 (PA)3618.70.000000e+002089/2153 (97%)
text_code_colored.pngEPI387920A/muscovy duck/Vietnam/LBM14/2011 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI348877A/chicken/Vietnam/NCVD-459/2010 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI348856A/duck/Vietnam/NCVD-449/2010 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI348842A/duck/Vietnam/NCVD-432/2010 (A/H5N1) segment 3 (PA)3618.70.000000e+002089/2153 (97%)
text_code_colored.pngEPI227015A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI170663A/chicken/Vietnam/209/2005 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI170641A/chicken/Vietnam/212/2005 (A/H5N1) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI620871A/chicken/Vietnam/NCVD-675/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI557756A/chicken/Vietnam/NCVD-A675/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI539359A/Viet Nam/CM32/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI461826A/duck/Hunan/S4234/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI438915A/chicken/Vietnam/NCVD-675/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI427335A/chicken/Vietnam/NCVD-686/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI425815A/muscovy duck/Vietnam/NCVD-1049/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI425775A/chicken/Vietnam/NCVD-1034/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002088/2153 (96%)
text_code_colored.pngEPI425548A/duck/Vietnam/NCVD-850/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI425340A/chicken/Vietnam/NCVD-753/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002086/2151 (96%)
text_code_colored.pngEPI425284A/duck/Vietnam/NCVD-674/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI425028A/duck/Vietnam/NCVD-754/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002086/2151 (96%)
text_code_colored.pngEPI424972A/chicken/Vietnam/NCVD-710/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI424932A/chicken/Vietnam/NCVD-752/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002086/2151 (96%)
text_code_colored.pngEPI424908A/duck/Vietnam/NCVD-943/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002088/2153 (96%)
text_code_colored.pngEPI424430A/chicken/Vietnam/NCVD-705/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI424422A/chicken/Vietnam/NCVD-704/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI424414A/chicken/Vietnam/NCVD-703/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI424406A/chicken/Vietnam/NCVD-702/2011 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI424366A/duck/Vietnam/NCVD-664/2010 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI225093A/duck/Nam Dinh/218/2006 (A/H5) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI224970A/chicken/Hong Kong/D-06-0947/2006 (A/H5N1) segment 3 (PA)3613.20.000000e+002088/2153 (96%)
text_code_colored.pngEPI170655A/duck/Vietnam/210/2005 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI170648A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI170634A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI170620A/chicken/Vietnam/216/2005 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI170612A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI170604A/duck/Vietnam/218/2005 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI170596A/duck/Vietnam/219/2005 (A/H5N1) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI113028A/chicken/Hong Kong/947/2006 (A/H5N1) segment 3 (PA)3613.20.000000e+002088/2153 (96%)
text_code_colored.pngEPI448035A/crow/Bangladesh/1019/2011 (A/H5N1) segment 3 (PA)3607.60.000000e+002088/2154 (96%)
text_code_colored.pngEPI425564A/chicken/Vietnam/NCVD-857/2011 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI425524A/chicken/Vietnam/NCVD-802/2011 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI425444A/duck/Vietnam/NCVD-1219/2012 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI425316A/duck/Vietnam/NCVD-1217/2012 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI425164A/chicken/Vietnam/NCVD-854/2011 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI424820A/duck/Vietnam/NCVD-806/2011 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI424764A/duck/Vietnam/NCVD-851/2011 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI348863A/duck/Vietnam/NCVD-456/2010 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI348786A/duck/Vietnam/NCVD-458/2010 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI270187A/Vietnam/UT30850/2005 (A/H5N1) segment 3 (PA)3607.60.000000e+002084/2149 (96%)
text_code_colored.pngEPI246275A/duck/Korea/NSQ263/2008 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI246271A/chicken/Korea/ISQ250/2008 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI220340A/chicken/Primorje/1/2008 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI173066A/chicken/Primorsky/85/2008 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI170719A/chicken/Vietnam/202/2005 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI170679A/duck/Vietnam/207/2005 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI113074A/duck/Guangxi/5457/2005 (A/H5N1) segment 3 (PA)3607.60.000000e+002087/2153 (96%)
text_code_colored.pngEPI113020A/magpie robin/Hong Kong/366/2006 (A/H5N1) segment 3 (PA)3607.60.000000e+002082/2146 (97%)
text_code_colored.pngEPI113018A/chicken/Hong Kong/282/2006 (A/H5N1) segment 3 (PA)3607.60.000000e+002086/2152 (96%)
text_code_colored.pngEPI448163A/crow/Bangladesh/316T/2011 (A/H5N1) segment 3 (PA)3602.10.000000e+002087/2154 (96%)
text_code_colored.pngEPI448147A/crow/Bangladesh/1056/2011 (A/H5N1) segment 3 (PA)3602.10.000000e+002087/2154 (96%)
text_code_colored.pngEPI448051A/crow/Bangladesh/1054/2011 (A/H5N1) segment 3 (PA)3602.10.000000e+002087/2154 (96%)
text_code_colored.pngEPI448043A/crow/Bangladesh/1020/2011 (A/H5N1) segment 3 (PA)3602.10.000000e+002087/2154 (96%)
text_code_colored.pngEPI438986A/duck/Vietnam/NCVD-935/2011 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI438917A/duck/Vietnam/NCVD-931/2011 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI425911A/duck/Vietnam/NCVD-1304/2012 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI425823A/chicken/Vietnam/NCVD-1059/2011 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI425556A/duck/Vietnam/NCVD-645/2010 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI425412A/duck/Vietnam/NCVD-1306/2012 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI424844A/duck/Vietnam/NCVD-1018/2011 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI352356A/chicken/India/CL03485/2011 (A/H5N1) segment 3 (PA)3602.10.000000e+002087/2154 (96%)
text_code_colored.pngEPI352350A/chicken/India/CA0303/2011 (A/H5N1) segment 3 (PA)3602.10.000000e+002087/2154 (96%)
text_code_colored.pngEPI352336A/chicken/India/CA0301/2011 (A/H5N1) segment 3 (PA)3602.10.000000e+002087/2154 (96%)
text_code_colored.pngEPI246270A/chicken/Korea/Gimje/2008 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI170627A/duck/Vietnam/215/2005 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI152395A/whooper swan/Hokkaido/1/2008 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI113120A/duck/Hunan/5152/2005 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI113118A/duck/Hunan/5106/2005 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI113068A/duck/Guangxi/5165/2005 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI113064A/chicken/Guangxi/4989/2005 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI113060A/goose/Guangxi/4513/2005 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI113058A/duck/Guangxi/4428/2005 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI113056A/goose/Guangxi/4289/2005 (A/H5N1) segment 3 (PA)3602.10.000000e+002085/2152 (96%)
text_code_colored.pngEPI448027A/crow/Bangladesh/1008/2011 (A/H5N1) segment 3 (PA)3596.50.000000e+002086/2154 (96%)
text_code_colored.pngEPI425943A/chicken/Vietnam/NCVD-715/2011 (A/H5N1) segment 3 (PA)3596.50.000000e+002085/2153 (96%)
text_code_colored.pngEPI425540A/duck/Vietnam/NCVD-825/2011 (A/H5N1) segment 3 (PA)3596.50.000000e+002084/2152 (96%)
text_code_colored.pngEPI425332A/duck/Vietnam/NCVD-1221/2012 (A/H5N1) segment 3 (PA)3596.50.000000e+002084/2152 (96%)
text_code_colored.pngEPI424780A/duck/Vietnam/NCVD-861/2011 (A/H5N1) segment 3 (PA)3596.50.000000e+002085/2153 (96%)
text_code_colored.pngEPI424772A/duck/Vietnam/NCVD-859/2011 (A/H5N1) segment 3 (PA)3596.50.000000e+002085/2153 (96%)
text_code_colored.pngEPI424398A/chicken/Vietnam/NCVD-699/2011 (A/H5N1) segment 3 (PA)3596.50.000000e+002084/2152 (96%)
text_code_colored.pngEPI352330A/chicken/India/TR0383/2011 (A/H5N1) segment 3 (PA)3596.50.000000e+002086/2154 (96%)
text_code_colored.pngEPI352286A/duck/India/02AF1/2011 (A/H5N1) segment 3 (PA)3596.50.000000e+002086/2154 (96%)
text_code_colored.pngEPI170695A/duck/Vietnam/205/2005 (A/H5N1) segment 3 (PA)3596.50.000000e+002084/2152 (96%)
text_code_colored.pngEPI170671A/duck/Vietnam/208/2005 (A/H5N1) segment 3 (PA)3596.50.000000e+002084/2152 (96%)
text_code_colored.pngEPI164581A/whooper swan/Aomori/1/2008 (A/H5N1) segment 3 (PA)3596.50.000000e+002084/2152 (96%)
text_code_colored.pngEPI113096A/chicken/Guiyang/29/2006 (A/H5N1) segment 3 (PA)3596.50.000000e+002084/2152 (96%)
text_code_colored.pngEPI113076A/duck/Guangxi/150/2006 (A/H5N1) segment 3 (PA)3596.50.000000e+002084/2152 (96%)
text_code_colored.pngEPI113070A/duck/Guangxi/5270/2005 (A/H5N1) segment 3 (PA)3596.50.000000e+002084/2152 (96%)
text_code_colored.pngEPI557741A/duck/Vietnam/NCVD-KA250/2012 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI531379A/hill myna/Heilongjiang/0704/2012 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI503724A/Japanese white-eye/Taoyuan/Q454/2012 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI448920A/crow/Bangladesh/1058/2011 (A/H5N1) segment 3 (PA)3591.00.000000e+002085/2154 (96%)
text_code_colored.pngEPI448885A/crow/Bangladesh/315T/2011 (A/H5N1) segment 3 (PA)3591.00.000000e+002085/2154 (96%)
text_code_colored.pngEPI448099A/duck/Bangladesh/1849/2011 (A/H5N1) segment 3 (PA)3591.00.000000e+002085/2154 (96%)
text_code_colored.pngEPI425372A/duck/Vietnam/NCVD-1234/2012 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI425364A/duck/Vietnam/NCVD-1232/2012 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI425348A/chicken/Vietnam/NCVD-1223/2012 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI424852A/duck/Vietnam/NCVD-1022/2011 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI389929A/duck/Vietnam/LBM136/2012 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI352343A/chicken/India/CA0302/2011 (A/H5N1) segment 3 (PA)3591.00.000000e+002085/2154 (96%)
text_code_colored.pngEPI350154A/chicken/Vietnam/NCVD-390/2009 (A/H5N1) segment 3 (PA)3591.00.000000e+002084/2153 (96%)
text_code_colored.pngEPI222501A/red-billed starling/Hong Kong/4925/2007 (A/H5N1) segment 3 (PA)3591.00.000000e+002063/2122 (97%)
text_code_colored.pngEPI222033A/environment/Hunan/5-32/2007 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI167968A/common magpie/Hong Kong/5052/2007 (A/H5N1) segment 3 (PA)3591.00.000000e+002063/2122 (97%)
text_code_colored.pngEPI164589A/whooper swan/Aomori/2/2008 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI164372A/goose/Yunnan/6193/2006 (A/H5N1) segment 3 (PA)3591.00.000000e+002084/2153 (96%)
text_code_colored.pngEPI161545A/whooper swan/Akita/1/2008 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI113266A/duck/Guiyang/1081/2006 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI113264A/goose/Guiyang/765/2006 (A/H5N1) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI113062A/duck/Guangxi/4830/2005 (A/H5N1) segment 3 (PA)3591.00.000000e+002079/2146 (96%)
text_code_colored.pngEPI113016A/magpie robin/Hong Kong/75/2006 (A/H5N1) segment 3 (PA)3591.00.000000e+002075/2140 (96%)
text_code_colored.pngEPI448059A/crow/Bangladesh/1061/2011 (A/H5N1) segment 3 (PA)3587.30.000000e+002084/2154 (96%)
text_code_colored.pngEPI642453A/crow/India/01CA12/2012 (A/H5N1) segment 3 (PA)3585.50.000000e+002084/2154 (96%)
text_code_colored.pngEPI557745A/duck/Vietnam/NCVD-KA309/2012 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI557734A/crow/India/01TR01/2012 (A/H5N1) segment 3 (PA)3585.50.000000e+002084/2154 (96%)
text_code_colored.pngEPI448155A/crow/Bangladesh/313T/2011 (A/H5N1) segment 3 (PA)3585.50.000000e+002084/2154 (96%)
text_code_colored.pngEPI448139A/chicken/Bangladesh/11303/2011 (A/H5N1) segment 3 (PA)3585.50.000000e+002084/2154 (96%)
text_code_colored.pngEPI425879A/duck/Vietnam/NCVD-1182/2012 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI425404A/duck/Vietnam/NCVD-1269/2012 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI425396A/muscovy duck/Vietnam/NCVD-1256/2012 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI425052A/duck/Vietnam/NCVD-760/2011 (A/H5N1) segment 3 (PA)3585.50.000000e+002083/2153 (96%)
text_code_colored.pngEPI425044A/duck/Vietnam/NCVD-759/2011 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI425036A/duck/Vietnam/NCVD-758/2011 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI424924A/duck/Vietnam/NCVD-947/2011 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI424692A/duck/Vietnam/NCVD-948/2011 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI424660A/chicken/Vietnam/NCVD-1255/2012 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI389921A/duck/Vietnam/LBM133/2012 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI389913A/duck/Vietnam/LBM132/2012 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI337940A/Guangxi/1/2005 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI337088A/Hunan/1/2006 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI280092A/Hunan/1/2006 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI246273A/chicken/Korea/YAQ173/2008 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI222025A/environment/Hunan/5-25/2007 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI167991A/little egret/Hong Kong/8550/2007 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI167983A/house crow/Hong Kong/5288/2007 (A/H5N1) segment 3 (PA)3585.50.000000e+002062/2122 (97%)
text_code_colored.pngEPI167889A/peregrine falcon/Hong Kong/1143/2007 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI164292A/duck/Yunnan/6490/2006 (A/H5N1) segment 3 (PA)3585.50.000000e+002083/2153 (96%)
text_code_colored.pngEPI164263A/Guangxi/1/2005 (A/H5N1) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI623579A/crow/India/11TI07/2011 (A/H5N1) segment 3 (PA)3579.90.000000e+002083/2154 (96%)
text_code_colored.pngEPI557742A/duck/Vietnam/NCVD-KA260/2012 (A/H5N1) segment 3 (PA)3579.90.000000e+002082/2153 (96%)
text_code_colored.pngEPI448187A/goose/Bangladesh/4051T/2011 (A/H5N1) segment 3 (PA)3579.90.000000e+002083/2154 (96%)
text_code_colored.pngEPI448107A/waterfowl/Bangladesh/33025/2011 (A/H5N1) segment 3 (PA)3579.90.000000e+002083/2154 (96%)
text_code_colored.pngEPI425839A/duck/Vietnam/NCVD3-8/2011 (A/H5N1) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI425799A/duck/Vietnam/NCVD-1044/2011 (A/H5N1) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI425783A/chicken/Vietnam/NCVD-1040/2011 (A/H5N1) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI425612A/chicken/Vietnam/NCVD-1488/2012 (A/H5N1) segment 3 (PA)3579.90.000000e+002082/2153 (96%)
text_code_colored.pngEPI425220A/duck/Vietnam/NCVD1-48/2011 (A/H5N1) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI424876A/duck/Vietnam/NCVD-1029/2011 (A/H5N1) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI389952A/muscovy duck/Vietnam/LBM113/2012 (A/H5N1) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI348870A/duck/Vietnam/NCVD-457/2010 (A/H5N1) segment 3 (PA)3579.90.000000e+002082/2153 (96%)
text_code_colored.pngEPI168015A/common buzzard/Hong Kong/9213/2007 (A/H5N1) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI113290A/duck/Guangxi/1830/2006 (A/H5N1) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI113260A/goose/Guiyang/1794/2006 (A/H5N1) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI113080A/duck/Guangxi/288/2006 (A/H5N1) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI510400A/environment/Bangladesh/12197/2011 (A/H5N1) segment 3 (PA)3578.10.000000e+002082/2155 (96%)
text_code_colored.pngEPI585437A/crow/India/11CA01/2011 (A/H5N1) segment 3 (PA)3576.20.000000e+002082/2154 (96%)
text_code_colored.pngEPI557746A/duck/Vietnam/NCVD-KA310/2012 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI557743A/duck/Vietnam/NCVD-KA261/2012 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI461032A/duck/Vietnam/QB1207/2012 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI448267A/chicken/Bangladesh/42010/2012 (A/H5N1) segment 3 (PA)3574.40.000000e+002082/2154 (96%)
text_code_colored.pngEPI448219A/duck/Bangladesh/4124T/2011 (A/H5N1) segment 3 (PA)3574.40.000000e+002082/2154 (96%)
text_code_colored.pngEPI448211A/duck/Bangladesh/4120T/2011 (A/H5N1) segment 3 (PA)3574.40.000000e+002082/2154 (96%)
text_code_colored.pngEPI448171A/chicken/Bangladesh/3072/2011 (A/H5N1) segment 3 (PA)3574.40.000000e+002082/2154 (96%)
text_code_colored.pngEPI425847A/duck/Vietnam/NCVD3-31/2011 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI425807A/duck/Vietnam/NCVD-1048/2011 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI425791A/duck/Vietnam/NCVD-1042/2011 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI425252A/dove/Vietnam/NCVD-1178/2012 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI425244A/chicken/Vietnam/NCVD-1177/2012 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI221743A/chicken/Hunan/3/2007 (A/H5N1) segment 3 (PA)3574.40.000000e+002081/2153 (96%)
text_code_colored.pngEPI220521A/environment/Hunan/6-45/2008 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI164316A/goose/Yunnan/4389/2006 (A/H5N1) segment 3 (PA)3574.40.000000e+002081/2153 (96%)
text_code_colored.pngEPI164308A/goose/Yunnan/4371/2006 (A/H5N1) segment 3 (PA)3574.40.000000e+002081/2153 (96%)
text_code_colored.pngEPI113286A/duck/Guangxi/1550/2006 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI113284A/goose/Guangxi/1458/2006 (A/H5N1) segment 3 (PA)3574.40.000000e+002081/2153 (96%)
text_code_colored.pngEPI113256A/goose/Guiyang/1636/2006 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI113078A/goose/Guangxi/224/2006 (A/H5N1) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI448906A/duck/Bangladesh/4117T/2011 (A/H5N1) segment 3 (PA)3570.70.000000e+002081/2154 (96%)
text_code_colored.pngEPI448179A/chicken/Bangladesh/3075/2011 (A/H5N1) segment 3 (PA)3570.70.000000e+002081/2154 (96%)
text_code_colored.pngEPI642454A/crow/India/02CA03/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002080/2153 (96%)
text_code_colored.pngEPI642416A/crow/India/11TI16/2011 (A/H5N1) segment 3 (PA)3568.80.000000e+002081/2154 (96%)
text_code_colored.pngEPI557750A/chicken/Vietnam/NCVD-KA432/2013 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI557744A/duck/Vietnam/NCVD-KA262/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI448913A/duck/Bangladesh/4059T/2011 (A/H5N1) segment 3 (PA)3568.80.000000e+002081/2154 (96%)
text_code_colored.pngEPI448251A/environment/Bangladesh/1017-1/2011 (A/H5N1) segment 3 (PA)3568.80.000000e+002082/2155 (96%)
text_code_colored.pngEPI448235A/environment/Bangladesh/1018/2011 (A/H5N1) segment 3 (PA)3568.80.000000e+002081/2154 (96%)
text_code_colored.pngEPI448195A/chicken/Bangladesh/4058/2011 (A/H5N1) segment 3 (PA)3568.80.000000e+002081/2154 (96%)
text_code_colored.pngEPI448115A/environment/Bangladesh/1017/2011 (A/H5N1) segment 3 (PA)3568.80.000000e+002081/2154 (96%)
text_code_colored.pngEPI432707A/muscovy duck/Vietnam/LBM260/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI425951A/chicken/Vietnam/NCVD-1038/2011 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI425927A/duck/Vietnam/NCVD-1544/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI425895A/duck/Vietnam/NCVD-1251/2011 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI425388A/duck/Vietnam/NCVD-1253/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI425324A/muscovy duck/Vietnam/NCVD-1220/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002080/2153 (96%)
text_code_colored.pngEPI425308A/duck/Vietnam/NCVD-1904/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI425268A/duck/Vietnam/NCVD-1901/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI425172A/chicken/Vietnam/NCVD-1942/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI425148A/duck/Vietnam/NCVD-1935/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI425100A/duck/Vietnam/NCVD-1497/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI425060A/duck/Vietnam/NCVD-1252/2011 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI424740A/duck/Vietnam/NCVD-1932/2012 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI337075A/Sichuan/2/2006 (A/H5N1) segment 3 (PA)3568.80.000000e+002081/2154 (96%)
text_code_colored.pngEPI221896A/duck/Hunan/3/2007 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI220537A/environment/Hunan/7-73/2008 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI220270A/black-crowned night heron/Hong Kong/659/2008 (A/H5N1) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI164237A/Sichuan/2/2006 (A/H5N1) segment 3 (PA)3568.80.000000e+002081/2154 (96%)
text_code_colored.pngEPI167758A/chicken/Vietnam/NCVD-44/2007 (A/H5N1) segment 3 (PA)3565.20.000000e+002078/2153 (96%)
text_code_colored.pngEPI642460A/chicken/Bhutan/01TR12/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002080/2154 (96%)
text_code_colored.pngEPI642458A/chicken/Bhutan/01CL140/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002080/2154 (96%)
text_code_colored.pngEPI642420A/pigeon/Bhutan/01BR01/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002080/2154 (96%)
text_code_colored.pngEPI510398A/chicken/Bangladesh/18061/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002080/2154 (96%)
text_code_colored.pngEPI510375A/chicken/Bangladesh/18065/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002080/2154 (96%)
text_code_colored.pngEPI489676A/tiger/Jiangsu/01/2013 (A/H5N1) segment 3 (PA)3563.30.000000e+002079/2153 (96%)
text_code_colored.pngEPI461689A/duck/Hunan/S4030/2011 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI459256A/duck/Quanh Ninh/21/2013 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI442652A/chicken/Bangladesh/12VIR-7140-19/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002079/2153 (96%)
text_code_colored.pngEPI438149A/muscovy duck/Vietnam/LBM295/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI432699A/muscovy duck/Vietnam/LBM258/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI425935A/duck/Vietnam/NCVD-1875/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI425919A/duck/Vietnam/NCVD-1547/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI425887A/duck/Vietnam/NCVD-1212/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002079/2153 (96%)
text_code_colored.pngEPI425684A/duck/Vietnam/NCVD-1602/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI425668A/duck/Vietnam/NCVD-1905/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI425644A/duck/Vietnam/NCVD-1936/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002079/2153 (96%)
text_code_colored.pngEPI425436A/duck/Vietnam/NCVD-1210/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002079/2153 (96%)
text_code_colored.pngEPI425380A/chicken/Vietnam/NCVD-1248/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI425180A/duck/Vietnam/NCVD-1944/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI425140A/duck/Vietnam/NCVD-1933/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI425124A/duck/Vietnam/NCVD-1872/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI425108A/duck/Vietnam/NCVD-1943/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI425020A/duck/Vietnam/NCVD-1884/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI425012A/duck/Vietnam/NCVD-1878/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI424988A/duck/Vietnam/NCVD-1607/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI424980A/duck/Vietnam/NCVD-1584/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI424732A/chicken/Vietnam/NCVD-1927/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI424716A/duck/Vietnam/NCVD-1897/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI424708A/duck/Vietnam/NCVD-1896/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI389945A/duck/Vietnam/LBM140/2012 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI355442A/swan/Shanghai/10/2009 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI246272A/chicken/Korea/USQ284/2008 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI167782A/Muscovy duck/Vietnam/NCVD-46/2007 (A/H5N1) segment 3 (PA)3563.30.000000e+002080/2154 (96%)
text_code_colored.pngEPI164557A/duck/Laos/P0106/2007 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI113292A/goose/Guangxi/1898/2006 (A/H5N1) segment 3 (PA)3563.30.000000e+002078/2152 (96%)
text_code_colored.pngEPI113288A/goose/Guangxi/1633/2006 (A/H5N1) segment 3 (PA)3563.30.000000e+002079/2153 (96%)
text_code_colored.pngEPI113254A/duck/Guiyang/1558/2006 (A/H5N1) segment 3 (PA)3563.30.000000e+002079/2153 (96%)
text_code_colored.pngEPI113066A/duck/Guangxi/5075/2005 (A/H5N1) segment 3 (PA)3563.30.000000e+002065/2132 (96%)
text_code_colored.pngEPI448203A/chicken/Bangladesh/4070T/2011 (A/H5N1) segment 3 (PA)3561.50.000000e+002079/2153 (96%)
text_code_colored.pngEPI510354A/environment/Bangladesh/15661/2012 (A/H5N1) segment 3 (PA)3559.60.000000e+002079/2154 (96%)
text_code_colored.pngEPI425300A/duck/Vietnam/NCVD-1902/2012 (A/H5N1) segment 3 (PA)3559.60.000000e+002077/2152 (96%)
text_code_colored.pngEPI246274A/duck/Korea/JEQ149/2008 (A/H5N1) segment 3 (PA)3559.60.000000e+002077/2152 (96%)
text_code_colored.pngEPI557748A/duck/Vietnam/NCVD-KA368/2012 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI500776A/Alberta/01/2014 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI460939A/muscovy duck/Vietnam/LBM398/2013 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI448892A/waterfowl/Bangladesh/31935/2011 (A/H5N1) segment 3 (PA)3557.80.000000e+002079/2154 (96%)
text_code_colored.pngEPI425676A/duck/Vietnam/NCVD-1593/2012 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI425636A/duck/Vietnam/NCVD-1931/2012 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI425628A/duck/Vietnam/NCVD-1928/2012 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI425604A/chicken/Vietnam/NCVD-1963/2012 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI425468A/chicken/Vietnam/NCVD-1247/2012 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI425132A/duck/Vietnam/NCVD-1899/2012 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI424836A/duck/Vietnam/NCVD-952/2011 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI424724A/duck/Vietnam/NCVD-1898/2012 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI424187A/muscovy duck/Vietnam/LBM229/2012 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI424179A/muscovy duck/Vietnam/LBM228/2012 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI408096A/village chicken/Kyaing Tong/2433/2007 (A/H5N1) segment 3 (PA)3557.80.000000e+002078/2153 (96%)
text_code_colored.pngEPI406383A/chicken/Ha Tay/44/2007 (A/H5N1) segment 3 (PA)3557.80.000000e+002078/2153 (96%)
text_code_colored.pngEPI389937A/duck/Vietnam/LBM139/2012 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI361515A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 3 (PA)3557.80.000000e+002078/2153 (96%)
text_code_colored.pngEPI337058A/Anhui/1/2005 (A/H5N1) segment 3 (PA)3557.80.000000e+002079/2154 (96%)
text_code_colored.pngEPI275773A/chicken/Hunan/21/2005 (A/H5N1) segment 3 (PA)3557.80.000000e+002078/2153 (96%)
text_code_colored.pngEPI221579A/Daurian starling/Hong Kong/1532/2007 (A/H5N1) segment 3 (PA)3557.80.000000e+002045/2104 (97%)
text_code_colored.pngEPI180910A/chicken/Laos/16/2008 (A/H5N1) segment 3 (PA)3557.80.000000e+002078/2153 (96%)
text_code_colored.pngEPI180822A/duck/Laos/P0127/2007 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI164276A/duck/Yunnan/4873/2006 (A/H5N1) segment 3 (PA)3557.80.000000e+002078/2153 (96%)
text_code_colored.pngEPI164220A/Anhui/1/2005 (A/H5N1) segment 3 (PA)3557.80.000000e+002079/2154 (96%)
text_code_colored.pngEPI139938A/Duck/Fujian/1734/05 (A/H5N1) segment 3 (PA)3557.80.000000e+002078/2153 (96%)
text_code_colored.pngEPI113296A/duck/Guangxi/2143/2006 (A/H5N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI681255A/chicken/Zhejiang/727159/2014 (A/H5N2) segment 3 (PA)3552.20.000000e+002075/2151 (96%)
text_code_colored.pngEPI567036A/muscovy duck/Quang Ninh/48c1-4-1/2013 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI557747A/duck/Vietnam/NCVD-KA311/2012 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI510985A/chicken/Bangladesh/15085/2012 (A/H5N1) segment 3 (PA)3552.20.000000e+002078/2154 (96%)
text_code_colored.pngEPI461535A/muscovy duck/Vietnam/LBM344/2013 (A/H5N1) segment 3 (PA)3552.20.000000e+002075/2151 (96%)
text_code_colored.pngEPI460947A/muscovy duck/Vietnam/LBM399/2013 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI448275A/duck/Bangladesh/32077/2012 (A/H5N1) segment 3 (PA)3552.20.000000e+002079/2155 (96%)
text_code_colored.pngEPI425652A/duck/Vietnam/NCVD-1968/2012 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI424700A/duck/Vietnam/NCVD-1869/2012 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI424684A/duck/Vietnam/NCVD-1974/2012 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI424195A/muscovy duck/Vietnam/LBM230/2012 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI424171A/muscovy duck/Vietnam/LBM227/2012 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI337094A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002080/2156 (96%)
text_code_colored.pngEPI279945A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002080/2156 (96%)
text_code_colored.pngEPI275981A/duck/Hubei/49/2005 (A/H5N1) segment 3 (PA)3552.20.000000e+002078/2154 (96%)
text_code_colored.pngEPI180886A/chicken/Laos/P0130/2007 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI180846A/duck/Laos/A0301/2007 (A/H5N1) segment 3 (PA)3552.20.000000e+002078/2154 (96%)
text_code_colored.pngEPI164565A/chicken/Laos/P0169/2007 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI164549A/duck/Laos/P0050/2007 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI164324A/goose/Yunnan/4985/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002077/2153 (96%)
text_code_colored.pngEPI113294A/chicken/Guangxi/1951/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002077/2153 (96%)
text_code_colored.pngEPI113280A/duck/Guangxi/1258/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI113246A/goose/Guiyang/4030/2005 (A/H5N1) segment 3 (PA)3552.20.000000e+002078/2154 (96%)
text_code_colored.pngEPI113102A/goose/Guiyang/538/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002078/2154 (96%)
text_code_colored.pngEPI113100A/duck/Guiyang/497/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002078/2154 (96%)
text_code_colored.pngEPI113090A/duck/Guangxi/804/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002062/2131 (96%)
text_code_colored.pngEPI113088A/duck/Guangxi/744/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002064/2133 (96%)
text_code_colored.pngEPI113086A/duck/Guangxi/619/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002062/2131 (96%)
text_code_colored.pngEPI113084A/goose/Guangxi/582/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002062/2131 (96%)
text_code_colored.pngEPI113082A/duck/Guangxi/392/2006 (A/H5N1) segment 3 (PA)3552.20.000000e+002062/2131 (96%)
text_code_colored.pngEPI681248A/pigeon/Zhejiang/112090/2014 (A/H5N1) segment 3 (PA)3546.70.000000e+002075/2152 (96%)
text_code_colored.pngEPI681243A/duck/Zhejiang/1220092/2014 (A/H5N1) segment 3 (PA)3546.70.000000e+002075/2152 (96%)
text_code_colored.pngEPI642418A/chicken/India/03CA03/2012 (A/H5N1) segment 3 (PA)3546.70.000000e+002077/2154 (96%)
text_code_colored.pngEPI585434A/crow/India/11CL01/2011 (A/H5N1) segment 3 (PA)3546.70.000000e+002077/2154 (96%)
text_code_colored.pngEPI557758A/duck/Vietnam/NCVD-KA415/2012 (A/H5N2) segment 3 (PA)3546.70.000000e+002075/2152 (96%)
text_code_colored.pngEPI557751A/chicken/Vietnam/NCVD-KA435/2013 (A/H5N1) segment 3 (PA)3546.70.000000e+002075/2152 (96%)
text_code_colored.pngEPI557738A/duck/Vietnam/NCVD-KA30/2012 (A/H5N1) segment 3 (PA)3546.70.000000e+002075/2152 (96%)
text_code_colored.pngEPI510477A/environment/Bangladesh/15145/2012 (A/H5N1) segment 3 (PA)3546.70.000000e+002078/2155 (96%)
text_code_colored.pngEPI510476A/environment/Bangladesh/15165/2012 (A/H5N1) segment 3 (PA)3546.70.000000e+002078/2155 (96%)
text_code_colored.pngEPI510475A/environment/Bangladesh/15121/2012 (A/H5N1) segment 3 (PA)3546.70.000000e+002078/2155 (96%)
text_code_colored.pngEPI510471A/environment/Bangladesh/15105/2012 (A/H5N1) segment 3 (PA)3546.70.000000e+002078/2155 (96%)
text_code_colored.pngEPI510463A/chicken/Bangladesh/15078/2012 (A/H5N1) segment 3 (PA)3546.70.000000e+002077/2154 (96%)
text_code_colored.pngEPI510399A/environment/Bangladesh/15147/2012 (A/H5N1) segment 3 (PA)3546.70.000000e+002078/2155 (96%)
text_code_colored.pngEPI510316A/environment/Bangladesh/15114/2012 (A/H5N1) segment 3 (PA)3546.70.000000e+002078/2155 (96%)
text_code_colored.pngEPI510286A/environment/Bangladesh/15126/2012 (A/H5N1) segment 3 (PA)3546.70.000000e+002078/2155 (96%)
text_code_colored.pngEPI485580A/Cambodia/X0125302/2013 (A/H5N1) segment 3 (PA)3546.70.000000e+002075/2152 (96%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI680855A/chicken/Zhejiang/C71916/2013 (A/H9N2) segment 5 (NP)2712.00.000000e+001486/1495 (99%)
text_code_colored.pngEPI680839A/quail/Zhejiang/2A6/2013 (A/H9N2) segment 5 (NP)2712.00.000000e+001486/1495 (99%)
text_code_colored.pngEPI681127A/chicken/Zhejiang/925117/2014 (A/H9N2) segment 5 (NP)2706.50.000000e+001485/1495 (99%)
text_code_colored.pngEPI680862A/chicken/Zhejiang/C19/2013 (A/H9N2) segment 5 (NP)2706.50.000000e+001485/1495 (99%)
text_code_colored.pngEPI680858A/chicken/Zhejiang/C1/2013 (A/H9N2) segment 5 (NP)2706.50.000000e+001485/1495 (99%)
text_code_colored.pngEPI680853A/chicken/Zhejiang/C7199/2013 (A/H9N2) segment 5 (NP)2706.50.000000e+001485/1495 (99%)
text_code_colored.pngEPI641401A/Yunnan/0127/2015 (A/H5N6) segment 5 (NP)2706.50.000000e+001485/1495 (99%)
text_code_colored.pngEPI582355A/chicken/Huzhou/3791/2013 (A/H7N9) segment 5 (NP)2702.80.000000e+001485/1496 (99%)
text_code_colored.pngEPI683071A/chicken/Taizhou/TZJF02/2015 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI681129A/chicken/Zhejiang/925134/2014 (A/H9N2) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI680854A/chicken/Zhejiang/C71914/2013 (A/H9N2) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI680852A/chicken/Zhejiang/C7195/2013 (A/H9N2) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI680851A/chicken/Zhejiang/C4910/2013 (A/H9N2) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI680850A/chicken/Zhejiang/C496/2013 (A/H9N2) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI680848A/chicken/Zhejiang/C489/2013 (A/H9N2) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638105A/Anhui/1-YK_RG202/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638098A/Anhui/1-YK_RG201/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638091A/Anhui/1-YK_RG200/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638084A/Anhui/1-YK_RG199/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638077A/Anhui/1-YK_RG198/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638070A/Anhui/1-YK_RG197/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638063A/Anhui/1-YK_RG196/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638056A/Anhui/1-YK_RG195/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638049A/Anhui/1-YK_RG194/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638042A/Anhui/1-YK_RG193/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638035A/Anhui/1-YK_RG192/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638028A/Anhui/1-YK_RG191/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638021A/Anhui/1-YK_RG190/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638014A/Anhui/1-YK_RG189/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638007A/Anhui/1-YK_RG188/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI638000A/Anhui/1-YK_RG187/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637993A/Anhui/1-YK_RG186/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637986A/Anhui/1-YK_RG185/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637979A/Anhui/1-YK_RG184/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637972A/Anhui/1-YK_RG183/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637965A/Anhui/1-YK_RG182/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637958A/Anhui/1-YK_RG181/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637951A/Anhui/1-YK_RG180/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637944A/Anhui/1-YK_RG179/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637937A/Anhui/1-YK_RG178/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637930A/Anhui/1-YK_RG177/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637923A/Anhui/1-YK_RG176/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637916A/Anhui/1-YK_RG174/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637909A/Anhui/1-YK_RG173/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637902A/Anhui/1-YK_RG172/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637895A/Anhui/1-YK_RG171/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637888A/Anhui/1-YK_RG170/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637881A/Anhui/1-YK_RG169/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637874A/Anhui/1-YK_RG168/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637867A/Anhui/1-YK_RG167/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637860A/Anhui/1-YK_RG166/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637832A/Anhui/1-YK_RG162/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637825A/Anhui/1-YK_RG161/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637818A/Anhui/1-YK_RG160/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637811A/Anhui/1-YK_RG159/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637804A/Anhui/1-YK_RG158/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637797A/Anhui/1-YK_RG157/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637776A/Anhui/1-YK_RG154/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637769A/Anhui/1-YK_RG153/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637762A/Anhui/1-YK_RG152/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637755A/Anhui/1-YK_RG151/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637748A/Anhui/1-YK_RG150/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637741A/Anhui/1-YK_RG149/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637734A/Anhui/1-YK_RG148/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637727A/Anhui/1-YK_RG147/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637720A/Anhui/1-YK_RG146/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637713A/Anhui/1-YK_RG145/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637706A/Anhui/1-YK_RG144/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637699A/Anhui/1-YK_RG143/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637692A/Anhui/1-YK_RG142/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637685A/Anhui/1-YK_RG141/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637484A/Anhui/1-YK_RG113/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637477A/Anhui/1-YK_RG112/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637470A/Anhui/1-YK_RG111/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637463A/Anhui/1-YK_RG110/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637456A/Anhui/1-YK_RG109/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637449A/Anhui/1-YK_RG108/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637421A/Anhui/1-YK_RG104/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637414A/Anhui/1-YK_RG103/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637407A/Anhui/1-YK_RG102/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637400A/Anhui/1-YK_RG101/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637393A/Anhui/1-YK_RG100/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637386A/Anhui/1-YK_RG99/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637379A/Anhui/1-YK_RG98/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637372A/Anhui/1-YK_RG97/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637365A/Anhui/1-YK_RG96/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637358A/Anhui/1-YK_RG95/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637350A/Anhui/1-YK_RG94/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637343A/Anhui/1-YK_RG93/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637336A/Anhui/1-YK_RG92/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637329A/Anhui/1-YK_RG91/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637322A/Anhui/1-YK_RG90/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637315A/Anhui/1-YK_RG89/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637293A/Anhui/1-YK_RG86/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637286A/Anhui/1-YK_RG85/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637278A/Anhui/1-YK_RG84/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637271A/Anhui/1-YK_RG83/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637180A/Anhui/1-YK_RG72/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637172A/Anhui/1-YK_RG71/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637157A/Anhui/1-YK_RG69/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637150A/Anhui/1-YK_RG68/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637143A/Anhui/1-YK_RG67/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637115A/Anhui/1-YK_RG63/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637108A/Anhui/1-YK_RG62/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637101A/Anhui/1-YK_RG61/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637087A/Anhui/1-YK_RG59/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637080A/Anhui/1-YK_RG58/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637073A/Anhui/1-YK_RG57/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637066A/Anhui/1-YK_RG56/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637059A/Anhui/1-YK_RG55/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637052A/Anhui/1-YK_RG54/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637045A/Anhui/1-YK_RG53/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637038A/Anhui/1-YK_RG52/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637031A/Anhui/1-YK_RG51/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637024A/Anhui/1-YK_RG50/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637017A/Anhui/1-YK_RG49/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637010A/Anhui/1-YK_RG48/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI637003A/Anhui/1-YK_RG47/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636996A/Anhui/1-YK_RG46/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636989A/Anhui/1-YK_RG45/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636982A/Anhui/1-YK_RG44/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636975A/Anhui/1-YK_RG43/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636968A/Anhui/1-YK_RG42/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636961A/Anhui/1-YK_RG41/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636954A/Anhui/1-YK_RG40/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636947A/Anhui/1-YK_RG39/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636940A/Anhui/1-YK_RG38/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636933A/Anhui/1-YK_RG37/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636925A/Anhui/1-YK_RG36/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636917A/Anhui/1-YK_RG35/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636910A/Anhui/1-YK_RG34/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636903A/Anhui/1-YK_RG33/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636896A/Anhui/1-YK_RG32/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636887A/Anhui/1-YK_RG31/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636880A/Anhui/1-YK_RG30/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636873A/Anhui/1-YK_RG29/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636866A/Anhui/1-YK_RG28/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636859A/Anhui/1-YK_RG27/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636852A/Anhui/1-YK_RG26/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636843A/Anhui/1-YK_RG25/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636836A/Anhui/1-YK_RG24/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636829A/Anhui/1-YK_RG23/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636822A/Anhui/1-YK_RG22/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636815A/Anhui/1-YK_RG21/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636808A/Anhui/1-YK_RG20/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636797A/Anhui/1-YK_RG19/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636790A/Anhui/1-YK_RG18/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636783A/Anhui/1-YK_RG17/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636776A/Anhui/1-YK_RG16/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636769A/Anhui/1-YK_RG15/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636762A/Anhui/1-YK_RG14/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636755A/Anhui/1-YK_RG13/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636748A/Anhui/1-YK_RG12/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636741A/Anhui/1-YK_RG10/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636733A/Anhui/1-YK_RG09/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636725A/Anhui/1-YK_RG08/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636718A/Anhui/1-YK_RG07/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636711A/Anhui/1-YK_RG06/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636704A/Anhui/1-YK_RG05/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636697A/Anhui/1-YK_RG04/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636690A/Anhui/1-YK_RG03/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636683A/Anhui/1-YK_RG02/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI636676A/Anhui/1-YK_RG01/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620202A/Anhui/1-BALF_RG6/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620195A/Anhui/1-JCVI1_RG3/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620188A/Anhui/1-JCVI1_RG2/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620181A/Anhui/1-JCVI1_RG1/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620177A/Anhui/1-BALF_RG17/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620170A/Anhui/1-BALF_RG9/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620163A/Anhui/1-BALF_RG8/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620156A/Anhui/1-BALF_RG7/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620145A/Anhui/1-BALF_RG20/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620138A/Anhui/1-BALF_RG19/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620131A/Anhui/1-BALF_RG18/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620121A/Anhui/1-BALF_RG32/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620114A/Anhui/1-BALF_RG31/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620107A/Anhui/1-BALF_RG29/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620100A/Anhui/1-BALF_RG21/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620095A/Anhui/1-BALF_RG44/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620088A/Anhui/1-BALF_RG43/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620081A/Anhui/1-BALF_RG42/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620074A/Anhui/1-BALF_RG41/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620067A/Anhui/1-BALF_RG40/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620063A/Anhui/1-BALF_RG2/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620056A/Anhui/1-BALF_RG1/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620049A/Anhui/1-BALF_RG45/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620042A/Anhui/1-BALF_RG5/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620035A/Anhui/1-BALF_RG4/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI620028A/Anhui/1-BALF_RG3/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI619987A/Anhui/1-BALF_RG33/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI613838A/Anhui/DEWH72-05/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI613831A/Anhui/DEWH72-04/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI613824A/Anhui/DEWH72-03/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI613817A/Anhui/DEWH72-02/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI613810A/Anhui/DEWH72-01/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI613793A/Anhui/DEWH72-09/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI613786A/Anhui/DEWH72-08/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI613779A/Anhui/DEWH72-07/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI583022A/chicken/Huzhou/4169/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI583008A/chicken/Huzhou/4083/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI582992A/chicken/Huzhou/4079/2013 (A/H0) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI582984A/chicken/Huzhou/4076/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI582967A/chicken/Huzhou/4074/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI582953A/chicken/Huzhou/4069/2013 (A/H0) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI582945A/chicken/Huzhou/4067/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI582930A/chicken/Huzhou/4034/2013 (A/H0) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI582921A/chicken/Huzhou/3977/2013 (A/H0) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI582906A/chicken/Huzhou/3802/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI582348A/chicken/Huzhou/3765/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI576577A/chicken/Guangdong/3640/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)
text_code_colored.pngEPI568649A/Shanghai/02/2013 (A/H7N9) segment 5 (NP)2700.90.000000e+001484/1495 (99%)