Sign in to follow this  
Followers 0
niman

2016 Thailand Zika Related To 2013 Thailand Sequence

3 posts in this topic

Faculty of Medicine Siriraj Hospital in Bangkok Thailand has released a partial 2016 Zika sequence which is most closely related to 2013 sequence from Thailand.

Share this post


Link to post
Share on other sites
LOCUS       KY007221                2088 bp    RNA     linear   VRL 25-OCT-2016
DEFINITION  Zika virus isolate BKK01 polyprotein gene, partial cds.
ACCESSION   KY007221
VERSION     KY007221.1
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 2088)
  AUTHORS   Leelahakorn,N., Horthongkham,N., Sornprasert,S., Athipanyasilp,N.,
            Kantakamalakul,W. and Sutthent,R.
  TITLE     Characterization of zika virus in Thailand
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2088)
  AUTHORS   Leelahakorn,N., Horthongkham,N., Sornprasert,S., Athipanyasilp,N.,
            Kantakamalakul,W. and Sutthent,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2016) Microbiology, Faculty of Medicine Siriraj
            Hospital, Mahidol University, 2 Wanglang, Bangkok, Bangkok 10700,
            Thailand
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: DNAbaser v. 4.2
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..2088
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="BKK01"
                     /isolation_source="urine"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Thailand"
                     /collection_date="30-Aug-2016"
     CDS             <1..>2088
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AOX24135.1"
                     /translation="KEKKRRGTDTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRSDAG
                     EAISFPTTLGMNKCYIQIMDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVY
                     GTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFA
                     LAAAAIAWLLGSSTSQKVIYLVMILLIAPAYSIRCIGVNNRDFVEGMSGGTWVDVVLE
                     HGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDK
                     QSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLS
                     VHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSD
                     LYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVL
                     GSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTK
                     IPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKM
                     MLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFG
                     SVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLVCLA
                     LGGVLIFLSTAVSA"
ORIGIN      
        1 aaggagaaga agagacgagg cacagacact agtgtcggaa ttgttggcct cctgctgacc
       61 acagccatgg cagcggaggt cactagacgt gggagtgcat actatatgta cttggacaga
      121 agcgatgctg gggaggccat atcttttcca accacactgg ggatgaataa gtgttatata
      181 cagatcatgg atcttggaca catgtgtgat gccaccatga gctatgaatg ccctatgctg
      241 gatgaggggg tagaaccaga tgacgtcgat tgttggtgca acacgacgtc aacttgggtt
      301 gtgtacggaa cctgccacca caaaaaaggt gaagcgcgga gatctagaag agctgtgacg
      361 ctcccctccc actccactag gaagctgcaa acgcggtcgc agacctggtt ggaatcaaga
      421 gaatacacaa agcacttgat tagagtcgaa aattggatat tcaggaaccc tggcttcgcg
      481 ttggcagcag ctgccatcgc ttggcttttg ggaagctcaa cgagccaaaa agtcatatac
      541 ttggtcatga tactgctgat tgccccggca tatagcatca ggtgcatagg agtcaacaat
      601 agggactttg tggaaggtat gtcaggtggg acttgggttg atgtcgtctt ggaacatgga
      661 ggttgtgtca ccgtaatggc acaggacaaa ccgactgtcg acatagagct ggttacaaca
      721 acagtcagca acatggcaga ggtaagatcc tactgctatg aggcatcaat atcggacatg
      781 gcttcggaca gccgctgccc aacacaaggt gaagcctacc ttgacaagca atcagacact
      841 caatatgtct gcaaaagaac gttagtggac agaggctggg gaaatggatg tggacttttt
      901 ggcaaaggga gcctggtgac atgcgccaag tttgcatgct ccaagaaaat gaccgggaag
      961 agcatccagc cagagaatct ggagtaccga ataatgctgt cagttcatgg ctcccagcac
     1021 agtgggatga tcgttaatga cacaggacat gaaactgatg agaatagagc gaaggttgag
     1081 ataacgccca attcaccaag agccgaagcc accctgggag gttttggaag cctaggactt
     1141 gattgtgaac cgaggacagg ccttgacttt tcagatttgt attacttgac tatgaataac
     1201 aagcactggt tggttcacaa ggagtggttc cacgacattc cattaccttg gcacgctggg
     1261 gcagacaccg gaactccaca ctggaacaac aaagaagcac tggtagagtt caaggatgca
     1321 catgccaaaa ggcaaactgt cgtggtccta gggagtcaag agggagcagt tcacacggct
     1381 cttgctggag ctctggaggc tgagatggat ggtgcaaagg gaaggctgtc ctctggccac
     1441 ttgaaatgtc gcctgaaaat ggataaactt agactgaagg gcgtgtcata ctccctgtgt
     1501 accgcagcgt tcacattcac taagatcccg gctgaaacac tgcacgggac agtcacagtg
     1561 gaggtacagt acgcagggac agatggacct tgcaaggttc cagctcagat ggcggtggac
     1621 atgcaaactc tgaccccagt tgggaggttg ataaccgcta accctgtaat cactgaaagc
     1681 actgagaact ctaagatgat gctggaactt gatccaccat ttggggactc ttacattgtc
     1741 ataggagtcg gggagaagaa gatcacccac cactggcaca ggagtggcag caccattgga
     1801 aaagcatttg aagccactgt gagaggtgcc aagagaatgg cagtcttggg agacacagcc
     1861 tgggactttg gatcagttgg aggcgctctc aactcattgg gcaagggtat ccatcaaatt
     1921 tttggagcag ctttcaaatc attgtttgga ggaatgtcct ggttctcaca aattctcatt
     1981 ggaacgttgc tgatgtggtt gggtctgaat acaaagaatg gatctatttc ccttgtgtgc
     2041 ttggccttag ggggagtgtt gatcttcttg tccacagccg tctctgct

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
3698 3698 100% 0.0 99% KX694532.1
3698 3698 100% 0.0 99% KF993678.1
3631 3631 100% 0.0 99% KX447521.1
3631 3631 100% 0.0 99% KX447509.1
3626 3626 100% 0.0 99% KX879604.1
3626 3626 100% 0.0 99% KX447519.1
3626 3626 100% 0.0 99% KX447513.1
3626 3626 100% 0.0 99% KX447510.1
3626 3626 100% 0.0 99% KX262887.1
3624 3624 100% 0.0 98% KY014315.1
3622 3622 100% 0.0 98% KX879603.1
3622 3622 100% 0.0 98% KX856011.1
3622 3622 100% 0.0 98% KJ776791.2
3622 3622 100% 0.0 98% KX694534.1
3622 3622 100% 0.0 98% KX447520.1
3622 3622 100% 0.0 98% KX447518.1
3622 3622 100% 0.0 98% KX447515.1
3622 3622 100% 0.0 98% KX447514.1
3622 3622 100% 0.0 98% KX447511.1
3622 3622 100% 0.0 98% KX247632.1
3622 3622 100% 0.0 98% KX051563.1
3622 3622 100% 0.0 98% KU509998.3
3622 3622 100% 0.0 98% KU991811.1
3622 3622 100% 0.0 98% KU681081.3
3617 3617 100% 0.0 98% KY014307.1
3617 3617 100% 0.0 98% KY014306.1
3617 3617 100% 0.0 98% KX197205.1
3617 3617 100% 0.0 98% KX447516.1
3617 3617 100% 0.0 98% KX576684.1
3617 3617 100% 0.0 98% KX369547.1
3617 3617 100% 0.0 98% KX446951.1
3617 3617 100% 0.0 98% KU758871.1
3617 3617 100% 0.0 98% KU758870.1
3617 3617 100% 0.0 98% KX280026.1
3617 3617 100% 0.0 98% KU527068.1
3615 3615 100% 0.0 98% KX766028.1
3613 3613 100% 0.0 98% KY014327.1
3613 3613 100% 0.0 98% KX806557.2
3613 3613 100% 0.0 98% KX766029.1
3613 3613 100% 0.0 98% KX447517.1
3613 3613 100% 0.0 98% KX447512.1
3613 3613 100% 0.0 98% KU758877.1
3613 3613 100% 0.0 98% KU758873.1
3613 3613 100% 0.0 98% KX247646.1
3613 3613 100% 0.0 98% KX197192.1
3613 3613 100% 0.0 98% KU937936.1
3613 3613 100% 0.0 98% KX156776.1
3613 3613 100% 0.0 98% KX156774.1
3613 3613 100% 0.0 98% KU940228.1
3613 3613 100% 0.0 98% KU501217.1
3613 3613 100% 0.0 98% KU501216.1
3613 3613 100% 0.0 98% KU365778.1
3613 3613 100% 0.0 98% KU312314.1
3613 3613 100% 0.0 98% KU321639.1
3611 3611 100% 0.0 98% KY014309.1
3611 3611 100% 0.0 98% KY014301.1
3609 3609 100% 0.0 98% KY014310.1
3608 3608 100% 0.0 98% KY014319.1
3608 3608 100% 0.0 98% KY014317.1
3608 3608 100% 0.0 98% KY014304.1
3608 3608 100% 0.0 98% LC190723.1
3608 3608 100% 0.0 98% KX922707.1
3608 3608 100% 0.0 98% KX811222.1
3608 3608 100% 0.0 98% KU820897.5
3608 3608 100% 0.0 98% KX266255.1
3608 3608 100% 0.0 98% KX520666.1
3608 3608 100% 0.0 98% KX446950.1
3608 3608 100% 0.0 98% KU866423.2
3608 3608 100% 0.0 98% KU758869.1
3608 3608 100% 0.0 98% KX253996.1
3608 3608 100% 0.0 98% KX185891.1
3608 3608 100% 0.0 98% KX156775.1
3608 3608 100% 0.0 98% KX117076.1
3608 3608 100% 0.0 98% KX087102.1
3608 3608 100% 0.0 98% KU963796.1
3608 3608 100% 0.0 98% KU955589.1
3608 3608 100% 0.0 98% KU820899.2
3608 3608 100% 0.0 98% KU729218.1
3608 3608 100% 0.0 98% KU497555.1
3608 3608 100% 0.0 98% KU707826.1
3608 3608 100% 0.0 98% KU365779.1
3606 3606 100% 0.0 98% KY014297.1
3606 3606 100% 0.0 98% KU940224.1
3604 3604 100% 0.0 98% KY014321.1
3604 3604 100% 0.0 98% KY014303.1
3604 3604 100% 0.0 98% KY014300.1
3604 3604 100% 0.0 98% KX827309.1
3604 3604 100% 0.0 98% KX813683.1
3604 3604 100% 0.0 98% KX377337.1
3604 3604 100% 0.0 98% KU758872.1
3604 3604 100% 0.0 98% KU758868.1
3604 3604 100% 0.0 98% KU870645.1
3604 3604 100% 0.0 98% KU926309.1
3604 3604 100% 0.0 98% KU853013.1
3604 3604 100% 0.0 98% KU853012.1
3604 3604 100% 0.0 98% KU729217.2
3604 3604 100% 0.0 98% KU501215.1
3604 3604 100% 0.0 98% KU365780.1
3604 3604 100% 0.0 98% KU365777.1
3599 3599 100% 0.0 98% KY014322.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.