High Path H7N8 In Dubois County Indiana Turkey Farm

niman · January 15, 2016

USDA has reported high path H7N8 in turkey farm in Dubois Co Indiana.

https://www.aphis.usda.gov/wps/portal/aphis/newsroom/news/sa_news/sa_by_date/newsroom-2016/newsroom-january-2016/ct-hpai-indiana-turkeys/!ut/p/a0/04_Sj9CPykssy0xPLMnMz0vMAfGjzOK9_D2MDJ0MjDzdXUyMDTzdPA2cAtz8jT1dTPULsh0VAbiDHEw!/

Edited January 16, 2016 by niman

niman · January 15, 2016

USDA Confirms Highly Pathogenic H7N8 Avian Influenza in a Commercial Turkey Flock in Dubois County, Indiana

Last Modified: Jan 15, 2016

Print

Contacts:
Andrea McNally (202)799-7033
[email protected]
Lyndsay Cole (970)494-7410
[email protected]

WASHINGTON, January 15, 2016 -- The United States Department of Agriculture’s (USDA) Animal and Plant Health Inspection Service (APHIS) has confirmed the presence of highly pathogenic H7N8 avian influenza (HPAI) in a commercial turkey flock in Dubois County, Indiana. This is a different strain of HPAI than the strains that caused the 2015 outbreak. There are no known cases of H7N8 infections in humans. As a reminder, the proper handling and cooking of poultry and eggs to an internal temperature of 165 ˚F kills bacteria and viruses, including HPAI.

Samples from the turkey flock, which experienced increased mortality, were tested at the Indiana Animal Disease Diagnostic Laboratory at Purdue University, which is a part of USDA’s National Animal Health Laboratory Network, and confirmed by USDA this morning. APHIS is working closely with the Indiana State Board of Animal Health on a joint incident response. State officials quarantined the affected premises and depopulation of birds on the premises has already begun. Depopulation prevents the spread of the disease. Birds from the flock will not enter the food system.

As part of existing avian influenza response plans, Federal and State partners are working jointly on additional surveillance and testing in the nearby area. The rapid testing and response in this incident is the result of months of planning with local, state, federal and industry partners to ensure the most efficient and effective coordination. Since the previous HPAI detections in 2015, APHIS and its state and industry partners have learned valuable lessons to help implement stronger preparedness and response capabilities. In September, APHIS published a HPAI Fall Preparedness and Response Plan that captures the results of this planning effort, organizing information on preparatory activities, policy decisions and updated strategy documents.
The United States has the strongest AI surveillance program in the world, and USDA is working with its partners to actively look for the disease in commercial poultry operations, live bird markets and in migratory wild bird populations.

Anyone involved with poultry production, from the small backyard to the large commercial producer, should review their biosecurity activities to assure the health of their birds. To facilitate such a review, a biosecurity self-assessment and educational materials can be found at http://www.uspoultry.org/animal_husbandry/intro.cfm

In addition to practicing good biosecurity, all bird owners should prevent contact between their birds and wild birds and report sick birds or unusual bird deaths to State/Federal officials, either through their state veterinarian or through USDA’s toll-free number at 1-866-536-7593. Additional information on biosecurity for backyard flocks can be found at http://healthybirds.aphis.usda.gov.

Additional background
Avian influenza (AI) is caused by an influenza type A virus which can infect poultry (such as chickens, turkeys, pheasants, quail, domestic ducks, geese and guinea fowl) and is carried by free flying waterfowl such as ducks, geese and shorebirds. AI viruses are classified by a combination of two groups of proteins: hemagglutinin or “H” proteins, of which there are 16 (H1–H16), and neuraminidase or “N” proteins, of which there are 9 (N1–N9). Many different combinations of “H” and “N” proteins are possible. Each combination is considered a different subtype, and can be further broken down into different strains. AI viruses are further classified by their pathogenicity (low or high)— the ability of a particular virus strain to produce disease in domestic chickens.

#

USDA is an equal opportunity provider and employer. To file a complaint of discrimination, write: USDA, Office of the Assistant Secretary for Civil Rights, Office of Adjudication, 1400 Independence Ave., SW, Washington, DC 20250-9410 or call (866) 632-9992 (Toll-free Customer Service), (800) 877-8339 (Local or Federal relay), (866) 377-8642 (Relay voice users).

https://www.aphis.usda.gov/wps/portal/aphis/newsroom/news/sa_news/sa_by_date/newsroom-2016/newsroom-january-2016/ct-hpai-indiana-turkeys/!ut/p/a0/04_Sj9CPykssy0xPLMnMz0vMAfGjzOK9_D2MDJ0MjDzdXUyMDTzdPA2cAtz8jT1dTPULsh0VAbiDHEw!/

niman · January 15, 2016

USDA reports first bird flu case since June, different strain than last year

Katie Little | Jacob Pramuk

22 Mins AgoBreaking News

3

COMMENTSJoin the Discussion

Bird flu has infected a commercial turkey flock in Indiana, though the strain is different from the one that caused an outbreak last year, the U.S. Department of Agriculture reported Friday.

This marks the first highly pathogenic avian influenza (HPAI) case since June. In the past year, the U.S. poultry industry has been hit hard by avian flu. Before this latest sighting, HPAI had affected 211 commercial and 21 backyard poultry premises since December 2014.

In bird flu's worst outbreak in decades, infected flocks have prompted the depopulation of 7.5 million turkeys and 42.1 million chickens. The cost to federal taxpayers has already hit more than $950 million.

Jim Watson | AFP | Getty Images

A bird flu outbreak affecting turkeys has been reported in Indiana on Jan. 15th, 2016.

To help contain bird flu, the USDA has been planning for a worst-case scenario in which 500 or more commercial flocks across a wide swath of the U.S. could be affected.

Its plan includes promoting improved biosecurity practices on farms, improving surveillance of wild birds (which have spread the virus in the past) and promoting rapid detection of the illness in domestic poultry before depopulating affected flocks within 24 hours.

This story is developing. Please check back for further updates.

Click here for the latest on the markets.

— Reuters contributed to this report.

http://www.cnbc.com/2016/01/15/usda-reports-first-bird-flu-case-since-june-different-strain-than-last-year.html

niman · January 15, 2016

LOCUS       KR821169                1723 bp    cRNA    linear   VRL 17-JUN-2015
DEFINITION  Influenza A virus (A/chicken/Guanajuato/07437-15/2015(H7N3))
            segment 4 hemagglutinin (HA) gene, complete cds.
ACCESSION   KR821169
VERSION     KR821169.1  GI:831182854
KEYWORDS    .
SOURCE      Influenza A virus (A/chicken/Guanajuato/07437-15/2015(H7N3))
  ORGANISM  Influenza A virus (A/chicken/Guanajuato/07437-15/2015(H7N3))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1723)
  AUTHORS   Delgadillo-Alvarez,J.B.
  TITLE     Sequence analysis of H7N3 avian influenza viruses isolated from
            poultry in Mexico
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1723)
  AUTHORS   Delgadillo-Alvarez,J.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2015) DGSA, Servicio Nacional de Sanidad,
            Inocuidad y Calidad Agroalimentaria (SENASICA), Av. Cuauhtemoc No.
            1230 Piso 9 Colonia Santa Cruz Atoyac, Mexico, Distrito Federal
            03310, Mexico
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: newbler v. 3.0
            Assembly Name         :: GS Reference Mapper
            Sequencing Technology :: 454
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1723
                     /organism="Influenza A virus
                     (A/chicken/Guanajuato/07437-15/2015(H7N3))"
                     /mol_type="viral cRNA"
                     /strain="A/chicken/Guanajuato/07437-15/2015"
                     /serotype="H7N3"
                     /host="chicken"
                     /db_xref="taxon:1657908"
                     /segment="4"
                     /country="Mexico"
                     /collection_date="11-Mar-2015"
     gene            10..1716
                     /gene="HA"
     CDS             10..1716
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="AKL91078.1"
                     /db_xref="GI:831182855"
                     /translation="MNTQILALIAYMLIGAKGDKICLGHHAVANGTKVNTLTERGIEV
                     VNATETVETANTKKICTQGKRPIDLRQCGLLGTLIGPPQCDQFLKFDADLIIERREGT
                     DVCYPGKFTNEESLRQILRRSGGIDKESMDFTYNGIRTNGTTSACKRSNPSFYAEMKW
                     LLSDSDNATFPQMTMSYRNPRNKSALIIWGVHHSGSATEQTKLYGSGDKFITVGSSKY
                     LQSFTPSPGPRPKVNGQSGRIDFHWLLLDPNDTVTFTFNGAFIAPDRASFFRGESIGI
                     QSDVPLDPGCKGDCFHNGGTIVSSLPFQNINPRTVGKCPRYVKQPSLLLATGMRNVPE
                     NPKDRKSRHRRTRGLFGAIAGFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAI
                     NQITGKLNRLIDKTNQQFELIDNEFSEIEQQIGNVINWTRDSMTEVWSYNAELLIAME
                     NQHTIDLADSEMNKLYERVRKQLRENAEEDGTGCFEMFHKCDDQCMESIRNNTYDHTQ
                     YRAESLQNRIQIDPVKLSSGYKDIILWFSFGASCFLLLAIAMGLVFICIKNGNMRCTI
                     CI"
     mat_peptide     64..1050
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1051..1713
                     /gene="HA"
                     /product="HA2"
ORIGIN      
        1 ggatacaaaa tgaacactca aattttggca ctcattgctt atatgctaat tggagctaaa
       61 ggagacaaaa tatgtcttgg gcaccatgct gtggcaaatg gaacaaaagt gaacacatta
      121 acagagaggg gaatcgaagt agtaaatgcc acagaaacgg tggagactgc aaatactaag
      181 aaaatatgca ctcaggggaa aagaccaata gatctaagac aatgcggact tctaggaacc
      241 ctaataggac ctccccaatg cgatcaattt ctgaaatttg acgctgattt aataattgaa
      301 cgaagagaag gaaccgatgt gtgttatccc gggaagttca caaatgaaga atcactgagg
      361 caaatacttc gaagatcagg aggaattgat aaagagtcga tggatttcac ctataatgga
      421 ataagaacca atgggacgac aagtgcttgc aaaagatcca atccttcctt ctatgcggag
      481 atgaagtggt tactgtcgga ttctgacaat gcaactttcc ctcaaatgac tatgtcgtac
      541 agaaatccca ggaacaaatc agctctgata atttggggag tgcatcattc tggatcggct
      601 actgagcaga ccaaactcta tgggagtgga gacaagttca taacagtagg aagctcgaaa
      661 tacctgcagt cattcacccc aagcccgggg ccacgaccaa aggtgaatgg gcaatcagga
      721 aggatcgact ttcactggct actccttgat cccaatgaca cagtgacctt cactttcaat
      781 ggggcattca tagctcctga cagagcaagc ttctttagag gagagtcaat aggaattcag
      841 agtgatgttc ctttggatcc tggttgtaag ggggattgct tccacaatgg gggtacgata
      901 gtgagttctc tgccattcca gaacatcaac cctagaacag tgggaaaatg ccctcggtat
      961 gtcaaacagc caagcctcct tttggctaca gggatgagaa atgtcccaga gaaccccaag
     1021 gataggaaga gccgacatcg aaggaccaga ggcctttttg gagcgattgc tgggttcata
     1081 gagaatggat gggaaggtct cattgatgga tggtatggtt tcagacatca aaatgcacaa
     1141 ggagaaggaa ctgcagctga ttacaaaagc actcaatctg cgataaatca aatcacaggc
     1201 aaattgaatc gtctaattga caaaacaaat cagcagtttg aactgataga caacgaattc
     1261 agtgaaatag aacaacagat tgggaatgtc attaactgga cacgcgattc aatgactgag
     1321 gtatggtcgt acaatgctga attgctgata gctatggaaa atcagcacac aatagatctt
     1381 gcagactcag aaatgaacaa actttatgag cgtgtaagga aacaacttag ggagaatgct
     1441 gaagaggatg ggactggatg ctttgaaatg tttcataagt gtgatgatca gtgcatggag
     1501 agcatcagga acaacactta tgaccatact caatacagag cggaatcatt gcagaatagg
     1561 atacagatag atccagtgaa attgagtagt ggatacaaag acataatctt atggtttagc
     1621 ttcggggcat catgttttct tcttctagcc attgcaatgg gattggtttt catttgcata
     1681 aagaatggaa acatgcggtg cactatttgt atatagtttg aga

niman · January 15, 2016

Immediate notification report Report reference: REF OIE 17686,

Report Date: 08/05/2015, Country : Mexico

Report Summary

Name of sender of the report Dr Joaquín Braulio Delgadillo Álvarez Telephone +52 55 59 05 10 00

Position Director General de Salud Animal Fax Address Avenida Cuauhtémoc N° 1230 - Piso 9 Colonia Santa Cruz Atoyac Delegación Benito Juárez CP 03310 México DF Mexico Email [email protected]

Date submitted to OIE 08/05/2015

Animal type Terrestrial Date of report 08/05/2015

Disease Highly pathogenic avian influenza

Date of start of the event 28/04/2015 Causal Agent Highly pathogenic avian influenza virus

Date of confirmation of the event 07/05/2015 Serotype(s) H7N3

Diagnosis Clinical, Laboratory (basic)

Reason First occurrence of a listed disease Clinical signs Yes Country or zone a zone or compartment Number of reported outbreaks submitted= 1, Draft= 0 Outbreak details Estado Number of outbreaks Municipio Localidad Unit Type Location Latitude Longitude Start Date End Date: CHIAPAS- (this report - submitted) - Not applicable Tuxtla Gutierrez 16.724614 -93.094339 28/04/2015 Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered Plain chachalaca:Cracidae(Ortal is Vetula) Animals ... 6 6 0 0 Clay-colored thrush:Turdidae(Turdus grayi) Animals ... 2 2 0 0 Affected Population Outbreak summary: Total outbreaks = 1 (Submitted) Species Susceptible Cases Deaths Destroyed Slaughtered Plain chachalaca 6 6 0 0

Clay-colored thrush 2 2 0 0 Epidemiology Epidemiological comments Endemic wild birds were reported having been found dead in a nature reserve called “The Zapotal”; the reserve is in the State of Chiapas, consists of 100 hectares of semi-humid forest, with several species of sapotas, and shows a wide variety of native wildlife of this State. It has about 220 animal species in their natural environments and 154 species living freely in the reserve, of which 62 species of birds.

During the initial investigation, three highly pathogenic avian influenza virus of H7N3 subtype were isolated with an intravenous pathogenicity index of 2.91 and 2.99. A 10 km focal and perifocal zone was established and no evidence of infection was found in commercial poultry. Under the national epidemiological surveillance program, a state active epidemiological surveillance program is on-going for 100% of the commercial poultry and, through a statistical sample size, in backyard poultry, based on serological, virological and molecular testing; no evidence of infection was found in commercial poultry or in backyard poultry. The affected species are Ortalis vetula and Turdus grayi. The epidemiological investigation continues. Source of the outbreak(s) or origin of infection • Unknown or inconclusive Measures applied Applied To be applied • control of wildlife reservoirs • movement control inside the country • screening • zoning • disinfection of infected premises/establishment(s) • no planned control measures

Printed on: Tue May 12 12:23:47 CEST 2015 Page 1/3 No Yes Animals treated Vaccination Prohibited No Yes Diagnostic test results Laboratory Type Name of Laboratory Species Test Type Date Results Provided Result National laboratory Level 3 Biosecurity Laboratory, SENASICA Clay-colored thrush intravenous pathogenicity index (IVPI) test 07/05/2015 Positive National laboratory Level 3 Biosecurity Laboratory, SENASICA Clay-colored thrush virus isolation 29/04/2015 Positive National laboratory Level 3 Biosecurity Laboratory, SENASICA Plain chachalaca intravenous pathogenicity index (IVPI) test 07/05/2015 Positive National laboratory Level 3 Biosecurity Laboratory, SENASICA Plain chachalaca virus isolation 29/04/2015 Positive Future Reporting The event is continuing. Weekly follow-up reports will be submitted

http://www.oie.int/wahis_2/public\..\temp\reports/en_imm_0000017686_20150512_122347.pdf

niman · January 15, 2016

Affected Counties 2016

County	Date Confirmed Positive	Number of Poultry	Type of Operation	Status
Dubois	Jan. 14, 2016	60,000	Commercial Turkey	Currently being depopulated

Current Statewide Situation
Total number of affected premises = 1
Total number of affected counties = 1

Premises by County/Number of flocks
Dubois : 1

Total number of birds affected in Indiana
Commercial Turkey: 60,000
_________________

http://www.in.gov/boah/2390.htm
Total: 60,000

niman · January 15, 2016

US | Fri Jan 15, 2016 11:48am EST

U.S. finds first case of deadly bird flu in poultry since June

CHICAGO | BY TOM POLANSEK

An Indiana turkey flock has been infected with a deadly type of bird flu in the first new case of the disease in U.S. poultry since June, the U.S. Department of Agriculture said on Friday.

The flock in Dubois County, Indiana, was infected with a strain known as H7N8, which is different from strains that caused more than 48 million chickens and turkeys to die last year, according to the USDA.

Indiana officials quarantined the farm with the infected turkeys and the birds are being killed to prevent the spread of the disease, the USDA said.

The outbreak will likely cause new restrictions on U.S. poultry exports.

Last year's outbreak cost exporters millions of dollars in lost business as trading partners limited deals from states and counties with infected flocks. Some countries, such as China, halted all imports of U.S. poultry.

The 2015 outbreak also sent U.S. egg prices to record highs and tightened supplies of turkey meat.

Birds from the Indiana turkey flock will not enter the food system, according to the USDA. There are no known cases of H7N8 infections in humans, the department said.

The Indiana Animal Disease Diagnostic Laboratory at Purdue University tested samples from flock, and the USDA confirmed the turkeys were infected with bird flu.

The virus is thought to be spread by wild ducks, which can carry the disease without becoming infected and transmit it to poultry through feces and feathers.

(Reporting by Tom Polansek; Editing by Franklin Paul and Alan Crosby)

http://www.reuters.com/article/us-health-birdflu-indiana-idUSKCN0UT1Y3

niman · January 15, 2016

Michael R. Pence, Governor Bret D. Marsh, DVM, State Veterinarian INDIANA STATE BOARD OF ANIMAL HEALTH

Office of the State Veterinarian Discovery Hall, Suite 100 1202 East 38th Street Indianapolis, IN 46205-2898 Phone: 317/544-2400

NOTE TO MEDIA: Direct all media inquiries, including interview requests, to the Indiana Joint Information Center (JIC) at: 317-238-1784 or email: [email protected]

General updates are available online at: www.in.gov/boah/2390.htm

FOR IMMEDIATE RELEASE Highly Pathogenic H7N8 Avian Influenza Diagnosed in Indiana Poultry Flock

INDIANAPOLIS ( 15 January 2016)—The Indiana State Board of Animal Health (BOAH) has been notified by the U.S. Department of Agriculture’s National Veterinary Services Laboratory that poultry from a commercial turkey farm in Dubois County has tested positive for highly pathogenic H7N8 avian influenza. Avian influenza does not present a food safety risk; poultry and eggs are safe to eat. The Centers for Disease Control considers the risk of illness to humans to be very low. A company veterinarian delivered samples from the flock to the laboratory for testing, after several hundred birds died.

“This finding of highly pathogenic H7N8 is unique to Indiana and the nation,” said Indiana State Veterinarian Bret D. Marsh, DVM. “This strain is unrelated to those identified in the Upper Midwest in 2015, nor is it related to the HPAI case identified in a Northeastern Indiana backyard poultry flock that was affected last May.” Indiana Governor Mike Pence stated, “Indiana is one of the largest poultry states in America, and I have directed all relevant agencies to bring the full resources of the state of Indiana to bear on containing and resolving the issue as quickly as possible. Multiple state agencies have been heavily focused for nearly a year on the necessary steps in this type of event, including the State Board of Animal Health, Indiana State Department of Agriculture, Indiana Department of Homeland Security, Indiana Animal Disease Diagnostic Laboratory, Indiana Department of Environmental Management, Indiana State Poultry Association, and several private sector partners. Hoosiers can be assured that we are taking all precautions to contain the situation and minimize the effects to Indiana’s robust poultry industry.” Indiana’s poultry industry ranks fourth nationally in turkey production, first in duck production, third in eggs, and is a significant producer of broiler chickens. The poultry industry employs more than 14,000 Hoosiers and is valued at $2.5 billion.

REPORTING Backyard poultry owners are encouraged to be aware of the signs of avian influenza and report illness and/or death to the USDA Healthy Birds Hotline: 866-536-7593. Callers will be routed to a state or federal veterinarian in Indiana for a case assessment. Dead birds should be double-bagged and refrigerated for possible testing. Signs include: sudden death without clinical signs; lack of energy or appetite; decreased egg production; softshelled or misshapen eggs; swelling or purple discoloration of head, eyelids, comb, hocks; nasal discharge; coughing; sneezing; incoordination; and diarrhea. A great resource for backyard bird health information is online at: www.healthybirds.aphis.usda.gov

UPDATES and INFORMATION: Situation updates and status reports about ongoing avian influenza activities, along with critical disease-related information, will be posted online at: www.in.gov/boah/2390.htm . Users may subscribe to email updates on a link at that page. ### BACKGROUND: This marks the first case of HPAI in Indiana in 2016. While the disease was found on 219 sites in 16 states in the United States last year, Indiana had only one backyard flock of 76 birds affected in 2015. This event marks the first case in a commercial flock in Indiana.

http://www.in.gov/boah/files/HPAI_Dubois1_Conf_PR_1-15-16.pdf

niman · January 15, 2016

UPDATE: Highly pathogenic H7N8 bird flu diagnosed in Indiana turkey farm

Updated: Fri 1:33 PM, Jan 15, 2016

By: Associated Press, NewsCenter 16

Poultry from a commercial turkey farm in Dubois County has tested positive for highly pathogenic H7N8 avian influenza.

INDIANAPOLIS From the Indiana State Board of Animal Health:

The Indiana State Board of Animal Health (BOAH) has been notified by the U.S. Department of Agriculture’s National Veterinary Services Laboratory that poultry from a commercial turkey farm in Dubois County has tested positive for highly pathogenic H7N8 avian influenza.

Avian influenza does not present a food safety risk; poultry and eggs are safe to eat. The Centers for Disease Control considers the risk of illness to humans to be very low.

A company veterinarian delivered samples from the flock to the laboratory for testing, after several hundred birds died.

“This finding of highly pathogenic H7N8 is unique to Indiana and the nation,” said Indiana State Veterinarian Bret D. Marsh, DVM. “This strain is unrelated to those identified in the Upper Midwest in 2015, nor is it related to the HPAI case identified in a Northeastern Indiana backyard poultry flock that was affected last May.”

Indiana Governor Mike Pence stated, “Indiana is one of the largest poultry states in America, and I have directed all relevant agencies to bring the full resources of the state of Indiana to bear on containing and resolving the issue as quickly as possible. Multiple state agencies have been heavily focused for nearly a year on the necessary steps in this type of event, including the State Board of Animal Health, Indiana State Department of Agriculture, Indiana Department of Homeland Security, Indiana Animal Disease Diagnostic Laboratory, Indiana Department of Environmental Management, Indiana State Poultry Association, and several private sector partners. Hoosiers can be assured that we are taking all precautions to contain the situation and minimize the effects to Indiana’s robust poultry industry.”

Indiana’s poultry industry ranks fourth nationally in turkey production, first in duck production, third in eggs, and is a significant producer of broiler chickens. The poultry industry employs more than 14,000 Hoosiers and is valued at $2.5 billion.

REPORTING
Backyard poultry owners are encouraged to be aware of the signs of avian influenza and report illness and/or death to the USDA Healthy Birds Hotline: 866-536-7593. Callers will be routed to a state or federal veterinarian in Indiana for a case assessment. Dead birds should be double-bagged and refrigerated for possible testing.

Signs include: sudden death without clinical signs; lack of energy or appetite; decreased egg production; soft-shelled or misshapen eggs; swelling or purple discoloration of head, eyelids, comb, hocks; nasal discharge; coughing; sneezing; incoordination; and diarrhea. A great resource for backyard bird health information is online at: www.healthybirds.aphis.usda.gov

Bird flu at Indiana turkey farm not same as 2015 strain
INDIANAPOLIS (AP)

Federal officials say a bird flu virus that is different from the one that ravaged turkey and chicken farms last summer has been found in Indiana.

The U.S. Department of Agriculture said Friday the H7N8 flu strain had been confirmed at a commercial turkey farm in the southwestern Indiana county of Dubois. The strain is highly contagious for birds, not humans.

Last year's H5N2 virus outbreak began spreading widely in the spring, not winter, and led to the deaths of 48 million birds.

Indiana Board of Animal Health spokeswoman Denise Derrer says the farm has about 60,000 turkeys and the flock is being euthanized to prevent the disease from spreading.

She said a quarantine is in place for commercial poultry farms and backyard flocks within a nearly 6-mile radius.

Governor Pence Statement on Case of Avian Influenza in Southwestern Indiana

Indianapolis – On Friday, Governor Mike Pence issued the following statement on Indiana’s confirmed case of high pathogenic avian influenza (H7N8) in a commercial turkey flock in southwestern Indiana.

“Indiana is one of the largest poultry states in America, and I have directed all relevant agencies to bring the full resources of the state of Indiana to bear on containing and resolving the issue as quickly as possible. Multiple state agencies have been heavily focused for nearly a year on the necessary steps in this type of event, including the State Board of Animal Health, Indiana State Department of Agriculture, Indiana Department of Homeland Security, Indiana Animal Disease Diagnostic Laboratory, Indiana Department of Environmental Management, Indiana State Poultry Association, and several private sector partners. Hoosiers can be assured that we are taking all precautions to contain the situation and minimize the effects to Indiana’s robust poultry industry.

http://www.wndu.com/home/headlines/Bird-flu-at-Indiana-turkey-farm-not-same-as-2015-strain-365442931.html

niman · January 15, 2016

Partial sequences of H7 and N8 are North American (unrelated to N8 in Fujian clade 2.3.4.4 H5N8).

Most recent public H7N8 low path wild bird sequences are from Ohio in 2011.

More recent surveillance has identified H7N8 in wild birds in Kentucky & California.

Full set of sequences expected next week.

65 Commercial farms on 10 km radius

1000 potential backyard farms in 10 km radius

niman · January 15, 2016

LOCUS       CY132501                1706 bp    cRNA    linear   VRL 17-JAN-2013
DEFINITION  Influenza A virus (A/mallard/Ohio/11OS2033/2011(H7N8))
            hemagglutinin (HA) gene, complete cds.
ACCESSION   CY132501
VERSION     CY132501.1  GI:442775029
KEYWORDS    .
SOURCE      Influenza A virus (A/mallard/Ohio/11OS2033/2011(H7N8))
  ORGANISM  Influenza A virus (A/mallard/Ohio/11OS2033/2011(H7N8))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1706)
  AUTHORS   Wentworth,D.E., Dugan,V., Halpin,R., Lin,X., Bera,J., Wester,E.,
            Ghedin,E., Fedorova,N., Tsitrin,T., Stockwell,T., Amedeo,P.,
            Bishop,B., Edworthy,P., Gupta,N., Katzel,D., Li,K., Schobel,S.,
            Shrivastava,S., Thovarai,V., Wang,S., Slemons,R., Nolting,J.,
            Bao,Y., Sanders,R., Dernovoy,D., Kiryutin,B., Lipman,D.J. and
            Tatusova,T.
  TITLE     The NIAID Influenza Genome Sequencing Project
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1706)
  CONSRTM   The NIAID Influenza Genome Sequencing Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JAN-2013) on behalf of JCVI/Ohio State
            University/NCBI, National Center for Biotechnology Information,
            NIH, Bethesda, MD 20894, USA
COMMENT     This work was supported by the National Institute of Allergy and
            Infectious Diseases (NIAID), Genome Sequencing Centers for
            Infectious Diseases (GSCID) program.
FEATURES             Location/Qualifiers
     source          1..1706
                     /organism="Influenza A virus
                     (A/mallard/Ohio/11OS2033/2011(H7N8))"
                     /mol_type="viral cRNA"
                     /strain="A/mallard/Ohio/11OS2033/2011"
                     /serotype="H7N8"
                     /host="mallard; gender F; age hatch year"
                     /bio_material="CEIRS#11OS2033#"
                     /db_xref="taxon:1283055"
                     /segment="4"
                     /lab_host="E1 passage(s)"
                     /country="USA: Ohio"
                     /collection_date="17-Aug-2011"
     misc_feature    1..1706
                     /db_xref="IRD:NIGSP_CEIRS_UMN033_COH2_00206.HA"
     gene            10..1692
                     /gene="HA"
     CDS             10..1692
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="AGC73843.1"
                     /db_xref="GI:442775030"
                     /translation="MNTQILALIACMLIGAKGDKICLGHHAVANGTKVNTLTERGIEV
                     VNATETVETANIKKICTQGKRPTDLGQCGLLGTLIGPPQCDQFLEFDADLIIERREGT
                     DVCYPGKFTNEESLRQILRGSGGIDKESMGFTYSGIRTNGATSACRRSGSSFYAEMKW
                     LLSNSDNAAFPQMTKSYRNPRNKPALIIWGVHHSGSATEQTKLYGSGNKLITVGSSKY
                     QQSFTPSPGARPQVNGQSGRIDFHWLLLDPNDTVTFTFNGAFIAPDRASFFRGESLGV
                     QSDVPLDSGCEGDCFHSGGTIVSSLPFQNINPRTVGRCPRYVKQTSLLLATGMKNVPE
                     NPKTRGLFGAIAGFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLN
                     RLIDKTNQQFELIDNEFSEIEQQIGNVINWTRDSMTEVWSYNAELLVAMENQHTIDLA
                     DSEMNKLYERVRKQLRENAEEDGTGCFEIFHKCDDQCMESIRNNTYDHTQYRTESLQN
                     RIQIDPVKLSSGYKDIILWFSFGASCFLLLAIAMGLVFICIKNGNMRCTICI"
     sig_peptide     10..63
                     /gene="HA"
     mat_peptide     64..1026
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1027..1689
                     /gene="HA"
                     /product="HA2"
ORIGIN      
        1 ggatacaaaa tgaacactca aattttggca ctcattgctt gtatgctgat tggagctaaa
       61 ggagacaaaa tatgtcttgg gcaccatgct gtggcaaatg gaacaaaagt gaacacatta
      121 acagagagag gaattgaagt agtaaatgcc acagaaacgg tggaaactgc aaatattaag
      181 aaaatatgca ctcaagggaa aagaccaaca gacctggggc aatgcggact tctaggaacc
      241 ctaataggac ctccccaatg cgaccaattt ctggaatttg acgctgattt aataattgaa
      301 cgaagagaag gaaccgatgt gtgctacccc gggaagttca caaatgaaga atcactgagg
      361 caaatccttc gagggtcagg aggaattgat aaggagtcaa tgggtttcac ctatagtgga
      421 ataagaacca atggggcgac gagtgcttgc agaagatcag gttcttcctt ctatgcggag
      481 atgaagtggt tactgtcaaa ttcagacaat gcggcatttc cccaaatgac taagtcgtat
      541 agaaatccca ggaacaaacc agctctgata atttggggag tgcatcactc tggatcggct
      601 actgagcaga ccaaactcta tggaagtgga aacaagttga taacagtagg aagctcgaaa
      661 tatcagcagt cattcactcc aagcccagga gcacgaccac aggtgaatgg gcaatcagga
      721 aggattgatt ttcactggct actccttgat cccaatgaca cagtgacctt cactttcaat
      781 ggagcattca tagctcctga cagagcaagt ttctttaggg gagagtcact gggagtccaa
      841 agtgatgttc ctttggattc tggttgtgaa ggggattgct tccacagtgg gggtacgata
      901 gtgagttccc tgccgttcca gaacatcaac cctagaacag tagggagatg ccctcgatat
      961 gtcaaacaga caagcctcct tttggccaca gggatgaaaa acgttccgga gaaccccaag
     1021 accagaggcc tttttggagc aattgctgga ttcatagaga atggatggga aggtctcatt
     1081 gatggatggt atggtttcag acatcaaaat gcacaagggg aaggaactgc agctgactac
     1141 aaaagcactc aatctgcaat agatcagatc acaggcaaat tgaatcgtct aattgacaag
     1201 acaaatcagc agtttgaact gatagacaat gaattcagtg aaatagaaca acaaattggg
     1261 aatgtcatta actggacacg agactcaatg actgaggtat ggtcgtacaa tgctgaattg
     1321 ctggtagcaa tggaaaatca gcacacaata gatcttgcag actcagaaat gaacaaactt
     1381 tacgagcgtg tgaggaaaca actgagggag aatgctgaag aggatgggac tggatgcttt
     1441 gagatatttc ataagtgtga tgatcagtgc atggagagca taaggaacaa cacttatgac
     1501 cacacccaat acagaacaga gtcactgcag aatagaatac agatagaccc agtgaaattg
     1561 agtagtggat acaaggacat aatcttatgg tttagcttcg gggcatcatg ttttcttctt
     1621 ctagccattg caatgggatt ggttttcatt tgcataaaga atggaaacat gcggtgcact
     1681 atttgtatat agtttgagaa aaacac

niman · January 15, 2016

Descriptions

Segment-ID	Name	Score	E-Value	Identity
EPI413776	A/mallard/Ohio/11OS2010/2011 (A/H7N8) segment 4 (HA)	3134.9	0.000000e+00	1697/1697 (100%)
EPI413775	A/mallard/Ohio/11OS2033/2011 (A/H7N8) segment 4 (HA)	3134.9	0.000000e+00	1697/1697 (100%)
EPI419132	A/mallard/Wisconsin/10OS3171/2010 (A/H7N3) segment 4 (HA)	3057.3	0.000000e+00	1683/1697 (99%)
EPI418956	A/northern shoveler/Wisconsin/10OS3226/2010 (A/H7N3) segment 4 (HA)	3051.8	0.000000e+00	1682/1697 (99%)
EPI419151	A/mallard/Wisconsin/10OS3232/2010 (A/H0) segment 4 (HA)	3046.2	0.000000e+00	1681/1697 (99%)
EPI334033	A/mallard/Wisconsin/4236/2009 (A/H0) segment 4 (HA)	2996.4	0.000000e+00	1672/1697 (98%)
EPI419595	A/mallard/Missouri/10MO053/2010 (A/H7N4) segment 4 (HA)	2968.7	0.000000e+00	1667/1697 (98%)
EPI333728	A/mallard/Missouri/220/2009 (A/H7N3) segment 4 (HA)	2963.1	0.000000e+00	1666/1697 (98%)
EPI299451	A/northern shoveler/Mississippi/09OS643/2009 (A/H7N7) segment 4 (HA)	2941.0	0.000000e+00	1662/1697 (97%)
EPI299347	A/American green-winged teal/Mississippi/09OS046/2009 (A/H7N7) segment 4 (HA)	2935.4	0.000000e+00	1661/1697 (97%)
EPI463745	A/mallard/Minnesota/AI09-1714/2009 (A/H7N1) segment 4 (HA)	2904.1	0.000000e+00	1655/1697 (97%)
EPI616891	A/mallard/Alberta/590/2010 (A/H7N8) segment 4 (HA)	2902.2	0.000000e+00	1656/1698 (97%)
EPI616845	A/blue-winged teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 4 (HA)	2891.1	0.000000e+00	1654/1698 (97%)
EPI449900	A/blue-winged Teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 4 (HA)	2891.1	0.000000e+00	1654/1698 (97%)
EPI414400	A/northern pintail/Interior Alaska/10BM02539R0/2010 (A/H7N3) segment 4 (HA)	2874.5	0.000000e+00	1651/1698 (97%)
EPI451746	A/northern pintail/Interior Alaska/10BM09348R0/2010 (A/H7N3) segment 4 (HA)	2869.0	0.000000e+00	1650/1698 (97%)
EPI451739	A/northern pintail/Interior Alaska/10BM09347R0/2010 (A/H7N3) segment 4 (HA)	2869.0	0.000000e+00	1650/1698 (97%)
EPI451697	A/northern pintail/Interior Alaska/10BM08586R0/2010 (A/H7N3) segment 4 (HA)	2869.0	0.000000e+00	1650/1698 (97%)
EPI436656	A/mallard/Interior Alaska/10BM05860R0/2010 (A/H7N3) segment 4 (HA)	2869.0	0.000000e+00	1650/1698 (97%)
EPI436570	A/mallard/Interior Alaska/10BM05347R0/2010 (A/H7N3) segment 4 (HA)	2869.0	0.000000e+00	1650/1698 (97%)
EPI419496	A/American green-winged teal/Mississippi/11OS247/2011 (A/H0) segment 4 (HA)	2869.0	0.000000e+00	1650/1698 (97%)
EPI300150	A/northern pintail/Interior Alaska/8MP0262R2/2008 (A/H7N3) segment 4 (HA)	2869.0	0.000000e+00	1649/1697 (97%)
EPI451928	A/mallard/Interior Alaska/10BM11434R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451914	A/northern pintail/Interior Alaska/10BM11208R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451872	A/mallard/Interior Alaska/10BM10811R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451865	A/northern pintail/Interior Alaska/10BM10809R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451858	A/northern pintail/Interior Alaska/10BM10807R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451851	A/northern pintail/Interior Alaska/10BM10805R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451844	A/northern pintail/Interior Alaska/10BM10801R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451814	A/mallard/Interior Alaska/10BM10324R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451800	A/northern pintail/Interior Alaska/10BM09832R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451795	A/mallard/Interior Alaska/10BM09818R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451781	A/mallard/Interior Alaska/10CH00016R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451732	A/northern pintail/Interior Alaska/10BM09181R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451725	A/mallard/Interior Alaska/10BM08884R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451718	A/mallard/Interior Alaska/10BM08883R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451711	A/mallard/Interior Alaska/10BM08874R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451690	A/northern pintail/Interior Alaska/10BM08400R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451676	A/mallard/Interior Alaska/10BM08100R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451668	A/mallard/Interior Alaska/10BM08099R0/2010 (A/H0) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451639	A/mallard/Interior Alaska/10BM07501R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451596	A/northern pintail/Interior Alaska/10BM07114R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451582	A/mallard/Interior Alaska/10BM07092R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451551	A/mallard/Interior Alaska/10BM07066R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI451449	A/mallard/Interior Alaska/10BM09141R0/2010 (A/H0) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI436824	A/mallard/Interior Alaska/10BM06911R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI436816	A/mallard/Interior Alaska/10BM06909R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI436806	A/mallard/Interior Alaska/10BM06905R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI436797	A/northern pintail/Interior Alaska/10BM06899R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI436787	A/northern pintail/Interior Alaska/10BM06895R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI436780	A/northern pintail/Interior Alaska/10BM06524R0/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI433155	A/mallard/Interior Alaska/10BM04564R1/2010 (A/H7N3) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI432793	A/northern pintail/Interior Alaska/10BM06901R0/2010 (A/H0) segment 4 (HA)	2863.4	0.000000e+00	1649/1698 (97%)
EPI419184	A/northern shoveler/Missouri/10OS4700/2010 (A/H0) segment 4 (HA)	2863.4	0.000000e+00	1650/1699 (97%)
EPI453927	A/mallard/Interior Alaska/10BM10829R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451956	A/mallard/Interior Alaska/10BM12534R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451949	A/northern pintail/Interior Alaska/10BM11038R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451935	A/northern pintail/Interior Alaska/10BM11945R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451921	A/northern pintail/Interior Alaska/10BM11366R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451900	A/mallard/Interior Alaska/10BM10876R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451893	A/mallard/Interior Alaska/10BM10861R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451886	A/mallard/Interior Alaska/10BM10859R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451879	A/northern pintail/Interior Alaska/10BM10853R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451835	A/northern pintail/Interior Alaska/10BM10790R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451828	A/mallard/Interior Alaska/10BM10787R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451821	A/northern pintail/Interior Alaska/10BM10476R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451807	A/northern pintail/Interior Alaska/10BM10166R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451788	A/northern pintail/Interior Alaska/10BM09481R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451774	A/mallard/Interior Alaska/10BM09563R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451760	A/mallard/Interior Alaska/10BM09539R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451753	A/mallard/Interior Alaska/10BM09528R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451704	A/northern pintail/Interior Alaska/10BM08705R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451683	A/mallard/Interior Alaska/10BM08120R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451632	A/northern pintail/Interior Alaska/10BM07469R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451625	A/northern pintail/Interior Alaska/10BM07458R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451617	A/northern pintail/Interior Alaska/10BM07260R0/2010 (A/H0) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451610	A/northern pintail/Interior Alaska/10BM07121R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451589	A/northern pintail/Interior Alaska/10BM07106R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451565	A/mallard/Interior Alaska/10BM07085R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451558	A/mallard/Interior Alaska/10BM07072R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451544	A/northern pintail/Interior Alaska/10BM07029R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451436	A/northern pintail/Interior Alaska/10BM07267R0/2010 (A/H0) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI436858	A/northern pintail/Interior Alaska/10BM06720R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI436764	A/mallard/Interior Alaska/10BM06838R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI436669	A/northern pintail/Interior Alaska/10BM06306R0/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI419233	A/gadwall/Missouri/10OS4731/2010 (A/H7N3) segment 4 (HA)	2857.9	0.000000e+00	1649/1699 (97%)
EPI418896	A/common goldeneye/Wisconsin/10OS4202/2010 (A/H7N6) segment 4 (HA)	2857.9	0.000000e+00	1648/1698 (97%)
EPI451942	A/northern pintail/Interior Alaska/10BM09015R0/2010 (A/H7N6) segment 4 (HA)	2852.3	0.000000e+00	1647/1698 (96%)
EPI451907	A/northern pintail/Interior Alaska/10BM10906R0/2010 (A/H7N3) segment 4 (HA)	2852.3	0.000000e+00	1647/1698 (96%)
EPI451767	A/mallard/Interior Alaska/10BM09548R0/2010 (A/H7N3) segment 4 (HA)	2852.3	0.000000e+00	1647/1698 (96%)
EPI451660	A/northern pintail/Interior Alaska/10BM07821R0/2010 (A/H0) segment 4 (HA)	2852.3	0.000000e+00	1647/1698 (96%)
EPI451653	A/northern pintail/Interior Alaska/10BM07737R0/2010 (A/H7N3) segment 4 (HA)	2852.3	0.000000e+00	1647/1698 (96%)
EPI451603	A/northern pintail/Interior Alaska/10BM07120R0/2010 (A/H7N3) segment 4 (HA)	2852.3	0.000000e+00	1647/1698 (96%)
EPI451443	A/northern pintail/Interior Alaska/10BM07399R0/2010 (A/H7N3) segment 4 (HA)	2852.3	0.000000e+00	1647/1698 (96%)
EPI419540	A/American green-winged teal/Mississippi/11OS259/2011 (A/H0) segment 4 (HA)	2852.3	0.000000e+00	1647/1698 (96%)
EPI419497	A/American green-winged teal/Mississippi/11OS250/2011 (A/H7N3) segment 4 (HA)	2852.3	0.000000e+00	1647/1698 (96%)
EPI418762	A/American green-winged teal/Illinois/10OS3368/2010 (A/H7N7) segment 4 (HA)	2852.3	0.000000e+00	1647/1698 (96%)
EPI418759	A/American green-winged teal/Illinois/10OS3329/2010 (A/H7N7) segment 4 (HA)	2852.3	0.000000e+00	1647/1698 (96%)
EPI487934	A/turkey/Minnesota/20400/2009 (A/H7N9) segment 4 (HA)	2848.7	0.000000e+00	1636/1683 (97%)
EPI487926	A/turkey/Minnesota/18421/2009 (A/H7N9) segment 4 (HA)	2848.7	0.000000e+00	1636/1683 (97%)

niman · January 15, 2016

Descriptions

Segment-ID	Name	Score	E-Value	Identity
EPI413811	A/mallard/Ohio/11OS2091/2011 (A/H4N8) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413790	A/mallard/Ohio/11OS2010/2011 (A/H7N8) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413783	A/mallard/Ohio/11OS2033/2011 (A/H7N8) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413714	A/mallard/Ohio/11OS2204/2011 (A/H4N8) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413706	A/wood duck/Ohio/11OS2099/2011 (A/H0) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413699	A/mallard/Ohio/11OS2047/2011 (A/H4N8) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413682	A/mallard/Ohio/11OS2200/2011 (A/H0) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413654	A/mallard/Ohio/11OS2202/2011 (A/H4N8) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413644	A/mallard/Ohio/11OS2097/2011 (A/H0) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413637	A/mallard/Ohio/11OS2096/2011 (A/H4N8) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413322	A/mallard/Ohio/11OS2208/2011 (A/H0) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413313	A/mallard/Ohio/11OS2201/2011 (A/H0) segment 6 (NA)	2597.5	0.000000e+00	1406/1406 (100%)
EPI413609	A/mallard/Ohio/11OS2153/2011 (A/H3N8) segment 6 (NA)	2592.0	0.000000e+00	1405/1406 (99%)
EPI413617	A/mallard/Ohio/11OS2203/2011 (A/H0) segment 6 (NA)	2580.9	0.000000e+00	1403/1406 (99%)
EPI413301	A/mallard/Ohio/11OS2138/2011 (A/H0) segment 6 (NA)	2580.9	0.000000e+00	1403/1406 (99%)
EPI449816	A/mallard/Minnesota/AI09-3047/2009 (A/H0) segment 6 (NA)	2569.8	0.000000e+00	1401/1406 (99%)
EPI512412	A/blue-winged teal/Missouri/11OS2640/2011 (A/H4N8) segment 6 (NA)	2553.2	0.000000e+00	1398/1406 (99%)
EPI616317	A/blue-winged teal/Missouri/12OS2519/2012 (A/H4N8) segment 6 (NA)	2547.7	0.000000e+00	1397/1406 (99%)
EPI513078	A/mallard/Wisconsin/11OS4081/2011 (A/H3N8) segment 6 (NA)	2542.1	0.000000e+00	1396/1406 (99%)
EPI614535	A/blue winged-teal/Wisconsin/12OS4224/2012 (A/H4N8) segment 6 (NA)	2536.6	0.000000e+00	1395/1406 (99%)
EPI343026	A/redhead/Alberta/458/2007 (A/H3N8) segment 6 (NA)	2536.6	0.000000e+00	1395/1406 (99%)
EPI616356	A/mallard/Illinois/12OS4808/2012 (A/H4N8) segment 6 (NA)	2531.0	0.000000e+00	1394/1406 (99%)
EPI447975	A/American green-winged teal/Texas/AI09-6046/2009 (A/H3N8) segment 6 (NA)	2525.5	0.000000e+00	1393/1406 (99%)
EPI645369	A/blue-winged teal/Ohio/13OS1759/2013 (A/H4N8) segment 6 (NA)	2514.4	0.000000e+00	1391/1406 (98%)
EPI413343	A/environment/Ohio/08OS1292/2008 (A/H0) segment 6 (NA)	2508.9	0.000000e+00	1390/1406 (98%)
EPI342966	A/northern pintail/Alberta/8/2009 (A/H3N8) segment 6 (NA)	2508.9	0.000000e+00	1390/1406 (98%)
EPI452835	A/northern pintail/Interior Alaska/9BM7836R0/2009 (A/H3N8) segment 6 (NA)	2503.3	0.000000e+00	1389/1406 (98%)
EPI419372	A/mallard/Illinois/10OS3676/2010 (A/H3N8) segment 6 (NA)	2503.3	0.000000e+00	1389/1406 (98%)
EPI328723	A/mallard/California/6471/2008 (A/H3N8) segment 6 (NA)	2503.3	0.000000e+00	1389/1406 (98%)
EPI328649	A/mallard/California/10985/2008 (A/H3N8) segment 6 (NA)	2503.3	0.000000e+00	1390/1407 (98%)
EPI234254	A/blue-winged teal/North Dakota/Sg-00757/2008 (A/H4N8) segment 6 (NA)	2503.3	0.000000e+00	1383/1397 (98%)
EPI454155	A/northern pintail/Interior Alaska/10BM12552R0/2010 (A/H3N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI453679	A/American green-winged teal/Interior Alaska/10BM08422R0/2010 (A/H3N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI453371	A/northern pintail/Interior Alaska/10BM07597R0/2010 (A/H3N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI453172	A/northern pintail/Interior Alaska/9BM12647R0/2009 (A/H3N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI453158	A/mallard/Interior Alaska/9BM12567R0/2009 (A/H3N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI453025	A/northern shoveler/Interior Alaska/9BM12298R0/2009 (A/H3N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI453018	A/mallard/Interior Alaska/9BM12285R0/2009 (A/H3N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI452948	A/northern pintail/Interior Alaska/9BM10819R0/2009 (A/H3N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI452723	A/northern pintail/Interior Alaska/9BM11487R0/2009 (A/H3N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI450088	A/red-necked grebe/Minnesota/AI10-2531/2010 (A/H0) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI450063	A/red-necked grebe/Minnesota/AI10-2528/2010 (A/H4N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI436957	A/northern pintail/Interior Alaska/9BM8583R0/2009 (A/H0) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI436579	A/American green-winged teal/Interior Alaska/10BM05376R0/2010 (A/H3N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI418533	A/blue-winged teal/Wisconsin/10OS3108/2010 (A/H0) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI404668	A/American black duck/New Brunswick/03495/2009 (A/H3N8) segment 6 (NA)	2497.8	0.000000e+00	1388/1406 (98%)
EPI454141	A/mallard/Interior Alaska/10BM12049R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI454127	A/mallard/Interior Alaska/10BM12383R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI454120	A/mallard/Interior Alaska/10BM12374R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI454113	A/mallard/Interior Alaska/10BM12370R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI454106	A/mallard/Interior Alaska/10BM12363R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI454099	A/mallard/Interior Alaska/10BM12352R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI454092	A/mallard/Interior Alaska/10BM12351R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI454085	A/mallard/Interior Alaska/10BM12350R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI454078	A/mallard/Interior Alaska/10BM12311R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI454064	A/mallard/Interior Alaska/10BM12179R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI454057	A/mallard/Interior Alaska/10BM12178R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453992	A/mallard/Interior Alaska/10BM11420R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453985	A/mallard/Interior Alaska/10BM11419R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453978	A/mallard/Interior Alaska/10BM11418R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453964	A/mallard/Interior Alaska/10BM11415R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453957	A/mallard/Interior Alaska/10BM11414R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453805	A/mallard/Interior Alaska/10BM09561R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453728	A/northern pintail/Interior Alaska/10BM08587R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453707	A/northern pintail/Interior Alaska/10BM08505R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453700	A/northern pintail/Interior Alaska/10BM08493R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453693	A/northern pintail/Interior Alaska/10BM08489R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453686	A/northern pintail/Interior Alaska/10BM08488R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI453378	A/American green-winged teal/Interior Alaska/10BM07649R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI452562	A/American green-winged teal/Interior Alaska/9BM6410R0/2009 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI451576	A/mallard/Interior Alaska/10BM12582R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI451572	A/mallard/Interior Alaska/10BM12362R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI451529	A/mallard/Interior Alaska/10BM10834R0/2010 (A/H0) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI451519	A/mallard/Interior Alaska/10BM10831R0/2010 (A/H0) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI450080	A/red-necked grebe/Minnesota/AI10-2530/2010 (A/H0) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI450072	A/red-necked grebe/Minnesota/AI10-2529/2010 (A/H0) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI436674	A/mallard/Interior Alaska/10BM05900R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI436643	A/ring-necked duck/Interior Alaska/10BM05792R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI436637	A/northern shoveler/Interior Alaska/10BM05649R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI436630	A/northern shoveler/Interior Alaska/10BM05638R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI436616	A/northern shoveler/Interior Alaska/10BM05491R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI436609	A/northern shoveler/Interior Alaska/10BM05487R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI436586	A/northern shoveler/Interior Alaska/10BM05382R0/2010 (A/H3N8) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI432767	A/northern shoveler/Interior Alaska/10BM05646R0/2010 (A/H0) segment 6 (NA)	2492.3	0.000000e+00	1387/1406 (98%)
EPI526422	A/American green-winged teal/Ohio/13OS2086/2013 (A/H6N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI526349	A/American green-winged teal/Ohio/13OS2084/2013 (A/H6N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI454022	A/northern pintail/Interior Alaska/10BM11672R0/2010 (A/H3N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI454007	A/mallard/Interior Alaska/10BM11485R0/2010 (A/H0) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI453971	A/mallard/Interior Alaska/10BM11416R0/2010 (A/H3N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI453950	A/mallard/Interior Alaska/10BM11311R0/2010 (A/H3N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI453907	A/northern pintail/Interior Alaska/10BM10298R0/2010 (A/H3N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI453420	A/American green-winged teal/Interior Alaska/10BM08134R0/2010 (A/H3N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI453399	A/American green-winged teal/Interior Alaska/10BM07917R0/2010 (A/H3N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI453188	A/northern pintail/Interior Alaska/9BM12700R0/2009 (A/H3N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI453180	A/mallard/Interior Alaska/9BM12694R1/2009 (A/H0) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI449716	A/mallard/Minnesota/AI09-1829/2009 (A/H3N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI436726	A/mallard/Interior Alaska/10BM05968R0/2010 (A/H3N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI436707	A/mallard/Interior Alaska/10BM05970R0/2010 (A/H3N8) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI435720	A/American green-winged teal/Interior Alaska/10BM05439R0/2010 (A/H0) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)
EPI435676	A/American green-winged teal/Interior Alaska/10BM05440R0/2010 (A/H0) segment 6 (NA)	2486.7	0.000000e+00	1386/1406 (98%)

niman · January 15, 2016

Descriptions

Segment-ID	Name	Score	E-Value	Identity
EPI413789	A/mallard/Ohio/11OS2010/2011 (A/H7N8) segment 7 (MP)	1814.5	0.000000e+00	982/982 (100%)
EPI413782	A/mallard/Ohio/11OS2033/2011 (A/H7N8) segment 7 (MP)	1814.5	0.000000e+00	982/982 (100%)
EPI413810	A/mallard/Ohio/11OS2091/2011 (A/H4N8) segment 7 (MP)	1809.0	0.000000e+00	981/982 (99%)
EPI413713	A/mallard/Ohio/11OS2204/2011 (A/H4N8) segment 7 (MP)	1809.0	0.000000e+00	981/982 (99%)
EPI413705	A/wood duck/Ohio/11OS2099/2011 (A/H0) segment 7 (MP)	1809.0	0.000000e+00	981/982 (99%)
EPI413681	A/mallard/Ohio/11OS2200/2011 (A/H0) segment 7 (MP)	1809.0	0.000000e+00	981/982 (99%)
EPI413653	A/mallard/Ohio/11OS2202/2011 (A/H4N8) segment 7 (MP)	1809.0	0.000000e+00	981/982 (99%)
EPI413643	A/mallard/Ohio/11OS2097/2011 (A/H0) segment 7 (MP)	1809.0	0.000000e+00	981/982 (99%)
EPI413636	A/mallard/Ohio/11OS2096/2011 (A/H4N8) segment 7 (MP)	1809.0	0.000000e+00	981/982 (99%)
EPI413616	A/mallard/Ohio/11OS2203/2011 (A/H0) segment 7 (MP)	1809.0	0.000000e+00	981/982 (99%)
EPI413568	A/mallard/Ohio/11OS2150/2011 (A/H3N1) segment 7 (MP)	1809.0	0.000000e+00	981/982 (99%)
EPI413321	A/mallard/Ohio/11OS2208/2011 (A/H0) segment 7 (MP)	1809.0	0.000000e+00	981/982 (99%)
EPI413312	A/mallard/Ohio/11OS2201/2011 (A/H0) segment 7 (MP)	1809.0	0.000000e+00	981/982 (99%)
EPI413608	A/mallard/Ohio/11OS2153/2011 (A/H3N8) segment 7 (MP)	1803.5	0.000000e+00	980/982 (99%)
EPI413547	A/mallard/Ohio/11OS2073/2011 (A/H1N2) segment 7 (MP)	1803.5	0.000000e+00	980/982 (99%)
EPI299556	A/environment/Indiana/08OS3524/2008 (A/H1N2) segment 7 (MP)	1797.9	0.000000e+00	979/982 (99%)
EPI645440	A/mallard/Ohio/13OS1966/2013 (A/H1N8) segment 7 (MP)	1792.4	0.000000e+00	978/982 (99%)
EPI526292	A/American green-winged teal/Ohio/13OS1869/2013 (A/H10N8) segment 7 (MP)	1792.4	0.000000e+00	978/982 (99%)
EPI526138	A/American green-winged teal/Ohio/13OS2097/2013 (A/H6N8) segment 7 (MP)	1792.4	0.000000e+00	978/982 (99%)
EPI333999	A/mallard/Wisconsin/2576/2009 (A/H5N1) segment 7 (MP)	1792.4	0.000000e+00	978/982 (99%)
EPI280847	A/wild bird/Minnesota/460613-12/2006 (A/H5N2) segment 7 (MP)	1792.4	0.000000e+00	978/982 (99%)
EPI645454	A/American green-winged teal/Ohio/13OS2021/2013 (A/H4N6) segment 7 (MP)	1786.8	0.000000e+00	977/982 (99%)
EPI645412	A/blue-winged teal/Ohio/13OS2020/2013 (A/H4N6) segment 7 (MP)	1786.8	0.000000e+00	977/982 (99%)
EPI594840	A/mallard/Maryland/13OS3019/2014 (A/H0) segment 7 (MP)	1786.8	0.000000e+00	977/982 (99%)
EPI526259	A/blue-winged teal/Ohio/13OS1831/2013 (A/H3N2) segment 7 (MP)	1786.8	0.000000e+00	977/982 (99%)
EPI434140	A/blue-winged teal/Nova Scotia/01002/2010 (A/H3N8) segment 7 (MP)	1786.8	0.000000e+00	977/982 (99%)
EPI645524	A/American green-winged teal/Ohio/13OS1775/2013 (A/H4N8) segment 7 (MP)	1781.3	0.000000e+00	976/982 (99%)
EPI645461	A/blue-winged teal/Ohio/13OS1783/2013 (A/H4N8) segment 7 (MP)	1781.3	0.000000e+00	976/982 (99%)
EPI280751	A/mallard/Michigan/466547-5/2006 (A/H5N2) segment 7 (MP)	1781.3	0.000000e+00	976/982 (99%)
EPI435845	A/mallard/Alberta/166/2006 (A/H1N1) segment 7 (MP)	1770.2	0.000000e+00	974/982 (99%)
EPI419343	A/mallard/Illinois/10OS4130/2010 (A/H11N2) segment 7 (MP)	1770.2	0.000000e+00	974/982 (99%)
EPI302629	A/mallard/Minnesota/Sg-00195/2007 (A/H10N3) segment 7 (MP)	1770.2	0.000000e+00	974/982 (99%)
EPI263391	A/ring-necked duck/Minnesota/Sg-00068/2007 (A/H10N7) segment 7 (MP)	1770.2	0.000000e+00	974/982 (99%)
EPI263303	A/mallard/Minnesota/Sg-00057/2007 (A/H10N7) segment 7 (MP)	1770.2	0.000000e+00	974/982 (99%)
EPI263295	A/mallard/Minnesota/Sg-00056/2007 (A/H10N7) segment 7 (MP)	1770.2	0.000000e+00	974/982 (99%)
EPI263223	A/mallard/Minnesota/Sg-00046/2007 (A/H4N6) segment 7 (MP)	1770.2	0.000000e+00	974/982 (99%)
EPI616865	A/shorebird/Delaware Bay/22/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI614499	A/ruddy turnstone/Delaware Bay/290/2006 (A/H0) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI455654	A/northern shoveler/Minnesota/Sg-00612/2008 (A/H10N7) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI454952	A/sanderling/New Jersey/AI06-125/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI454945	A/red knot/New Jersey/AI06-096/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI343487	A/shorebird/Delaware Bay/332/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI327297	A/laughing gull/Delaware Bay/50/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI298356	A/mallard/Minnesota/Sg-00221/2007 (A/H10N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI286609	A/sanderling/New Jersey/125/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI286608	A/red knot/New Jersey/96/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI286607	A/ruddy turnstone/New Jersey/171/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI263367	A/mallard/Minnesota/Sg-00065/2007 (A/H10N7) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225641	A/shorebird/Delaware Bay/332/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225627	A/sanderling/New Jersey/355/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225620	A/sanderling/New Jersey/148/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225585	A/ruddy turnstone/New Jersey/589/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225558	A/ruddy turnstone/New Jersey/565/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225544	A/ruddy turnstone/New Jersey/562/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225530	A/ruddy turnstone/New Jersey/527/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225475	A/ruddy turnstone/New Jersey/195/2006 (A/H7) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225461	A/ruddy turnstone/New Jersey/183/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225434	A/ruddy turnstone/New Jersey/166/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225427	A/ruddy turnstone/Delaware/893/2006 (A/H7N7) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225394	A/ruddy turnstone/Delaware/789/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225366	A/ruddy turnstone/Delaware/760/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI225351	A/red knot/New Jersey/253/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI172292	A/laughing gull/Delaware Bay/6/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI171102	A/shorebird/Delaware Bay/560/2006 (A/H7N3) segment 7 (MP)	1764.7	0.000000e+00	973/982 (99%)
EPI120405	A/shorebird/Delaware/22/06 (A/H7N3) segment 7 (MP)	1761.0	0.000000e+00	972/982 (98%)
EPI455981	A/mallard/Minnesota/Sg-01030/2008 (A/H10N7) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI454958	A/ruddy turnstone/New Jersey/AI06-179/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI449587	A/mallard/Minnesota/Sg-01002/2008 (A/H0) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI419226	A/northern shoveler/Missouri/10OS4718/2010 (A/H10N7) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI404276	A/American black duck/New Brunswick/03556/2009 (A/H4N6) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI343503	A/ruddy turnstone/Delaware Bay/281/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI343495	A/ruddy turnstone/Delaware Bay/282/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI343479	A/sanderling/Delaware Bay/449/2006 (A/H9N2) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI343471	A/shorebird/Delaware Bay/513/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI343463	A/shorebird/Delaware Bay/552/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI333967	A/mallard/Wisconsin/3165/2009 (A/H1N1) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI333911	A/blue-winged teal/Wisconsin/2509/2009 (A/H1N2) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI296747	A/sanderling/Delaware/449/2006 (A/H9N2) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI227456	A/ring-necked duck/California/K90/2005 (A/H6N8) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI225578	A/ruddy turnstone/New Jersey/577/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI225551	A/ruddy turnstone/New Jersey/564/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI225489	A/ruddy turnstone/New Jersey/199/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI225482	A/ruddy turnstone/New Jersey/196/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI225468	A/ruddy turnstone/New Jersey/189/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI225454	A/ruddy turnstone/New Jersey/179/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI225387	A/ruddy turnstone/Delaware/779/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI225373	A/ruddy turnstone/Delaware/769/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI225358	A/ruddy turnstone/Delaware Bay/279/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI172316	A/ruddy turnstone/Delaware Bay/283/2006 (A/H7N3) segment 7 (MP)	1759.1	0.000000e+00	972/982 (98%)
EPI455973	A/mallard/Minnesota/Sg-01005/2008 (A/H0) segment 7 (MP)	1753.6	0.000000e+00	971/982 (98%)
EPI455035	A/ruddy turnstone/Delaware/AI06-778/2006 (A/H7N3) segment 7 (MP)	1753.6	0.000000e+00	971/982 (98%)
EPI442521	A/emperor goose/Alaska/44063-145/2006 (A/H2N1) segment 7 (MP)	1753.6	0.000000e+00	971/982 (98%)
EPI442516	A/northern pintail/Alaska/44161-087/2006 (A/H4N6) segment 7 (MP)	1753.6	0.000000e+00	971/982 (98%)
EPI442508	A/brant/Alaska/44063-007/2006 (A/H2N1) segment 7 (MP)	1753.6	0.000000e+00	971/982 (98%)
EPI442503	A/Canada goose/Alaska/44308-044/2007 (A/H4N6) segment 7 (MP)	1753.6	0.000000e+00	971/982 (98%)
EPI435817	A/shorebird/Delaware Bay/558/2006 (A/H1N1) segment 7 (MP)	1753.6	0.000000e+00	971/982 (98%)
EPI404628	A/American black duck/New Brunswick/03552/2009 (A/H4N6) segment 7 (MP)	1753.6	0.000000e+00	971/982 (98%)
EPI404615	A/American black duck/New Brunswick/03511/2009 (A/H4N6) segment 7 (MP)	1753.6	0.000000e+00	971/982 (98%)
EPI404608	A/American black duck/New Brunswick/03553/2009 (A/H4N6) segment 7 (MP)	1753.6	0.000000e+00	971/982 (98%)
EPI404257	A/American black duck/New Brunswick/03554/2009 (A/H4N6) segment 7 (MP)	1753.6	0.000000e+00	971/982 (98%)

niman · January 15, 2016

Descriptions

Segment-ID	Name	Score	E-Value	Identity
EPI413795	A/mallard/Ohio/11OS2010/2011 (A/H7N8) segment 1 (PB2)	4211.5	0.000000e+00	2280/2280 (100%)
EPI413788	A/mallard/Ohio/11OS2033/2011 (A/H7N8) segment 1 (PB2)	4211.5	0.000000e+00	2280/2280 (100%)
EPI413823	A/mallard/Ohio/11OS2092/2011 (A/H10N1) segment 1 (PB2)	4194.9	0.000000e+00	2277/2280 (99%)
EPI413816	A/mallard/Ohio/11OS2091/2011 (A/H4N8) segment 1 (PB2)	4194.9	0.000000e+00	2277/2280 (99%)
EPI413719	A/mallard/Ohio/11OS2204/2011 (A/H4N8) segment 1 (PB2)	4194.9	0.000000e+00	2277/2280 (99%)
EPI413712	A/wood duck/Ohio/11OS2099/2011 (A/H0) segment 1 (PB2)	4194.9	0.000000e+00	2277/2280 (99%)
EPI413688	A/mallard/Ohio/11OS2200/2011 (A/H0) segment 1 (PB2)	4194.9	0.000000e+00	2277/2280 (99%)
EPI413659	A/mallard/Ohio/11OS2202/2011 (A/H4N8) segment 1 (PB2)	4194.9	0.000000e+00	2277/2280 (99%)
EPI413651	A/mallard/Ohio/11OS2097/2011 (A/H0) segment 1 (PB2)	4194.9	0.000000e+00	2277/2280 (99%)
EPI413642	A/mallard/Ohio/11OS2096/2011 (A/H4N8) segment 1 (PB2)	4194.9	0.000000e+00	2277/2280 (99%)
EPI413329	A/mallard/Ohio/11OS2208/2011 (A/H0) segment 1 (PB2)	4194.9	0.000000e+00	2277/2280 (99%)
EPI413319	A/mallard/Ohio/11OS2201/2011 (A/H0) segment 1 (PB2)	4194.9	0.000000e+00	2277/2280 (99%)
EPI413704	A/mallard/Ohio/11OS2047/2011 (A/H4N8) segment 1 (PB2)	4189.3	0.000000e+00	2276/2280 (99%)
EPI413430	A/mallard/Ohio/11OS2206/2011 (A/H10N1) segment 1 (PB2)	4189.3	0.000000e+00	2276/2280 (99%)
EPI413623	A/mallard/Ohio/11OS2203/2011 (A/H0) segment 1 (PB2)	4183.8	0.000000e+00	2275/2280 (99%)
EPI413574	A/mallard/Ohio/11OS2150/2011 (A/H3N1) segment 1 (PB2)	4183.8	0.000000e+00	2275/2280 (99%)
EPI413697	A/mallard/Ohio/11OS1982/2011 (A/H0) segment 1 (PB2)	4178.2	0.000000e+00	2274/2280 (99%)
EPI413311	A/mallard/Ohio/11OS2138/2011 (A/H0) segment 1 (PB2)	4178.2	0.000000e+00	2274/2280 (99%)
EPI405305	A/mallard-black duck hybrid/New Brunswick/02642/2007 (A/H3N8) segment 1 (PB2)	4115.5	0.000000e+00	2262/2279 (99%)
EPI299466	A/American green-winged teal/Wisconsin/08OS2270/2008 (A/H3N8) segment 1 (PB2)	4100.7	0.000000e+00	2260/2280 (99%)
EPI188167	A/mallard/South Dakota/Sg-00457/2008 (A/H4N2) segment 1 (PB2)	4100.7	0.000000e+00	2260/2280 (99%)
EPI449499	A/mallard/Minnesota/Sg-00836/2008 (A/H0) segment 1 (PB2)	4098.8	0.000000e+00	2260/2280 (99%)
EPI413850	A/environment/Ohio/08OS1300/2008 (A/H0) segment 1 (PB2)	4095.1	0.000000e+00	2259/2280 (99%)
EPI449540	A/mallard/Minnesota/Sg-00868/2008 (A/H3N8) segment 1 (PB2)	4089.6	0.000000e+00	2258/2280 (99%)
EPI449383	A/mallard/Minnesota/Sg-00616/2008 (A/H4N8) segment 1 (PB2)	4089.6	0.000000e+00	2258/2280 (99%)
EPI413348	A/environment/Ohio/08OS1292/2008 (A/H0) segment 1 (PB2)	4089.6	0.000000e+00	2258/2280 (99%)
EPI449549	A/mallard/Minnesota/Sg-00902/2008 (A/H0) segment 1 (PB2)	4084.1	0.000000e+00	2257/2280 (98%)
EPI449347	A/mallard/Minnesota/Sg-00928/2008 (A/H0) segment 1 (PB2)	4084.1	0.000000e+00	2257/2280 (98%)
EPI333905	A/blue-winged teal/Wisconsin/2509/2009 (A/H1N2) segment 1 (PB2)	4084.1	0.000000e+00	2257/2280 (98%)
EPI299474	A/American green-winged teal/Wisconsin/08OS2291/2008 (A/H3N2) segment 1 (PB2)	4084.1	0.000000e+00	2257/2280 (98%)
EPI188191	A/mallard/Minnesota/Sg-00463/2008 (A/H3N8) segment 1 (PB2)	4084.1	0.000000e+00	2257/2280 (98%)
EPI449608	A/blue-winged teal/Minnesota/Sg-01026/2008 (A/H4N6) segment 1 (PB2)	4082.2	0.000000e+00	2256/2279 (98%)
EPI299394	A/gadwall/Wisconsin/08OS2293/2008 (A/H3N2) segment 1 (PB2)	4080.4	0.000000e+00	2256/2280 (98%)
EPI616843	A/mallard/Minnesota/AI08-5469/2008 (A/H7N3) segment 1 (PB2)	4078.5	0.000000e+00	2256/2280 (98%)
EPI449299	A/mallard/Minnesota/Sg-00767/2008 (A/H4N8) segment 1 (PB2)	4078.5	0.000000e+00	2256/2280 (98%)
EPI448658	A/blue-winged teal/North Dakota/Sg-00719/2008 (A/H3N8) segment 1 (PB2)	4078.5	0.000000e+00	2256/2280 (98%)
EPI333833	A/blue-winged teal/Wisconsin/2818/2009 (A/H0) segment 1 (PB2)	4078.5	0.000000e+00	2256/2280 (98%)
EPI188474	A/mallard/Minnesota/Sg-00631/2008 (A/H4N8) segment 1 (PB2)	4078.5	0.000000e+00	2248/2268 (99%)
EPI616144	A/blue-winged teal/Ohio/12OS2295/2012 (A/H4N6) segment 1 (PB2)	4076.7	0.000000e+00	2255/2279 (98%)
EPI616137	A/blue-winged teal/Ohio/12OS2294/2012 (A/H4N6) segment 1 (PB2)	4076.7	0.000000e+00	2255/2279 (98%)
EPI616130	A/blue-winged teal/Ohio/12OS2293/2012 (A/H4N6) segment 1 (PB2)	4076.7	0.000000e+00	2255/2279 (98%)
EPI449563	A/mallard/Minnesota/Sg-00931/2008 (A/H4N6) segment 1 (PB2)	4076.7	0.000000e+00	2255/2279 (98%)
EPI299386	A/American green-winged teal/Wisconsin/08OS2292/2008 (A/H3N2) segment 1 (PB2)	4076.7	0.000000e+00	2256/2280 (98%)
EPI299522	A/mallard/Wisconsin/08OS2841/2008 (A/H2N3) segment 1 (PB2)	4073.0	0.000000e+00	2255/2280 (98%)
EPI449474	A/green-winged teal/Minnesota/Sg-00820/2008 (A/H4N5) segment 1 (PB2)	4071.1	0.000000e+00	2254/2279 (98%)
EPI188447	A/mallard/Minnesota/Sg-00625/2008 (A/H4N8) segment 1 (PB2)	4071.1	0.000000e+00	2242/2261 (99%)
EPI188442	A/mallard/Minnesota/Sg-00624/2008 (A/H4N8) segment 1 (PB2)	4071.1	0.000000e+00	2246/2267 (99%)
EPI449943	A/mallard/Minnesota/AI09-4022/2009 (A/H3N2) segment 1 (PB2)	4067.4	0.000000e+00	2254/2280 (98%)
EPI449594	A/mallard/Minnesota/Sg-01002/2008 (A/H0) segment 1 (PB2)	4067.4	0.000000e+00	2254/2280 (98%)
EPI333961	A/mallard/Wisconsin/3165/2009 (A/H1N1) segment 1 (PB2)	4067.4	0.000000e+00	2254/2280 (98%)
EPI188709	A/blue-winged teal/Minnesota/Sg-00691/2008 (A/H4N8) segment 1 (PB2)	4067.4	0.000000e+00	2246/2268 (99%)
EPI449950	A/blue-winged Teal/North Dakota/AI09-4039/2009 (A/H3N6) segment 1 (PB2)	4065.6	0.000000e+00	2253/2279 (98%)
EPI188741	A/mallard/Minnesota/Sg-00700/2008 (A/H4N8) segment 1 (PB2)	4065.6	0.000000e+00	2241/2261 (99%)
EPI449822	A/mallard/Minnesota/AI09-3047/2009 (A/H0) segment 1 (PB2)	4061.9	0.000000e+00	2253/2280 (98%)
EPI449650	A/mallard/Minnesota/Sg-01039/2008 (A/H4N8) segment 1 (PB2)	4061.9	0.000000e+00	2253/2280 (98%)
EPI334257	A/mallard/Iowa/3195/2009 (A/H0) segment 1 (PB2)	4061.9	0.000000e+00	2253/2280 (98%)
EPI188492	A/mallard/Minnesota/Sg-00635/2008 (A/H4N8) segment 1 (PB2)	4060.1	0.000000e+00	2240/2261 (99%)
EPI616756	A/mallard/Minnesota/AI09-3770/2009 (A/H7N9) segment 1 (PB2)	4056.4	0.000000e+00	2253/2281 (98%)
EPI449850	A/mallard/Minnesota/AI09-3228/2009 (A/H3N1) segment 1 (PB2)	4056.4	0.000000e+00	2252/2280 (98%)
EPI449769	A/mallard/Minnesota/AI09-2509/2009 (A/H6N1) segment 1 (PB2)	4056.4	0.000000e+00	2252/2280 (98%)
EPI403265	A/shorebird/Delaware Bay/707/2009 (A/H6N2) segment 1 (PB2)	4056.4	0.000000e+00	2252/2280 (98%)
EPI188198	A/mallard/Minnesota/Sg-00465/2008 (A/H4N8) segment 1 (PB2)	4056.4	0.000000e+00	2236/2256 (99%)
EPI334320	A/mallard/Wisconsin/2755/2009 (A/H1N1) segment 1 (PB2)	4045.3	0.000000e+00	2250/2280 (98%)
EPI333977	A/mallard/Wisconsin/2756/2009 (A/H1N1) segment 1 (PB2)	4045.3	0.000000e+00	2250/2280 (98%)
EPI449636	A/mallard/Minnesota/Sg-01034/2008 (A/H11N2) segment 1 (PB2)	4039.7	0.000000e+00	2249/2280 (98%)
EPI419474	A/blue-winged teal/Illinois/10OS2988/2010 (A/H4N6) segment 1 (PB2)	4039.7	0.000000e+00	2249/2280 (98%)
EPI419260	A/American wigeon/Missouri/10OS4752/2010 (A/H6N1) segment 1 (PB2)	4039.7	0.000000e+00	2249/2280 (98%)
EPI413360	A/mallard/Ohio/10OS1354/2010 (A/H6N1) segment 1 (PB2)	4039.7	0.000000e+00	2249/2280 (98%)
EPI419710	A/American wigeon/Missouri/10MO0530/2010 (A/H0) segment 1 (PB2)	4037.9	0.000000e+00	2248/2279 (98%)
EPI334381	A/American green-winged teal/Illinois/2975/2009 (A/H0) segment 1 (PB2)	4037.9	0.000000e+00	2248/2279 (98%)
EPI453841	A/northern pintail/Interior Alaska/10CH00003R0/2010 (A/H4N6) segment 1 (PB2)	4034.2	0.000000e+00	2248/2280 (98%)
EPI418569	A/American green-winged teal/Iowa/10OS2467/2010 (A/H0) segment 1 (PB2)	4034.2	0.000000e+00	2248/2280 (98%)
EPI333817	A/lesser scaup/Illinois/4115/2009 (A/H10N7) segment 1 (PB2)	4028.7	0.000000e+00	2247/2280 (98%)
EPI418933	A/common goldeneye/Wisconsin/10OS4202/2010 (A/H7N6) segment 1 (PB2)	4023.1	0.000000e+00	2246/2280 (98%)
EPI418812	A/American green-winged teal/Illinois/10OS3589/2010 (A/H6N2) segment 1 (PB2)	4023.1	0.000000e+00	2246/2280 (98%)
EPI418776	A/gadwall/Illinois/10OS3342/2010 (A/H6N1) segment 1 (PB2)	4023.1	0.000000e+00	2246/2280 (98%)
EPI413739	A/mallard/Ohio/11OS2229/2011 (A/H5N2) segment 1 (PB2)	4023.1	0.000000e+00	2246/2280 (98%)
EPI413339	A/mallard/Ohio/11OS2237/2011 (A/H0) segment 1 (PB2)	4023.1	0.000000e+00	2246/2280 (98%)
EPI512602	A/northern shoveler/Mississippi/11OS5900/2011 (A/H8N1) segment 1 (PB2)	4021.3	0.000000e+00	2245/2279 (98%)
EPI418487	A/blue-winged teal/Illinois/10OS1546/2010 (A/H3N6) segment 1 (PB2)	4017.6	0.000000e+00	2245/2280 (98%)
EPI413867	A/mallard/Ohio/11OS1961/2011 (A/H5N2) segment 1 (PB2)	4017.6	0.000000e+00	2245/2280 (98%)
EPI413599	A/mallard/Ohio/11OS2146/2011 (A/H0) segment 1 (PB2)	4017.6	0.000000e+00	2245/2280 (98%)
EPI413588	A/mallard/Ohio/11OS2141/2011 (A/H3N2) segment 1 (PB2)	4017.6	0.000000e+00	2245/2280 (98%)
EPI413553	A/mallard/Ohio/11OS2073/2011 (A/H1N2) segment 1 (PB2)	4017.6	0.000000e+00	2245/2280 (98%)
EPI413760	A/mallard/Ohio/11OS2006/2011 (A/H5N2) segment 1 (PB2)	4012.0	0.000000e+00	2244/2280 (98%)
EPI413753	A/mallard/Ohio/11OS2119/2011 (A/H5N2) segment 1 (PB2)	4012.0	0.000000e+00	2244/2280 (98%)
EPI512669	A/mallard/Wisconsin/11OS3467/2011 (A/H0) segment 1 (PB2)	4006.5	0.000000e+00	2243/2280 (98%)
EPI512654	A/American green-winged teal/Wisconsin/11OS3432/2011 (A/H5N2) segment 1 (PB2)	4006.5	0.000000e+00	2243/2280 (98%)
EPI419109	A/American black duck/Wisconsin/10OS3949/2010 (A/H7N8) segment 1 (PB2)	4006.5	0.000000e+00	2243/2280 (98%)
EPI413443	A/mallard/Ohio/11OS1966/2011 (A/H10N3) segment 1 (PB2)	3995.4	0.000000e+00	2241/2280 (98%)
EPI526366	A/American green-winged teal/Ohio/13OS1861/2013 (A/H3N8) segment 1 (PB2)	3993.6	0.000000e+00	2241/2280 (98%)
EPI418648	A/mallard/Illinois/10OS3249/2010 (A/H11N2) segment 1 (PB2)	3989.9	0.000000e+00	2240/2280 (98%)
EPI413526	A/mallard/Ohio/11OS1991/2011 (A/H1N1) segment 1 (PB2)	3989.9	0.000000e+00	2240/2280 (98%)
EPI418998	A/mallard/Wisconsin/10OS2900/2010 (A/H3N2) segment 1 (PB2)	3988.0	0.000000e+00	2239/2279 (98%)
EPI512364	A/mallard/Illinois/11OS4421/2011 (A/H0) segment 1 (PB2)	3984.3	0.000000e+00	2239/2280 (98%)
EPI419418	A/mallard/Iowa/10OS2426/2010 (A/H3N8) segment 1 (PB2)	3978.8	0.000000e+00	2238/2280 (98%)
EPI413560	A/mallard/Ohio/11OS2149/2011 (A/H2N3) segment 1 (PB2)	3978.8	0.000000e+00	2238/2280 (98%)
EPI230655	A/environment/Maryland/1192/2006 (A/H5N1) segment 1 (PB2)	3978.8	0.000000e+00	2238/2280 (98%)
EPI595254	A/environment/Maryland/06OS1195/2006 (A/H5N1) segment 1 (PB2)	3973.3	0.000000e+00	2237/2280 (98%)
EPI595247	A/environment/Maryland/06OS1194/2006 (A/H5N1) segment 1 (PB2)	3973.3	0.000000e+00	2237/2280 (98%)

niman · January 15, 2016

Descriptions

Segment-ID	Name	Score	E-Value	Identity
EPI413787	A/mallard/Ohio/11OS2033/2011 (A/H7N8) segment 2 (PB1)	4200.4	0.000000e+00	2274/2274 (100%)
EPI413794	A/mallard/Ohio/11OS2010/2011 (A/H7N8) segment 2 (PB1)	4194.9	0.000000e+00	2273/2274 (99%)
EPI413815	A/mallard/Ohio/11OS2091/2011 (A/H4N8) segment 2 (PB1)	4172.7	0.000000e+00	2269/2274 (99%)
EPI413711	A/wood duck/Ohio/11OS2099/2011 (A/H0) segment 2 (PB1)	4172.7	0.000000e+00	2269/2274 (99%)
EPI413687	A/mallard/Ohio/11OS2200/2011 (A/H0) segment 2 (PB1)	4172.7	0.000000e+00	2269/2274 (99%)
EPI413650	A/mallard/Ohio/11OS2097/2011 (A/H0) segment 2 (PB1)	4172.7	0.000000e+00	2269/2274 (99%)
EPI413641	A/mallard/Ohio/11OS2096/2011 (A/H4N8) segment 2 (PB1)	4172.7	0.000000e+00	2269/2274 (99%)
EPI413581	A/mallard/Ohio/11OS2203/2011 (A/H0) segment 2 (PB1)	4172.7	0.000000e+00	2269/2274 (99%)
EPI413573	A/mallard/Ohio/11OS2150/2011 (A/H3N1) segment 2 (PB1)	4172.7	0.000000e+00	2269/2274 (99%)
EPI413327	A/mallard/Ohio/11OS2208/2011 (A/H0) segment 2 (PB1)	4172.7	0.000000e+00	2269/2274 (99%)
EPI413318	A/mallard/Ohio/11OS2201/2011 (A/H0) segment 2 (PB1)	4172.7	0.000000e+00	2269/2274 (99%)
EPI413718	A/mallard/Ohio/11OS2204/2011 (A/H4N8) segment 2 (PB1)	4167.2	0.000000e+00	2268/2274 (99%)
EPI413703	A/mallard/Ohio/11OS2047/2011 (A/H4N8) segment 2 (PB1)	4167.2	0.000000e+00	2268/2274 (99%)
EPI413658	A/mallard/Ohio/11OS2202/2011 (A/H4N8) segment 2 (PB1)	4167.2	0.000000e+00	2268/2274 (99%)
EPI419404	A/blue-winged teal/Iowa/10OS2411/2010 (A/H3N8) segment 2 (PB1)	4133.9	0.000000e+00	2262/2274 (99%)
EPI418775	A/gadwall/Illinois/10OS3342/2010 (A/H6N1) segment 2 (PB1)	4133.9	0.000000e+00	2262/2274 (99%)
EPI418684	A/American green-winged teal/Illinois/10OS1551/2010 (A/H4N6) segment 2 (PB1)	4133.9	0.000000e+00	2262/2274 (99%)
EPI418583	A/American green-winged teal/Iowa/10OS2467/2010 (A/H0) segment 2 (PB1)	4133.9	0.000000e+00	2262/2274 (99%)
EPI434177	A/blue-winged teal/Nova Scotia/01009/2010 (A/H4N6) segment 2 (PB1)	4128.4	0.000000e+00	2261/2274 (99%)
EPI434171	A/blue-winged teal/Nova Scotia/01008/2010 (A/H4N6) segment 2 (PB1)	4128.4	0.000000e+00	2261/2274 (99%)
EPI419583	A/blue-winged teal/Missouri/10MO003/2010 (A/H4N6) segment 2 (PB1)	4122.8	0.000000e+00	2260/2274 (99%)
EPI512566	A/northern shoveler/Mississippi/11OS5812/2011 (A/H11N9) segment 2 (PB1)	4106.2	0.000000e+00	2258/2275 (99%)
EPI449805	A/blue-winged Teal/North Dakota/AI09-2912/2009 (A/H6N1) segment 2 (PB1)	4100.7	0.000000e+00	2256/2274 (99%)
EPI476330	A/blue-winged teal/Canada/3288/2011 (A/H3N8) segment 2 (PB1)	4095.1	0.000000e+00	2255/2274 (99%)
EPI476324	A/blue-winged teal/Canada/3287/2011 (A/H3N8) segment 2 (PB1)	4095.1	0.000000e+00	2255/2274 (99%)
EPI476317	A/blue-winged teal/Canada/3286/2011 (A/H3N8) segment 2 (PB1)	4095.1	0.000000e+00	2255/2274 (99%)
EPI476310	A/blue-winged teal/Canada/3285/2011 (A/H3N8) segment 2 (PB1)	4095.1	0.000000e+00	2255/2274 (99%)
EPI476283	A/blue-winged teal/Canada/3244/2011 (A/H3N8) segment 2 (PB1)	4095.1	0.000000e+00	2255/2274 (99%)
EPI413415	A/mallard/Ohio/10OS1319/2010 (A/H4N6) segment 2 (PB1)	4095.1	0.000000e+00	2255/2274 (99%)
EPI299561	A/environment/Indiana/08OS3524/2008 (A/H1N2) segment 2 (PB1)	4084.1	0.000000e+00	2253/2274 (99%)
EPI419158	A/mallard/Wisconsin/10OS3232/2010 (A/H0) segment 2 (PB1)	4073.0	0.000000e+00	2251/2274 (98%)
EPI413801	A/mallard/Ohio/11OS2085/2011 (A/H4N6) segment 2 (PB1)	4073.0	0.000000e+00	2251/2274 (98%)
EPI476175	A/long-tailed duck/Maine/295/2011 (A/H3N8) segment 2 (PB1)	4067.4	0.000000e+00	2250/2274 (98%)
EPI435275	A/American black duck/New Brunswick/00946/2010 (A/H0) segment 2 (PB1)	4067.4	0.000000e+00	2250/2274 (98%)
EPI614538	A/blue winged-teal/Wisconsin/12OS4224/2012 (A/H4N8) segment 2 (PB1)	4061.9	0.000000e+00	2250/2275 (98%)
EPI419259	A/American wigeon/Missouri/10OS4752/2010 (A/H6N1) segment 2 (PB1)	4061.9	0.000000e+00	2249/2274 (98%)
EPI413598	A/mallard/Ohio/11OS2146/2011 (A/H0) segment 2 (PB1)	4061.9	0.000000e+00	2249/2274 (98%)
EPI413367	A/mallard/Ohio/10OS1354/2010 (A/H6N1) segment 2 (PB1)	4061.9	0.000000e+00	2249/2274 (98%)
EPI413673	A/mallard/Ohio/11OS2083/2011 (A/H4N8) segment 2 (PB1)	4056.4	0.000000e+00	2248/2274 (98%)
EPI413666	A/mallard/Ohio/11OS2072/2011 (A/H0) segment 2 (PB1)	4056.4	0.000000e+00	2248/2274 (98%)
EPI476210	A/thick-billed murre/Canada/1813/2011 (A/H12N5) segment 2 (PB1)	4050.8	0.000000e+00	2247/2274 (98%)
EPI418662	A/northern pintail/Illinois/10OS3959/2010 (A/H7N3) segment 2 (PB1)	4050.8	0.000000e+00	2247/2274 (98%)
EPI616078	A/northern pintail/Ohio/12OS3183/2012 (A/H0) segment 2 (PB1)	4045.3	0.000000e+00	2247/2275 (98%)
EPI512275	A/wood duck/Wisconsin/11OS2912/2011 (A/H3N6) segment 2 (PB1)	4045.3	0.000000e+00	2246/2274 (98%)
EPI333994	A/mallard/Wisconsin/2576/2009 (A/H5N1) segment 2 (PB1)	4045.3	0.000000e+00	2247/2275 (98%)
EPI616293	A/blue-winged teal/Ohio/12OS4593/2012 (A/H4N6) segment 2 (PB1)	4039.7	0.000000e+00	2245/2274 (98%)
EPI435356	A/American black duck/New Brunswick/00986/2010 (A/H4N6) segment 2 (PB1)	4039.7	0.000000e+00	2245/2274 (98%)
EPI512306	A/northern pintail/Illinois/11OS4796/2011 (A/H5N3) segment 2 (PB1)	4034.2	0.000000e+00	2244/2274 (98%)
EPI335402	A/aquatic bird/Korea/CN20/2009 (A/H6N1) segment 2 (PB1)	4034.2	0.000000e+00	2244/2274 (98%)
EPI420258	A/mallard/California/3569/2010 (A/H1N3) segment 2 (PB1)	4023.1	0.000000e+00	2242/2274 (98%)
EPI616437	A/mallard/Illinois/12OS5130/2012 (A/H1N1) segment 2 (PB1)	4017.6	0.000000e+00	2241/2274 (98%)
EPI616393	A/northern shoveler/Illinois/12OS5138/2012 (A/H1N1) segment 2 (PB1)	4017.6	0.000000e+00	2241/2274 (98%)
EPI387257	A/northern pintail/California/3466/2010 (A/H1N3) segment 2 (PB1)	4017.6	0.000000e+00	2241/2274 (98%)
EPI512611	A/mallard/Wisconsin/11OS4309/2011 (A/H4N6) segment 2 (PB1)	4012.0	0.000000e+00	2240/2274 (98%)
EPI159489	A/northern shoveler/California/HKWF1367/2007 (A/H3N7) segment 2 (PB1)	4012.0	0.000000e+00	2240/2274 (98%)
EPI616188	A/blue-winged teal/Ohio/12OS2229/2012 (A/H3N6) segment 2 (PB1)	4006.5	0.000000e+00	2239/2274 (98%)
EPI614550	A/American green-winged teal/Wisconsin/12OS4539/2012 (A/H0) segment 2 (PB1)	4006.5	0.000000e+00	2239/2274 (98%)
EPI512618	A/mallard/Wisconsin/11OS4310/2011 (A/H4N6) segment 2 (PB1)	4006.5	0.000000e+00	2239/2274 (98%)
EPI395061	A/glaucous-winged gull/Southeastern Alaska/10JR01856R0/2010 (A/H11N9) segment 2 (PB1)	4006.5	0.000000e+00	2240/2275 (98%)
EPI328040	A/northern shoveler/California/HKWF1128C/2007 (A/H2N7) segment 2 (PB1)	4006.5	0.000000e+00	2239/2274 (98%)
EPI159457	A/northern shoveler/California/HKWF1128/2007 (A/H2N7) segment 2 (PB1)	4006.5	0.000000e+00	2239/2274 (98%)
EPI526282	A/blue-winged teal/Ohio/13OS1831/2013 (A/H3N2) segment 2 (PB1)	4001.0	0.000000e+00	2238/2274 (98%)
EPI220555	A/green winged teal/California/AKS1370/2008 (A/H7N3) segment 2 (PB1)	4001.0	0.000000e+00	2238/2274 (98%)
EPI455139	A/mallard/Minnesota/AI06-1027/2006 (A/H0) segment 2 (PB1)	3973.3	0.000000e+00	2234/2275 (98%)
EPI449467	A/blue-winged teal/North Dakota/Sg-00759/2008 (A/H3N6) segment 2 (PB1)	3973.3	0.000000e+00	2233/2274 (98%)
EPI280844	A/mallard/Oregon/461067-2/2006 (A/H5N2) segment 2 (PB1)	3973.3	0.000000e+00	2233/2274 (98%)
EPI510514	A/goose/MB/428/2006 (A/H5N2) segment 2 (PB1)	3967.7	0.000000e+00	2232/2274 (98%)
EPI435842	A/mallard/Alberta/152/2006 (A/H1N3) segment 2 (PB1)	3967.7	0.000000e+00	2233/2275 (98%)
EPI328032	A/northern shoveler/California/HKWF1372C/2007 (A/H7N3) segment 2 (PB1)	3967.7	0.000000e+00	2232/2274 (98%)
EPI298304	A/blue-winged teal/Minnesota/Sg-00201/2007 (A/H4N6) segment 2 (PB1)	3967.7	0.000000e+00	2232/2274 (98%)
EPI292468	A/cinnamon teal/California/44287-659/2007 (A/H10N3) segment 2 (PB1)	3967.7	0.000000e+00	2232/2274 (98%)
EPI292404	A/northern shoveler/California/44287-179/2007 (A/H7N6) segment 2 (PB1)	3962.2	0.000000e+00	2231/2274 (98%)
EPI292396	A/northern shoveler/California/27985/2007 (A/H7N6) segment 2 (PB1)	3962.2	0.000000e+00	2231/2274 (98%)
EPI450020	A/blue-winged teal/Louisiana/AI09-5291/2009 (A/H4N6) segment 2 (PB1)	3956.6	0.000000e+00	2230/2274 (98%)
EPI328312	A/mallard/California/6420/2008 (A/H6N2) segment 2 (PB1)	3956.6	0.000000e+00	2230/2274 (98%)
EPI333730	A/northern shovelerMissouri/196/2009 (A/H10N3) segment 2 (PB1)	3951.1	0.000000e+00	2229/2274 (98%)
EPI327904	A/greater white-fronted goose/California/HKWF446C/2007 (A/H10N7) segment 2 (PB1)	3951.1	0.000000e+00	2229/2274 (98%)
EPI290554	A/mallard/Oregon/44221-105/2006 (A/H3N6) segment 2 (PB1)	3951.1	0.000000e+00	2229/2274 (98%)
EPI222119	A/greater white fronted goose/California/HKWF446/2007 (A/H10N7) segment 2 (PB1)	3951.1	0.000000e+00	2229/2274 (98%)
EPI178820	A/northern shoveler/California/HKWF608/2007 (A/H10N7) segment 2 (PB1)	3951.1	0.000000e+00	2229/2274 (98%)
EPI178796	A/northern shoveler/California/HKWF392sm/2007 (A/H10N7) segment 2 (PB1)	3951.1	0.000000e+00	2229/2274 (98%)
EPI442212	A/brant/Alaska/44339-481/2007 (A/H1N2) segment 2 (PB1)	3945.6	0.000000e+00	2228/2274 (97%)
EPI442211	A/brant/Alaska/44339-464/2007 (A/H1N2) segment 2 (PB1)	3945.6	0.000000e+00	2228/2274 (97%)
EPI334051	A/lesser scaup/Wisconsin/3964/2009 (A/H10N3) segment 2 (PB1)	3945.6	0.000000e+00	2228/2274 (97%)
EPI299652	A/American green-winged teal/Illinois/08OS2311/2008 (A/H0) segment 2 (PB1)	3945.6	0.000000e+00	2228/2274 (97%)
EPI292484	A/American green-winged teal/Oregon/44336-183/2007 (A/H3N8) segment 2 (PB1)	3945.6	0.000000e+00	2228/2274 (97%)
EPI290899	A/western grebe/Washington/20569-004/2007 (A/H1N2) segment 2 (PB1)	3945.6	0.000000e+00	2228/2274 (97%)
EPI288906	A/mallard/Alaska/44354-831/2007 (A/H4N6) segment 2 (PB1)	3945.6	0.000000e+00	2228/2274 (97%)
EPI225348	A/pintail/Alberta/21/2006 (A/H1N1) segment 2 (PB1)	3945.6	0.000000e+00	2228/2274 (97%)
EPI166182	A/blue-winged teal/Minnesota/Sg-00201/2007 (A/H4N6) segment 2 (PB1)	3945.6	0.000000e+00	2220/2262 (98%)
EPI419603	A/blue-winged teal/Missouri/10MO013/2010 (A/H3N1) segment 2 (PB1)	3940.0	0.000000e+00	2227/2274 (97%)
EPI419299	A/mallard/Iowa/10OS2752/2010 (A/H11N9) segment 2 (PB1)	3940.0	0.000000e+00	2228/2275 (97%)
EPI328056	A/northern shoveler/California/HKWF592C/2007 (A/H10N7) segment 2 (PB1)	3940.0	0.000000e+00	2227/2274 (97%)
EPI188790	A/blue-winged teal/North Dakota/Sg-00715/2008 (A/H4N6) segment 2 (PB1)	3940.0	0.000000e+00	2227/2274 (97%)
EPI167065	A/northern shoveler/California/HKWF216/2007 (A/H6N1) segment 2 (PB1)	3940.0	0.000000e+00	2227/2274 (97%)
EPI160341	A/northern shoveler/California/HKWF592/2007 (A/H10N7) segment 2 (PB1)	3940.0	0.000000e+00	2227/2274 (97%)
EPI333582	A/mallard/Mississippi/413/2010 (A/H1N1) segment 2 (PB1)	3934.5	0.000000e+00	2226/2274 (97%)
EPI327944	A/green-winged teal/California/11275/2008 (A/H7N3) segment 2 (PB1)	3934.5	0.000000e+00	2226/2274 (97%)
EPI154846	A/northern shoveler/California/HKWF611/2007 (A/H11N9) segment 2 (PB1)	3934.5	0.000000e+00	2226/2274 (97%)
EPI413308	A/mallard/Ohio/11OS2138/2011 (A/H0) segment 2 (PB1)	3928.9	0.000000e+00	2226/2275 (97%)

niman · January 15, 2016

Descriptions

Segment-ID	Name	Score	E-Value	Identity
EPI413793	A/mallard/Ohio/11OS2010/2011 (A/H7N8) segment 3 (PA)	3973.3	0.000000e+00	2151/2151 (100%)
EPI413786	A/mallard/Ohio/11OS2033/2011 (A/H7N8) segment 3 (PA)	3973.3	0.000000e+00	2151/2151 (100%)
EPI413612	A/mallard/Ohio/11OS2153/2011 (A/H3N8) segment 3 (PA)	3956.6	0.000000e+00	2148/2151 (99%)
EPI413622	A/mallard/Ohio/11OS2203/2011 (A/H0) segment 3 (PA)	3951.1	0.000000e+00	2147/2151 (99%)
EPI413814	A/mallard/Ohio/11OS2091/2011 (A/H4N8) segment 3 (PA)	3945.6	0.000000e+00	2146/2151 (99%)
EPI413717	A/mallard/Ohio/11OS2204/2011 (A/H4N8) segment 3 (PA)	3945.6	0.000000e+00	2146/2151 (99%)
EPI413710	A/wood duck/Ohio/11OS2099/2011 (A/H0) segment 3 (PA)	3945.6	0.000000e+00	2146/2151 (99%)
EPI413702	A/mallard/Ohio/11OS2047/2011 (A/H4N8) segment 3 (PA)	3945.6	0.000000e+00	2146/2151 (99%)
EPI413572	A/mallard/Ohio/11OS2150/2011 (A/H3N1) segment 3 (PA)	3945.6	0.000000e+00	2146/2151 (99%)
EPI413317	A/mallard/Ohio/11OS2201/2011 (A/H0) segment 3 (PA)	3945.6	0.000000e+00	2146/2151 (99%)
EPI413640	A/mallard/Ohio/11OS2096/2011 (A/H4N8) segment 3 (PA)	3940.0	0.000000e+00	2145/2151 (99%)
EPI413597	A/mallard/Ohio/11OS2146/2011 (A/H0) segment 3 (PA)	3940.0	0.000000e+00	2145/2151 (99%)
EPI413326	A/mallard/Ohio/11OS2208/2011 (A/H0) segment 3 (PA)	3934.5	0.000000e+00	2144/2151 (99%)
EPI418541	A/gadwall/Wisconsin/10OS3122/2010 (A/H11N9) segment 3 (PA)	3928.9	0.000000e+00	2143/2151 (99%)
EPI413694	A/mallard/Ohio/11OS1982/2011 (A/H0) segment 3 (PA)	3928.9	0.000000e+00	2143/2151 (99%)
EPI594785	A/mallard/Maryland/10OS2170/2010 (A/H6N2) segment 3 (PA)	3912.3	0.000000e+00	2140/2151 (99%)
EPI435650	A/mallard/Nova Scotia/01017/2010 (A/H0) segment 3 (PA)	3901.2	0.000000e+00	2138/2151 (99%)
EPI435647	A/mallard/Nova Scotia/01013/2010 (A/H6N1) segment 3 (PA)	3901.2	0.000000e+00	2138/2151 (99%)
EPI435515	A/blue-winged teal/Nova Scotia/01000/2010 (A/H6N1) segment 3 (PA)	3901.2	0.000000e+00	2138/2151 (99%)
EPI435514	A/blue-winged teal/Prince Edward Island/00849/2010 (A/H6N1) segment 3 (PA)	3901.2	0.000000e+00	2138/2151 (99%)
EPI594782	A/mallard/Maryland/09OS2221/2009 (A/H1N1) segment 3 (PA)	3895.7	0.000000e+00	2137/2151 (99%)
EPI435520	A/blue-winged teal/Nova Scotia/01027/2010 (A/H3N8) segment 3 (PA)	3895.7	0.000000e+00	2137/2151 (99%)
EPI435517	A/blue-winged teal/Nova Scotia/01003/2010 (A/H6N1) segment 3 (PA)	3895.7	0.000000e+00	2137/2151 (99%)
EPI435478	A/blue-winged teal/Nova Scotia/00070/2010 (A/H0) segment 3 (PA)	3895.7	0.000000e+00	2137/2151 (99%)
EPI334068	A/mallard/Wisconsin/1534/2009 (A/H6N8) segment 3 (PA)	3895.7	0.000000e+00	2137/2151 (99%)
EPI511401	A/mallard/Wisconsin/11OS3422/2011 (A/H11N9) segment 3 (PA)	3890.2	0.000000e+00	2136/2151 (99%)
EPI454418	A/mallard/New Jersey/AI09-5361/2009 (A/H11N9) segment 3 (PA)	3890.2	0.000000e+00	2136/2151 (99%)
EPI333907	A/blue-winged teal/Wisconsin/2509/2009 (A/H1N2) segment 3 (PA)	3890.2	0.000000e+00	2136/2151 (99%)
EPI333739	A/northern shovelerMissouri/141/2009 (A/H0) segment 3 (PA)	3890.2	0.000000e+00	2136/2151 (99%)
EPI454421	A/mallard/New Jersey/AI09-6426/2009 (A/H4N9) segment 3 (PA)	3884.6	0.000000e+00	2135/2151 (99%)
EPI447842	A/mallard/Minnesota/AI09-3066/2009 (A/H12N5) segment 3 (PA)	3884.6	0.000000e+00	2135/2151 (99%)
EPI419176	A/mallard/Wisconsin/10OS3881/2010 (A/H0) segment 3 (PA)	3884.6	0.000000e+00	2135/2151 (99%)
EPI413649	A/mallard/Ohio/11OS2097/2011 (A/H0) segment 3 (PA)	3884.6	0.000000e+00	2135/2151 (99%)
EPI454416	A/mallard/New Jersey/AI09-5122/2009 (A/H11N9) segment 3 (PA)	3879.1	0.000000e+00	2134/2151 (99%)
EPI334019	A/mallard/Wisconsin/2549/2009 (A/H3N2) segment 3 (PA)	3879.1	0.000000e+00	2134/2151 (99%)
EPI334124	A/blue-winged teal/Wisconsin/3061/2009 (A/H0) segment 3 (PA)	3873.5	0.000000e+00	2133/2151 (99%)
EPI333995	A/mallard/Wisconsin/2576/2009 (A/H5N1) segment 3 (PA)	3873.5	0.000000e+00	2133/2151 (99%)
EPI418913	A/bufflehead/Wisconsin/10OS3204/2010 (A/H12N5) segment 3 (PA)	3868.0	0.000000e+00	2132/2151 (99%)
EPI413414	A/mallard/Ohio/10OS1319/2010 (A/H4N6) segment 3 (PA)	3868.0	0.000000e+00	2132/2151 (99%)
EPI334036	A/greater scaup/Wisconsin/4234/2009 (A/H11N9) segment 3 (PA)	3868.0	0.000000e+00	2132/2151 (99%)
EPI419298	A/mallard/Iowa/10OS2752/2010 (A/H11N9) segment 3 (PA)	3862.5	0.000000e+00	2131/2151 (99%)
EPI334052	A/lesser scaup/Wisconsin/3964/2009 (A/H10N3) segment 3 (PA)	3862.5	0.000000e+00	2131/2151 (99%)
EPI333707	A/northern pintail/Missouri/319/2009 (A/H12N5) segment 3 (PA)	3856.9	0.000000e+00	2130/2151 (99%)
EPI333601	A/American green-winged teal/Mississippi/404/2010 (A/H0) segment 3 (PA)	3856.9	0.000000e+00	2130/2151 (99%)
EPI419080	A/mallard/Wisconsin/10OS3066/2010 (A/H6N2) segment 3 (PA)	3851.4	0.000000e+00	2129/2151 (98%)
EPI418509	A/mallard/Wisconsin/10OS2880/2010 (A/H6N8) segment 3 (PA)	3851.4	0.000000e+00	2129/2151 (98%)
EPI413337	A/mallard/Ohio/11OS2237/2011 (A/H0) segment 3 (PA)	3851.4	0.000000e+00	2129/2151 (98%)
EPI447575	A/ring-necked duck/Minnesota/Sg-01066/2008 (A/H12N8) segment 3 (PA)	3845.8	0.000000e+00	2128/2151 (98%)
EPI594788	A/mallard/Maryland/09OS2237/2009 (A/H10N6) segment 3 (PA)	3840.3	0.000000e+00	2127/2151 (98%)
EPI435627	A/American black duck/New Brunswick/00914/2010 (A/H0) segment 3 (PA)	3840.3	0.000000e+00	2127/2151 (98%)
EPI435625	A/mallard/New Brunswick/00913/2010 (A/H0) segment 3 (PA)	3840.3	0.000000e+00	2127/2151 (98%)
EPI419630	A/mallard/Missouri/10MO084/2010 (A/H5N9) segment 3 (PA)	3840.3	0.000000e+00	2127/2151 (98%)
EPI418732	A/American green-winged teal/Wisconsin/10OS2767/2010 (A/H6N8) segment 3 (PA)	3840.3	0.000000e+00	2127/2151 (98%)
EPI419320	A/mallard/Illinois/10OS4078/2010 (A/H10N7) segment 3 (PA)	3838.5	0.000000e+00	2126/2150 (98%)
EPI435628	A/American black duck/New Brunswick/00924/2010 (A/H10N7) segment 3 (PA)	3834.8	0.000000e+00	2126/2151 (98%)
EPI435624	A/American black duck/New Brunswick/00909/2010 (A/H10N7) segment 3 (PA)	3834.8	0.000000e+00	2126/2151 (98%)
EPI435623	A/American black duck/New Brunswick/00906/2010 (A/H10N7) segment 3 (PA)	3834.8	0.000000e+00	2126/2151 (98%)
EPI435622	A/mallard-black duck hybrid/New Brunswick/00904/2010 (A/H10N7) segment 3 (PA)	3834.8	0.000000e+00	2126/2151 (98%)
EPI413462	A/mallard/Ohio/11OS2213/2011 (A/H11N2) segment 3 (PA)	3834.8	0.000000e+00	2126/2151 (98%)
EPI413400	A/mallard/Michigan/10OS1491/2010 (A/H4N6) segment 3 (PA)	3834.8	0.000000e+00	2126/2151 (98%)
EPI435639	A/American black duck/New Brunswick/00971/2010 (A/H10N6) segment 3 (PA)	3829.2	0.000000e+00	2125/2151 (98%)
EPI300295	A/mallard/Interior Alaska/8BM2273/2008 (A/H0N4) segment 3 (PA)	3829.2	0.000000e+00	2125/2151 (98%)
EPI299691	A/northern pintail/Interior Alaska/8BM2621R1/2008 (A/H8N4) segment 3 (PA)	3829.2	0.000000e+00	2125/2151 (98%)
EPI290580	A/northern pintail/Oregon/44249-559/2006 (A/H3N8) segment 3 (PA)	3829.2	0.000000e+00	2125/2151 (98%)
EPI285924	A/mallard/NV/450206-2/2006 (A/H5N2) segment 3 (PA)	3829.2	0.000000e+00	2125/2151 (98%)
EPI285923	A/mallard/NV/450206/2006 (A/H5N2) segment 3 (PA)	3829.2	0.000000e+00	2125/2151 (98%)
EPI299143	A/mallard/Interior Alaska/8BM3061/2008 (A/H8N4) segment 3 (PA)	3823.7	0.000000e+00	2124/2151 (98%)
EPI511448	A/mallard/Missouri/11OS6301/2011 (A/H6N2) segment 3 (PA)	3818.1	0.000000e+00	2123/2151 (98%)
EPI413605	A/mallard/Ohio/11OS2049/2011 (A/H3N6) segment 3 (PA)	3818.1	0.000000e+00	2123/2151 (98%)
EPI300083	A/northern pintail/Interior Alaska/8BM2082/2008 (A/H8N4) segment 3 (PA)	3818.1	0.000000e+00	2123/2151 (98%)
EPI299991	A/northern pintail/Interior Alaska/8BM2454R1/2008 (A/H8N4) segment 3 (PA)	3818.1	0.000000e+00	2123/2151 (98%)
EPI299967	A/mallard/Interior Alaska/8MP0457R1/2008 (A/H8N4) segment 3 (PA)	3818.1	0.000000e+00	2123/2151 (98%)
EPI299959	A/northern pintail/Interior Alaska/8MP0209R1/2008 (A/H8N4) segment 3 (PA)	3818.1	0.000000e+00	2123/2151 (98%)
EPI299935	A/northern pintail/Interior Alaska/8MP0469/2008 (A/H8N4) segment 3 (PA)	3818.1	0.000000e+00	2123/2151 (98%)
EPI447511	A/northern shoveler/Minnesota/Sg-00648/2008 (A/H8N4) segment 3 (PA)	3812.6	0.000000e+00	2122/2151 (98%)
EPI300036	A/mallard/Interior Alaska/8BM3499/2008 (A/H8N4) segment 3 (PA)	3812.6	0.000000e+00	2122/2151 (98%)
EPI300029	A/mallard/Interior Alaska/8BM3327/2008 (A/H8N4) segment 3 (PA)	3812.6	0.000000e+00	2122/2151 (98%)
EPI299983	A/northern pintail/Interior Alaska/8BM2011R1/2008 (A/H8N4) segment 3 (PA)	3812.6	0.000000e+00	2122/2151 (98%)
EPI188549	A/northern shoveler/Minnesota/Sg-00648/2008 (A/H8N4) segment 3 (PA)	3812.6	0.000000e+00	2122/2151 (98%)
EPI328486	A/green-winged teal/California/7972/2008 (A/H6N2) segment 3 (PA)	3807.1	0.000000e+00	2122/2152 (98%)
EPI328345	A/environment/California/7836/2008 (A/H4N6) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI300302	A/northern pintail/Interior Alaska/8BM3284R1/2008 (A/H0N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI300288	A/northern pintail/Interior Alaska/8MP0073R2/2008 (A/H0N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI300260	A/northern pintail/Interior Alaska/8BM3359/2008 (A/H0N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI300099	A/northern pintail/Interior Alaska/8MP0213R2/2008 (A/H8N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI300021	A/northern pintail/Interior Alaska/8BM3177/2008 (A/H8N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI299999	A/mallard/Interior Alaska/8BM3039/2008 (A/H8N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI299951	A/mallard/Interior Alaska/8BM2841/2008 (A/H8N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI299943	A/mallard/Interior Alaska/8BM2714/2008 (A/H8N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI299739	A/mallard/Interior Alaska/8BM3584R1/2008 (A/H8N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI299707	A/northern pintail/Interior Alaska/8BM3137/2008 (A/H8N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI299151	A/northern pintail/Interior Alaska/8BM3088/2008 (A/H8N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI299135	A/northern pintail/Interior Alaska/8BM3041/2008 (A/H8N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI299127	A/northern pintail/Interior Alaska/8BM2987/2008 (A/H8N4) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI188695	A/mallard/Minnesota/Sg-00687/2008 (A/H3N8) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI178932	A/mallard/California/7766/2008 (A/H4N6) segment 3 (PA)	3807.1	0.000000e+00	2121/2151 (98%)
EPI614124	A/mallard/Ohio/12OS1385/2012 (A/H0) segment 3 (PA)	3801.5	0.000000e+00	2120/2151 (98%)
EPI614061	A/American green-winged teal/Ohio/12OS2128/2012 (A/H6N5) segment 3 (PA)	3801.5	0.000000e+00	2120/2151 (98%)
EPI594830	A/mallard/Maryland/12OS3662/2013 (A/H11N9) segment 3 (PA)	3801.5	0.000000e+00	2120/2151 (98%)
EPI487351	A/guinea fowl/Nebraska/17096/2011 (A/H7N9) segment 3 (PA)	3801.5	0.000000e+00	2120/2151 (98%)

niman · January 15, 2016

Descriptions

Segment-ID	Name	Score	E-Value	Identity
EPI413791	A/mallard/Ohio/11OS2010/2011 (A/H7N8) segment 5 (NP)	2765.6	0.000000e+00	1497/1497 (100%)
EPI413784	A/mallard/Ohio/11OS2033/2011 (A/H7N8) segment 5 (NP)	2765.6	0.000000e+00	1497/1497 (100%)
EPI413304	A/mallard/Ohio/11OS2138/2011 (A/H0) segment 5 (NP)	2760.0	0.000000e+00	1496/1497 (99%)
EPI413700	A/mallard/Ohio/11OS2047/2011 (A/H4N8) segment 5 (NP)	2754.5	0.000000e+00	1495/1497 (99%)
EPI413619	A/mallard/Ohio/11OS2203/2011 (A/H0) segment 5 (NP)	2754.5	0.000000e+00	1495/1497 (99%)
EPI413570	A/mallard/Ohio/11OS2150/2011 (A/H3N1) segment 5 (NP)	2754.5	0.000000e+00	1495/1497 (99%)
EPI413655	A/mallard/Ohio/11OS2202/2011 (A/H4N8) segment 5 (NP)	2748.9	0.000000e+00	1494/1497 (99%)
EPI413324	A/mallard/Ohio/11OS2208/2011 (A/H0) segment 5 (NP)	2748.9	0.000000e+00	1494/1497 (99%)
EPI413314	A/mallard/Ohio/11OS2201/2011 (A/H0) segment 5 (NP)	2748.9	0.000000e+00	1494/1497 (99%)
EPI413645	A/mallard/Ohio/11OS2097/2011 (A/H0) segment 5 (NP)	2737.9	0.000000e+00	1492/1497 (99%)
EPI413638	A/mallard/Ohio/11OS2096/2011 (A/H4N8) segment 5 (NP)	2737.9	0.000000e+00	1492/1497 (99%)
EPI413707	A/wood duck/Ohio/11OS2099/2011 (A/H0) segment 5 (NP)	2732.3	0.000000e+00	1491/1497 (99%)
EPI413715	A/mallard/Ohio/11OS2204/2011 (A/H4N8) segment 5 (NP)	2726.8	0.000000e+00	1490/1497 (99%)
EPI333577	A/mallard/Mississippi/442/2010 (A/H1N1) segment 5 (NP)	2715.7	0.000000e+00	1488/1497 (99%)
EPI290888	A/rock dove/Oregon/20547-004/2007 (A/H1N2) segment 5 (NP)	2715.7	0.000000e+00	1488/1497 (99%)
EPI290880	A/rock dove/Oregon/20547-003/2007 (A/H1N2) segment 5 (NP)	2715.7	0.000000e+00	1488/1497 (99%)
EPI343290	A/mallard/Alberta/27/2007 (A/H3N8) segment 5 (NP)	2710.2	0.000000e+00	1487/1497 (99%)
EPI343282	A/mallard/Alberta/28/2007 (A/H3N8) segment 5 (NP)	2710.2	0.000000e+00	1487/1497 (99%)
EPI343274	A/mallard/Alberta/34/2007 (A/H3N8) segment 5 (NP)	2710.2	0.000000e+00	1487/1497 (99%)
EPI299584	A/blue-winged teal/Texas/Sg-00087/2007 (A/H0) segment 5 (NP)	2710.2	0.000000e+00	1487/1497 (99%)
EPI178823	A/northern shoveler/California/HKWF608/2007 (A/H10N7) segment 5 (NP)	2704.6	0.000000e+00	1486/1497 (99%)
EPI595685	A/mallard/Maryland/08OS3075/2008 (A/H10N7) segment 5 (NP)	2699.1	0.000000e+00	1485/1497 (99%)
EPI435916	A/mallard/Alberta/569/2008 (A/H1N1) segment 5 (NP)	2699.1	0.000000e+00	1486/1498 (99%)
EPI435910	A/mallard/Alberta/496/2008 (A/H1N1) segment 5 (NP)	2699.1	0.000000e+00	1485/1497 (99%)
EPI414435	A/northern pintail/Interior Alaska/10BM02585R0/2010 (A/H4N6) segment 5 (NP)	2699.1	0.000000e+00	1485/1497 (99%)
EPI333765	A/mallard/Iowa/3193/2009 (A/H11N9) segment 5 (NP)	2699.1	0.000000e+00	1485/1497 (99%)
EPI468588	A/mallard/Minnesota/AI07-3100/2007 (A/H1N1) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI454128	A/mallard/Interior Alaska/10BM12383R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI454121	A/mallard/Interior Alaska/10BM12374R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI454114	A/mallard/Interior Alaska/10BM12370R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI454107	A/mallard/Interior Alaska/10BM12363R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI454093	A/mallard/Interior Alaska/10BM12351R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI454086	A/mallard/Interior Alaska/10BM12350R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI454051	A/mallard/Interior Alaska/10BM12177R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI454044	A/mallard/Interior Alaska/10BM12172R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI454037	A/northern pintail/Interior Alaska/10BM12163R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI453908	A/northern pintail/Interior Alaska/10BM10298R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI453845	A/mallard/Interior Alaska/10CH00021R0/2010 (A/H4N6) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI453838	A/northern pintail/Interior Alaska/10CH00003R0/2010 (A/H4N6) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI453729	A/northern pintail/Interior Alaska/10BM08587R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI453708	A/northern pintail/Interior Alaska/10BM08505R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI453701	A/northern pintail/Interior Alaska/10BM08493R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI453694	A/northern pintail/Interior Alaska/10BM08489R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI453687	A/northern pintail/Interior Alaska/10BM08488R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI453421	A/American green-winged teal/Interior Alaska/10BM08134R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI451573	A/mallard/Interior Alaska/10BM12362R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI451531	A/mallard/Interior Alaska/10BM10834R0/2010 (A/H0) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI451521	A/mallard/Interior Alaska/10BM10831R0/2010 (A/H0) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI449511	A/green-winged teal/Minnesota/Sg-00841/2008 (A/H0) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI436845	A/mallard/Interior Alaska/10BM05235R1/2010 (A/H0) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI436783	A/northern pintail/Interior Alaska/10BM06872R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI436695	A/mallard/Interior Alaska/10BM05968R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI436617	A/northern shoveler/Interior Alaska/10BM05491R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI436610	A/northern shoveler/Interior Alaska/10BM05487R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI436602	A/American green-winged teal/Interior Alaska/10BM05436R0/2010 (A/H0) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI436587	A/northern shoveler/Interior Alaska/10BM05382R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI436580	A/American green-winged teal/Interior Alaska/10BM05376R0/2010 (A/H3N8) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI436558	A/American wigeon/Interior Alaska/10BM05310R0/2010 (A/H0) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI435677	A/American green-winged teal/Interior Alaska/10BM05440R0/2010 (A/H0) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI414387	A/mallard/Interior Alaska/10BM02111R0/2010 (A/H12N5) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI343230	A/mallard/Alberta/115/2007 (A/H0) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI334268	A/common goldeneye/Iowa/3192/2009 (A/H11N9) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI333725	A/mallard/Missouri/220/2009 (A/H7N3) segment 5 (NP)	2693.5	0.000000e+00	1484/1497 (99%)
EPI595678	A/mallard/Maryland/08OS3074/2008 (A/H10N7) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI468265	A/mallard/Minnesota/AI07-3136/2007 (A/H1N1) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI454156	A/northern pintail/Interior Alaska/10BM12552R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI454142	A/mallard/Interior Alaska/10BM12049R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI454100	A/mallard/Interior Alaska/10BM12352R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI454079	A/mallard/Interior Alaska/10BM12311R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI454065	A/mallard/Interior Alaska/10BM12179R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI454058	A/mallard/Interior Alaska/10BM12178R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI454023	A/northern pintail/Interior Alaska/10BM11672R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI453993	A/mallard/Interior Alaska/10BM11420R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI453986	A/mallard/Interior Alaska/10BM11419R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI453979	A/mallard/Interior Alaska/10BM11418R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI453972	A/mallard/Interior Alaska/10BM11416R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI453965	A/mallard/Interior Alaska/10BM11415R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI453958	A/mallard/Interior Alaska/10BM11414R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI453379	A/American green-winged teal/Interior Alaska/10BM07649R0/2010 (A/H3N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI450001	A/lesser scaup/Louisiana/AI09-5204/2009 (A/H6N8) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI449710	A/mallard/Minnesota/AI09-1684/2009 (A/H1N1) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI449703	A/mallard/Minnesota/AI09-1678/2009 (A/H1N1) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI449560	A/mallard/Minnesota/Sg-00931/2008 (A/H4N6) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI448641	A/mallard/North Dakota/Sg-00703/2008 (A/H12N4) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI419187	A/mallard/Wisconsin/10OS3881/2010 (A/H0) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI334378	A/mallard/Illinois/3048/2009 (A/H11N2) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI334371	A/mallard/Illinois/3051/2009 (A/H11N3) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI328792	A/Stellers eider/Alaska/44422-107/2008 (A/H1N1) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI299430	A/northern shoveler/Mississippi/09OS025/2009 (A/H12N5) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI292641	A/mallard/Washington/44338-218/2007 (A/H1N1) segment 5 (NP)	2688.0	0.000000e+00	1483/1497 (99%)
EPI510541	A/duck/AB/329/2006 (A/H5N9) segment 5 (NP)	2682.5	0.000000e+00	1482/1497 (98%)
EPI453923	A/northern pintail/Interior Alaska/10BM10556R0/2010 (A/H0) segment 5 (NP)	2682.5	0.000000e+00	1482/1497 (98%)
EPI453887	A/mallard/Interior Alaska/10BM10000R0/2010 (A/H3N8) segment 5 (NP)	2682.5	0.000000e+00	1482/1497 (98%)
EPI453680	A/American green-winged teal/Interior Alaska/10BM08422R0/2010 (A/H3N8) segment 5 (NP)	2682.5	0.000000e+00	1482/1497 (98%)
EPI451952	A/northern pintail/Interior Alaska/10BM11038R0/2010 (A/H7N3) segment 5 (NP)	2682.5	0.000000e+00	1482/1497 (98%)
EPI449519	A/mallard/Minnesota/Sg-00847/2008 (A/H0) segment 5 (NP)	2682.5	0.000000e+00	1482/1497 (98%)
EPI436814	A/mallard/Interior Alaska/10BM06828R0/2010 (A/H3N8) segment 5 (NP)	2682.5	0.000000e+00	1482/1497 (98%)
EPI436755	A/mallard/Interior Alaska/10BM06835R0/2010 (A/H3N8) segment 5 (NP)	2682.5	0.000000e+00	1482/1497 (98%)
EPI436651	A/mallard/Interior Alaska/10BM05797R0/2010 (A/H3N8) segment 5 (NP)	2682.5	0.000000e+00	1482/1497 (98%)
EPI436122	A/mallard/Alberta/155/2009 (A/H1N9) segment 5 (NP)	2682.5	0.000000e+00	1482/1497 (98%)

niman · January 15, 2016

Descriptions

Segment-ID	Name	Score	E-Value	Identity
EPI413792	A/mallard/Ohio/11OS2010/2011 (A/H7N8) segment 8 (NS)	1548.6	0.000000e+00	838/838 (100%)
EPI413785	A/mallard/Ohio/11OS2033/2011 (A/H7N8) segment 8 (NS)	1548.6	0.000000e+00	838/838 (100%)
EPI413620	A/mallard/Ohio/11OS2203/2011 (A/H0) segment 8 (NS)	1548.6	0.000000e+00	838/838 (100%)
EPI413611	A/mallard/Ohio/11OS2153/2011 (A/H3N8) segment 8 (NS)	1548.6	0.000000e+00	838/838 (100%)
EPI413564	A/mallard/Ohio/11OS2142/2011 (A/H3N1) segment 8 (NS)	1548.6	0.000000e+00	838/838 (100%)
EPI413306	A/mallard/Ohio/11OS2138/2011 (A/H0) segment 8 (NS)	1548.6	0.000000e+00	838/838 (100%)
EPI512929	A/mallard/Illinois/11OS4121/2011 (A/H6N2) segment 8 (NS)	1543.1	0.000000e+00	837/838 (99%)
EPI456551	A/mallard/New Jersey/AI09-5361/2009 (A/H11N9) segment 8 (NS)	1543.1	0.000000e+00	837/838 (99%)
EPI456537	A/mallard/New Jersey/AI09-5122/2009 (A/H11N9) segment 8 (NS)	1543.1	0.000000e+00	837/838 (99%)
EPI449962	A/northern pintail/Minnesota/AI09-4322/2009 (A/H3N8) segment 8 (NS)	1543.1	0.000000e+00	837/838 (99%)
EPI413550	A/mallard/Ohio/11OS2073/2011 (A/H1N2) segment 8 (NS)	1543.1	0.000000e+00	837/838 (99%)
EPI456572	A/mallard/New Jersey/AI09-6426/2009 (A/H4N9) segment 8 (NS)	1537.5	0.000000e+00	836/838 (99%)
EPI433658	A/blue-winged teal/Prince Edward Island/00844/2010 (A/H4N9) segment 8 (NS)	1537.5	0.000000e+00	836/838 (99%)
EPI334109	A/environment/Indiana/3596/2009 (A/H5N2) segment 8 (NS)	1537.5	0.000000e+00	836/838 (99%)
EPI334101	A/environment/Indiana/3599/2009 (A/H5N2) segment 8 (NS)	1537.5	0.000000e+00	836/838 (99%)
EPI334093	A/environment/Indiana/3607/2009 (A/H5N2) segment 8 (NS)	1537.5	0.000000e+00	836/838 (99%)
EPI334085	A/environment/Indiana/3610/2009 (A/H5N2) segment 8 (NS)	1537.5	0.000000e+00	836/838 (99%)
EPI476386	A/blue-winged teal/Canada/3305/2011 (A/H4N6) segment 8 (NS)	1532.0	0.000000e+00	835/838 (99%)
EPI476379	A/blue-winged teal/Canada/3300/2011 (A/H4N6) segment 8 (NS)	1532.0	0.000000e+00	835/838 (99%)
EPI476372	A/blue-winged teal/Canada/3304/2011 (A/H4N6) segment 8 (NS)	1532.0	0.000000e+00	835/838 (99%)
EPI476358	A/blue-winged teal/Canada/3301/2011 (A/H4N6) segment 8 (NS)	1532.0	0.000000e+00	835/838 (99%)
EPI476195	A/bufflehead/Maine/340/2011 (A/H6N8) segment 8 (NS)	1532.0	0.000000e+00	835/838 (99%)
EPI476180	A/bufflehead/Maine/338/2011 (A/H4N8) segment 8 (NS)	1532.0	0.000000e+00	835/838 (99%)
EPI447964	A/northern shoveler/Arkansas/AI09-6012/2009 (A/H10N3) segment 8 (NS)	1532.0	0.000000e+00	835/838 (99%)
EPI334195	A/American green-winged teal/Mississippi/383/2010 (A/H11N9) segment 8 (NS)	1532.0	0.000000e+00	835/838 (99%)
EPI298079	A/blue-winged teal/Texas/Sg-00157/2007 (A/H4N6) segment 8 (NS)	1532.0	0.000000e+00	835/838 (99%)
EPI280746	A/avian/Missouri/466554-6/2006 (A/H5N2) segment 8 (NS)	1532.0	0.000000e+00	835/838 (99%)
EPI595770	A/environment/Maryland/09OS1290/2009 (A/H4N6) segment 8 (NS)	1526.5	0.000000e+00	834/838 (99%)
EPI549461	A/blue-winged teal/TX/AI12-801/2012 (A/H10N3) segment 8 (NS)	1526.5	0.000000e+00	834/838 (99%)
EPI526486	A/blue-winged teal/Iowa/13OS2368/2013 (A/H4N8) segment 8 (NS)	1526.5	0.000000e+00	834/838 (99%)
EPI435257	A/American black duck/New Brunswick/00924/2010 (A/H10N7) segment 8 (NS)	1526.5	0.000000e+00	834/838 (99%)
EPI435240	A/mallard/New Brunswick/00913/2010 (A/H0) segment 8 (NS)	1526.5	0.000000e+00	834/838 (99%)
EPI435225	A/American black duck/New Brunswick/00909/2010 (A/H10N7) segment 8 (NS)	1526.5	0.000000e+00	834/838 (99%)
EPI435218	A/American black duck/New Brunswick/00906/2010 (A/H10N7) segment 8 (NS)	1526.5	0.000000e+00	834/838 (99%)
EPI435211	A/mallard-black duck hybrid/New Brunswick/00904/2010 (A/H10N7) segment 8 (NS)	1526.5	0.000000e+00	834/838 (99%)
EPI434182	A/blue-winged teal/Nova Scotia/01027/2010 (A/H3N8) segment 8 (NS)	1526.5	0.000000e+00	834/838 (99%)
EPI645427	A/American green-winged teal/Ohio/13OS1864/2013 (A/H4N8) segment 8 (NS)	1520.9	0.000000e+00	833/838 (99%)
EPI476216	A/thick-billed murre/Canada/1871/2011 (A/H1N1) segment 8 (NS)	1520.9	0.000000e+00	833/838 (99%)
EPI476153	A/common eider/Maine/270/2011 (A/H1N1) segment 8 (NS)	1520.9	0.000000e+00	833/838 (99%)
EPI476146	A/mallard/Maine/202/2011 (A/H1N1) segment 8 (NS)	1520.9	0.000000e+00	833/838 (99%)
EPI476128	A/bufflehead/Maine/161/2011 (A/H1N1) segment 8 (NS)	1520.9	0.000000e+00	833/838 (99%)
EPI468611	A/mallard/Alberta/88/2004 (A/H1N1) segment 8 (NS)	1520.9	0.000000e+00	833/838 (99%)
EPI435785	A/mallard/Alberta/88/2004 (A/H1N1) segment 8 (NS)	1520.9	0.000000e+00	833/838 (99%)
EPI435337	A/American black duck/New Brunswick/00971/2010 (A/H10N6) segment 8 (NS)	1520.9	0.000000e+00	833/838 (99%)
EPI298095	A/mallard/Minnesota/Sg-00161/2007 (A/H3N8) segment 8 (NS)	1520.9	0.000000e+00	833/838 (99%)
EPI616267	A/American green-winged teal/Ohio/12OS2334/2012 (A/H0) segment 8 (NS)	1515.4	0.000000e+00	832/838 (99%)
EPI476343	A/blue-winged teal/Canada/3240/2011 (A/H4N6) segment 8 (NS)	1515.4	0.000000e+00	832/838 (99%)
EPI476275	A/blue-winged teal/Canada/3241/2011 (A/H4N6) segment 8 (NS)	1515.4	0.000000e+00	832/838 (99%)
EPI476268	A/blue-winged teal/Canada/3239/2011 (A/H4N6) segment 8 (NS)	1515.4	0.000000e+00	832/838 (99%)
EPI476261	A/blue-winged teal/Canada/3237/2011 (A/H4N6) segment 8 (NS)	1515.4	0.000000e+00	832/838 (99%)
EPI476246	A/blue-winged teal/Canada/3231/2011 (A/H4N8) segment 8 (NS)	1515.4	0.000000e+00	832/838 (99%)
EPI420197	A/green-winged teal/California/96/2012 (A/H1N1) segment 8 (NS)	1515.4	0.000000e+00	832/838 (99%)
EPI343524	A/mallard/Alberta/66/2005 (A/H4N6) segment 8 (NS)	1515.4	0.000000e+00	832/838 (99%)
EPI343081	A/blue-winged teal/Alberta/346/2007 (A/H4N3) segment 8 (NS)	1515.4	0.000000e+00	832/838 (99%)
EPI290611	A/American coot/California/20116-002/2007 (A/H7N3) segment 8 (NS)	1515.4	0.000000e+00	832/838 (99%)
EPI263192	A/blue-winged teal/Texas/Sg-00080/2007 (A/H4N6) segment 8 (NS)	1515.4	0.000000e+00	832/838 (99%)
EPI616086	A/gadwall/Ohio/12OS5632/2012 (A/H5N2) segment 8 (NS)	1509.8	0.000000e+00	831/838 (99%)
EPI616060	A/gadwall/Ohio/12OS5640/2012 (A/H5N2) segment 8 (NS)	1509.8	0.000000e+00	831/838 (99%)
EPI512251	A/northern shoveler/Mississippi/12OS231/2012 (A/H0) segment 8 (NS)	1509.8	0.000000e+00	831/838 (99%)
EPI419686	A/mallard/Missouri/10MO0391/2010 (A/H10N7) segment 8 (NS)	1509.8	0.000000e+00	831/838 (99%)
EPI333660	A/American green-winged teal/Mississippi/300/2010 (A/H11N9) segment 8 (NS)	1509.8	0.000000e+00	831/838 (99%)
EPI290675	A/northern shoveler/Washington/44249-664/2006 (A/H7N3) segment 8 (NS)	1509.8	0.000000e+00	831/838 (99%)
EPI286021	A/mallard/Mississippi/469988-2/2006 (A/H5N2) segment 8 (NS)	1509.8	0.000000e+00	831/838 (99%)
EPI286020	A/Northern shoveler/Mississippi/469987-3/2006 (A/H5N2) segment 8 (NS)	1509.8	0.000000e+00	831/838 (99%)
EPI442346	A/lesser snow goose/Alaska/44301-116/2007 (A/H2N3) segment 8 (NS)	1508.0	0.000000e+00	830/837 (99%)
EPI227212	A/green-winged teal/Alberta/11383/2005 (A/H4N6) segment 8 (NS)	1508.0	0.000000e+00	830/837 (99%)
EPI614514	A/American green-winged teal/Wisconsin/12OS4281/2012 (A/H4N2) segment 8 (NS)	1504.3	0.000000e+00	830/838 (99%)
EPI450039	A/mallard/Arkansas/AI09-5900/2009 (A/H3N8) segment 8 (NS)	1504.3	0.000000e+00	830/838 (99%)
EPI405282	A/mallard/New Brunswick/04394/2007 (A/H10N7) segment 8 (NS)	1504.3	0.000000e+00	830/838 (99%)
EPI298191	A/blue-winged teal/Texas/Sg-00212/2007 (A/H0) segment 8 (NS)	1504.3	0.000000e+00	830/838 (99%)
EPI405153	A/American black duck/New Brunswick/04395/2007 (A/H10N7) segment 8 (NS)	1498.8	0.000000e+00	829/838 (98%)
EPI404504	A/mallard/Nova Scotia/02286/2007 (A/H7N4) segment 8 (NS)	1498.8	0.000000e+00	829/838 (98%)
EPI229603	A/mallard/Maryland/718/2004 (A/H8N4) segment 8 (NS)	1498.8	0.000000e+00	829/838 (98%)
EPI595336	A/mallard/Maryland/06OS194/2006 (A/H10N4) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI449430	A/mallard/Minnesota/Sg-00692/2008 (A/H2N3) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI420457	A/American black duck/St. John's/826/2008 (A/H4N6) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI420436	A/American black duck/St. John's/807/2008 (A/H4N4) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI404878	A/American black duck/New Brunswick/02656/2007 (A/H3N8) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI404583	A/mallard/Nova Scotia/02151/2007 (A/H1N1) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI404569	A/mallard-black duck hybrid/Nova Scotia/02150/2007 (A/H1N1) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI404562	A/mallard/Nova Scotia/02153/2007 (A/H1N1) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI392006	A/American black duck/Nova Scotia/02317/2007 (A/H4N6) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI391889	A/green-winged teal/New Brunswick/02587/2007 (A/H3N8) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI391875	A/green-winged teal/New Brunswick/02593/2007 (A/H3N8) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI391854	A/green-winged teal/New Brunswick/02597/2007 (A/H3N8) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI391847	A/green-winged teal/New Brunswick/02588/2007 (A/H3N8) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI391840	A/green-winged teal/New Brunswick/02592/2007 (A/H3N8) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI391805	A/green-winged teal/New Brunswick/02586/2007 (A/H3N8) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI391791	A/green-winged teal/New Brunswick/02591/2007 (A/H3N8) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI391784	A/green-winged teal/New Brunswick/02596/2007 (A/H3N8) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI391777	A/green-winged teal/New Brunswick/02595/2007 (A/H3N8) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI327354	A/American black duck/Newfoundland and Labrador/26516/2007 (A/H3N2) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI327352	A/American black duck/Newfoundland and Labrador/26553/2007 (A/H3N2) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI285991	A/avian/New Jersey/437109/2006 (A/H5N2) segment 8 (NS)	1493.2	0.000000e+00	828/838 (98%)
EPI615995	A/redhead/Ohio/13OS0431/2013 (A/H1N2) segment 8 (NS)	1487.7	0.000000e+00	827/838 (98%)
EPI434189	A/American black duck/Nova Scotia/00083/2010 (A/H1N1) segment 8 (NS)	1487.7	0.000000e+00	827/838 (98%)
EPI420450	A/American black duck/St. John's/819/2008 (A/H4N6) segment 8 (NS)	1487.7	0.000000e+00	827/838 (98%)
EPI420422	A/American black duck/St. John's/732/2008 (A/H3N8) segment 8 (NS)	1487.7	0.000000e+00	827/838 (98%)
EPI404720	A/American black duck/New Brunswick/02659/2007 (A/H4N6) segment 8 (NS)	1487.7	0.000000e+00	827/838 (98%)
EPI391798	A/green-winged teal/New Brunswick/02590/2007 (A/H3N8) segment 8 (NS)	1487.7	0.000000e+00	827/838 (98%)

niman · January 15, 2016

APHIS presser

https://www.aphis.usda.gov/animal_health/animal_dis_spec/poultry/downloads/hpai_audio_call.mp3

niman · January 16, 2016

Bird flu returns to poultry industry

By Lydia Mulvany and Jeff Wilson / Bloomberg

Published Jan 16, 2016 at 12:02AM

The U.S. government confirmed the presence of highly pathogenic H7N8 avian influenza in a commercial turkey flock in Indiana, the country’s first case since the end of last year’s outbreak that led to the destruction of 50 million animals.

The strain discovered at a 60,000-bird flock in Dubois County is different from those that caused last year’s outbreak, the U.S. Department of Agriculture’s Animal & Plant Health Inspection Service said Friday in a statement on its website. Federal and state authorities are monitoring and testing the nearby area, it said, without naming the exact site.

U.S. poultry producers have been on edge after recent cases in France. The U.S. outbreak, which ended in June, led to record-high egg prices and caused some shortages of turkey deli meat used in subs and sandwiches. It cost the industry $3.3 billion.

Producers have been discussing the new outbreak in a series of conference calls since they first became aware of the Indiana case late Thursday, said John Brunnquell, president of Egg Innovations Inc., which produces free-range eggs in farms across the Midwest. The response has been rapid, with the killing of birds going on throughout the night, he said in the interview.

“The timing of the disease was a surprise because most in the industry did not think it would reappear for another two or three months,” said Terry Reilly, a senior commodity analyst for Futures International in Chicago.

About 65 egg and turkey farms are within 10 kilometers (6.2 miles) of the affected barn, Brunnquell said. The area is home to an estimated 4.5 million egg-layers and about 1 to 2 million turkeys.

Indiana’s poultry industry ranks fourth nationally in turkey production, first in duck production and third in eggs, and is a significant producer of broiler chickens.

Shares of poultry producer Pilgrim’s Pride Corp. fell the most in more than two months after the announcement. Tyson Foods Inc., which produces chicken and other meats, fell as much as 5.5 percent.

The case of avian flu in Indiana doesn’t involve Tyson Foods, spokesman Gary Mickelson said in an emailed response.

The news of the case of bird flu was a boost for Cal-Maine Foods Inc., the largest U.S. egg supplier. Its stock jumped as much as 11 percent.

Avian influenza doesn’t present a food safety risk. All shipments of poultry and eggs are tested to ensure the absence of avian influenza before moving into the food supply. The Centers for Disease Control considers the risk of illness to humans to be very low.http://www.bendbulletin.com/nation/3913383-151/bird-flu-returns-to-poultry-industry#

niman · January 16, 2016

Bird flu flagged, state sets defenses

Indiana flock hit, so Arkansas alert

By Claire Williams

Posted: January 16, 2016 at 2:29 a.m.

Arkansas is prepared to fight an outbreak of bird flu, industry and government officials said Friday after the United States Department of Agriculture confirmed the first deadly case of the disease since June.

Bird flu hit a commercial turkey flock in Dubois County, Indiana, which is in the southern part of the state. The USDA's Animal and Plant Health Inspection Service said it was a strain of bird flu different from the one that caused the destruction of about 48 million birds last year.

Brandon Doss, Arkansas' state veterinarian, said he has been helping the state Livestock and Poultry Commission reach out to farmers who are growing poultry since the last outbreak.

"The poultry industry nationwide, and particularly in Arkansas, is doing everything they can to protect their flocks from this virus," he said.

Tyson Foods, the Arkansas-based poultry producer, said the company has no turkey operations in Indiana. It does have chicken operations in the southeast part of Indiana.

Tyson runs a chicken complex in Corydon, Indiana, about an hour drive from Dubois County, according to the company's website.

"We've been preparing for the possibility of the return of avian influenza since spring of last year," the company said in a statement. "Even though our chicken operations have not been affected and there has been no new case reported near our turkey operations since mid-June, all of our poultry operations are in a heightened biosecurity status."

All Tyson chicken operations in Indiana have been placed on an even higher biosecurity level, the company said. Some measures include limiting nonssential visitor access to contract farms and using biosecurity uniforms.

Tyson also tests all birds for the virus before they leave the farm, and the company knows the results before they are processed and sent to grocery stores and restaurants.

Bruce Holland, executive director of the Livestock and Poultry Commission, said there has been an effort to step up biosecurity measures since the weather cooled. The bird flu virus stays alive longer in cold weather.

"We've had a tremendous amount of meetings with the industry folks and growers," he said. "As soon as we had our outbreak last year, we started looking at what we were doing and how we were responding."

Marvin Childers, president of the Poultry Federation, a trade group for the industry in Arkansas, Missouri and Oklahoma, said the outbreak in Indiana could shut down trade between Arkansas poultry producers and foreign trading partners.

"Assuming that our trading partners do as they have done in other outbreaks, the shipment of poultry from the United States will be halted," he said. "It affects every state in the United States."

Bird flu last year dragged down exports for American producers as trading partners put up blanket bans on poultry from the U.S. The country's poultry and egg exports for the first half of 2015 fell 15 percent -- down $386.3 million to $2.4 billion form the same period last year -- according to a report by the U.S. Poultry and Egg Council.

"Some trade partners don't regionalize where the virus is," Holland said. "It's in America, and they shut the doors to all American poultry."

The federal Center for Disease Control considers the risk of bird flu to humans very low. Tyson said in a statement that there is no evidence to suggest that properly cooked poultry can transmit the disease to humans.

"Everyone will be waiting to see what happens in the next week or two," Holland said.

Business on 01/16/2016

http://www.nwaonline.com/news/2016/jan/16/bird-flu-flagged-state-sets-defenses-20/

niman · January 16, 2016

Avian influenza in the USA

16 January, 2016

The U.S. Department of Agriculture’s Animal and Plant Health Inspection Service Friday confirmed the presence of highly pathogenic H7N8 avian influenza in a commercial turkey flock in Dubois County, Indiana. The farm has about 60,000 turkeys and the flock is being euthanized to prevent the disease from spreading.
Indiana is the nation's fourth-largest turkey producer, the third-biggest egg producer, and first in duck production. The state's poultry industry is worth $2.5 billion.

http://www.poultrymed.com/Poultrymed/Templates/showpage.asp?DBID=1&LNGID=1&TMID=178&FID=1868&PID=0&IID=30272

niman · January 16, 2016

Avian_flu_confirmed_in_southwest_Indiana

Speaker_Bosma_reacts_to_governor_s_comme

AP_98111902203_1452886595462_30019620_ve

WRTV

DUBOIS COUNTY, Ind. -- A case of the avian flu was discovered in a southwest Indiana turkey farm.

The Indiana State Board of Animal Health said the flu was found after samples were tested following the death of hundreds of birds. The name of the farm has not been released.

“This finding of highly pathogenic H7N8 is unique to Indiana and the nation,” said Indiana State Veterinarian Bret D. Marsh.

Indiana officials say there is no food safety risk, and the risk to humans is very low.

“Indiana is one of the largest poultry states in America, and I have directed all relevant agencies to bring the full resources of the state of Indiana to bear on containing and resolving the issue as quickly as possible," Indiana Governor Mike Pence said in a statement.

RELATED | Poultry ban pulls birds from State Fair

Backyard poultry owners are encouraged to be aware of the signs of avian flu and report illnesses and/or deaths to the USDA Health Birds Hotline at 866-536-7593.

Signs include:

Sudden death without any signs
Lack of energy/appetite
Decreased egg production
Soft-shelled or misshapen eggs
Swelling or purple discoloration of head, eyelids, comb, hocks
Nasal discharge
Coughing, sneezing
Lack of coordination
Diarrhea

Indiana ranks fourth in the nation in turkey production, first in duck production, third in eggs, and is a significant producer of broiler chickens.

The $2.5 billion poultry industry employs more than 14,000 Hoosiers.

http://www.theindychannel.com/news/local-news/avian-flu-found-at-indiana-poultry-farm

niman · January 16, 2016

One week after N.C. poultry show ban lifted new bird flu outbreak in Indiana

Posted: Saturday, January 16, 2016 12:15 am

By Meghann Evans Winston-Salem Journal

Bird flu was confirmed at a turkey farm in Indiana, federal officials said Friday, but it was a different strain than the virus that spread in the Midwest last year.

The news came a week after N.C. Agriculture Commissioner Steve Troxler announced that North Carolina was lifting its ban on live poultry shows and public live bird sales a week earlier than it was set to expire.

The ban had been in effect since Aug. 15 in an effort to prevent the bird flu from spreading to the state.

The U.S. Department of Agriculture announced Friday that inspectors had confirmed the presence of highly pathogenic H7N8 avian influenza in a commercial turkey flock in Dubois County, Ind.

State and federal officials said they confirmed the virus Thursday night and began euthanizing about 60,000 turkeys. They hoped that a quick response could prevent a large outbreak.

There are no known cases of H7N8 infections in humans, the USDA said.

Troxler said in his statement last week that while North Carolina’s poultry show ban had been lifted, the state would consider putting it back in place if the national situation changed.

State Veterinarian Doug Meckes said in a statement Friday that North Carolina “will hold off on making a decision about reinstating the ban until we know whether or not this is an isolated incident.”

In the meantime, he encouraged poultry owners to limit out-of-state meetings and sales, maintain the highest levels of biosecurity, keep a close eye on their birds, and contact a veterinarian if they see any signs of bird flu.

Last year, a strain of bird flu cost turkey and chicken producers about 50 million birds, primarily in the Midwest. Wild birds introduced the virus, which spread from farm to farm and was last detected in June.

The threat that it could spread last fall led to the cancellation of poultry shows around the state last year, including the poultry show at the Dixie Classic Fair in Winston-Salem and the annual fall show of the Forsyth Fowl Fanciers Club.

With the ban now lifted, Donald Hartman, vice president of the Forsyth Fowl Fanciers Club, said members have begun planning the club’s spring show, which is traditionally held the last Saturday of March.

Forsyth County 4-H will be offering its embryology program to second-grade teachers in the county this spring, according to April Bowman, a livestock, forages and 4-H youth development extension agent for Forsyth County.

The embryology program will proceed unless the county receives other direction from the state.

http://www.journalnow.com/news/local/one-week-after-n-c-poultry-show-ban-lifted-new/article_ae02f6f3-3e2b-5d37-bdc1-61437aa22961.html

[email protected]

(336) 727-7204 The Associated Press contributed to this report.

High Path H7N8 In Dubois County Indiana Turkey Farm

Recommended Posts

USDA Confirms Highly Pathogenic H7N8 Avian Influenza in a Commercial Turkey Flock in Dubois County, Indiana

USDA reports first bird flu case since June, different strain than last year

Affected Counties 2016

U.S. finds first case of deadly bird flu in poultry since June

UPDATE: Highly pathogenic H7N8 bird flu diagnosed in Indiana turkey farm

Bird flu returns to poultry industry

Bird flu flagged, state sets defenses

Indiana flock hit, so Arkansas alert

Avian influenza in the USA

One week after N.C. poultry show ban lifted new bird flu outbreak in Indiana

Please sign in to comment

Recently Browsing 0 members