Sign in to follow this  
Followers 0
niman

Full Zika Sequence Chiba ex-Oceana

4 posts in this topic

Chiba Prefectural Institute of Public Health has release full Zika sequence from Chiba ex-Oceana, Chiba/S36/2016.

Share this post


Link to post
Share on other sites
LOCUS       LC191864               10807 bp    RNA     linear   VRL 27-OCT-2016
DEFINITION  Zika virus genomic RNA, complete genome, strain:
            ZIKV/Hu/Chiba/S36/2016.
ACCESSION   LC191864
VERSION     LC191864.1
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1
  AUTHORS   Taira,M., Ogawa,T., Yamamoto,K., Nishijima,H., Hotta,C., Akita,M.
            and Tajima,S.
  TITLE     The first complete genome sequence of Zika virus isolated from
            clinical case in Japan
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10807)
  AUTHORS   Taira,M. and Ogawa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2016) Contact:Masakatsu Taira Chiba Prefectural
            Institute of Public Health, Division of Virology; 666-2 Nitona-cho
            Chuo-ku, Chiba, Chiba 260-8715, Japan
FEATURES             Location/Qualifiers
     source          1..10807
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="ZIKV/Hu/Chiba/S36/2016"
                     /isolation_source="serum"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Japan:Chiba"
                     /collection_date="2016-04-21"
     CDS             108..10379
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAV89190.1"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGADTNVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNMTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDSAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSSAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYHNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRSMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 agttgttgat ctgtgtgagt cagactgcga cagttcgagt ttgaagcgaa agctagcaac
       61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa
      121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga
      181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca
      241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc
      301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca
      361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag
      421 gcgcagatac taatgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg
      481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca
      541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac
      601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag
      661 atgacgtcga ttgttggtgc aacatgacgt caacttgggt tgtgtacgga acctgccatc
      721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacta
      781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga
      841 ttagagtcga aaattggata ttcaggaacc ctggcttcgc gttagcagca gctgccatcg
      901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga
      961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta
     1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg
     1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg
     1141 aggtaagatc ctactgctat gaggcatcaa tatcggacat ggcttcggac agccgctgcc
     1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa
     1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga
     1321 cctgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc
     1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg
     1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa
     1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag
     1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca
     1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac
     1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg
     1741 tcgtggttct agggagtcaa gaaggagcag tccacacggc ccttgctgga gctctggagg
     1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa
     1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca
     1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga
     1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag
     2041 ttgggaggtt gataaccgct aaccctgtaa tcactgaaag cactgagaac tctaagatga
     2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga
     2161 agatcaccca ccactggcac aggagtggta gcaccattgg aaaagcattt gaagccactg
     2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg
     2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat
     2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt
     2401 tgggtctgaa cacaaagaac ggatctattt cccttatgtg cttggcctta gggggagtgt
     2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga
     2521 aggagacgag atgcggtaca ggggtgttcg tctacaacga cgttgaagcc tggagggaca
     2581 ggtacaagta ccatcctgac tctccccgca gactggcagc agcagtcaag caagcctggg
     2641 aagatggtat ctgtgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag
     2701 tggaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg
     2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc
     2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata
     2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcaaacac agagcatgga
     2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg
     3001 tcagagaaga ttattcatta gagtgtgatt cagccgttat tggaacagct gttaagggaa
     3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga
     3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat
     3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac
     3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg
     3301 aagagcttga aattcggttt gaggaatgcc caggcaccaa ggtccacgtg gaggaaacat
     3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat
     3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttccg ggctaaagat ggctgttggt
     3481 atggaatgga gataaggccc aggaaagaac cagaaagtaa cttagtaagg tcaatggtga
     3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca
     3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg
     3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa
     3721 ttttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catcttgcgc
     3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt
     3841 ggacaccccg cgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct
     3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa
     3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga
     4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg
     4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca
     4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt
     4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc
     4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg
     4321 ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca
     4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc
     4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc
     4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag
     4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg
     4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt
     4681 acagagtgat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag
     4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag
     4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat
     4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg
     4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca
     4981 ttggagcggt tgcgctggat tatccagcag gaacttcagg atctccaatc ctagacaagt
     5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta
     5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga
     5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga
     5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag
     5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt
     5341 atatgacaac agcagtcaat gttacccact ctggaacaga aatcgtcgac ttaatgtgcc
     5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata
     5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcga
     5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc
     5581 gtgacgcatt tccggactcc aactcaccaa tcatggacac cgaagtggaa gtcccagaga
     5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg
     5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg
     5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt
     5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg
     5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg
     5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga
     6001 atcccaacaa acctggagat gagtatctgt atggaggcgg gtgcgcagag actgacgaag
     6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc
     6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca
     6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg
     6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct
     6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca
     6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc
     6421 acgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag
     6481 tgatggaagc cttgggaaca ctgccaggac acatgacaga gagattccag gaagccattg
     6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg
     6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc
     6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg
     6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg
     6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc
     6841 aaagatctcc ccaggacaat caaatggcaa tcatcatcat ggtagcagta ggtcttctgg
     6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc
     6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggatatt gacctgcggc
     7021 cagcctcagc ttgggccatc tacgctgcct tgacaacttt cattacccca gccgtccaac
     7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag
     7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc
     7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc
     7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc
     7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg
     7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca
     7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg
     7501 gggccctgat cacagctgca acttccactt tgtgggaagg ctctcctaac aagtactgga
     7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt
     7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag
     7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct
     7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca
     7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt
     7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag
     7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa
     7981 aaggaggccc tggtcatgaa gaacccatgt tggtgcaaag ctatgggtgg aacatagtcc
     8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt
     8101 gtgacatagg tgagtcatca tccagtcctg aagtggaaga agcacggacg ctcagagtcc
     8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt
     8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag
     8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag
     8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg
     8401 acgggcccag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg
     8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga
     8521 tccgcagcga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg
     8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg
     8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga
     8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc
     8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag
     8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggttc
     8881 gtagcagtgc agcactaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg
     8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga
     9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg
     9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc
     9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag
     9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc
     9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcatcagca
     9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggctt
     9361 tggcattggc cataatcaag tacacatacc ataacaaagt ggtgaaggtc cttagaccag
     9421 ctgaaaaagg gaagacagtt atggacatta tttcgagaca agaccaaagg gggagcggac
     9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggagta
     9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag
     9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag
     9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg
     9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact
     9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt
     9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag
     9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc
     9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg
    10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat
    10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc
    10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg
    10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca
    10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact
    10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctggg gtgctgtaag
    10381 caccaatctt agtgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc
    10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg
    10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca
    10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg
    10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc
    10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc
    10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca
    10801 tggtttc

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
18354 18354 100% 0.0 99% KX806557.2
18336 18336 100% 0.0 99% KX447516.1
18336 18336 100% 0.0 99% KX447515.1
18336 18336 100% 0.0 99% KX447509.1
18330 18330 100% 0.0 99% KJ776791.2
18330 18330 100% 0.0 99% KX447512.1
18330 18330 100% 0.0 99% KX369547.1
18321 18321 100% 0.0 99% KX447514.1
18321 18321 100% 0.0 99% KX447513.1
18318 18318 100% 0.0 99% KX447511.1
18312 18312 100% 0.0 99% KX447510.1
18300 18300 100% 0.0 99% KX185891.1
18300 18300 100% 0.0 99% KX117076.1
18300 18300 100% 0.0 99% KU963796.1
18294 18294 100% 0.0 99% KX447517.1
18294 18294 100% 0.0 99% KX253996.1
18294 18294 100% 0.0 99% KU955589.1
18294 18294 100% 0.0 99% KU820899.2
18291 18291 100% 0.0 99% KX266255.1
18291 18291 100% 0.0 99% KU866423.2
18285 18285 100% 0.0 99% KU509998.3
18267 18267 100% 0.0 99% KX280026.1
18267 18267 100% 0.0 99% KX051563.1
18264 18264 100% 0.0 99% KX197205.1
18264 18264 100% 0.0 99% KU991811.1
18264 18264 100% 0.0 99% KU321639.1
18258 18258 100% 0.0 99% KX811222.1
18254 18254 100% 0.0 99% KU729218.1
18254 18254 100% 0.0 99% KU707826.1
18254 18254 100% 0.0 99% KU365779.1
18249 18249 100% 0.0 99% KX262887.1
18249 18249 100% 0.0 99% KX197192.1
18245 18245 100% 0.0 99% KU940228.1
18240 18240 100% 0.0 99% KX879604.1
18240 18240 100% 0.0 99% KX694534.1
18240 18240 100% 0.0 99% KX198135.1
18240 18240 100% 0.0 99% KU926309.1
18240 18240 100% 0.0 99% KU501217.1
18240 18240 100% 0.0 99% KU365780.1
18236 18236 100% 0.0 99% KY014303.1
18236 18236 100% 0.0 99% KX156774.1
18236 18236 99% 0.0 99% KU497555.1
18236 18236 100% 0.0 99% KU647676.1
18236 18236 100% 0.0 99% KU501216.1
18236 18236 100% 0.0 99% KU365777.1
18231 18231 100% 0.0 99% KY014297.1
18231 18231 100% 0.0 99% KX879603.1
18231 18231 100% 0.0 99% KU758877.1
18231 18231 100% 0.0 99% KX247646.1
18231 18231 100% 0.0 99% KX156776.1
18227 18227 100% 0.0 99% KX520666.1
18227 18227 100% 0.0 99% KU729217.2
18227 18227 100% 0.0 99% KU527068.1
18224 18224 100% 0.0 99% KY014327.1
18222 18222 100% 0.0 99% KU820897.5
18222 18222 100% 0.0 99% KX247632.1
18222 18222 100% 0.0 99% KU937936.1
18222 18222 100% 0.0 99% KX156775.1
18222 18222 100% 0.0 99% KX087102.1
18222 18222 100% 0.0 99% KU365778.1
18222 18222 100% 0.0 99% KU312312.1
18218 18218 100% 0.0 99% KY014315.1
18218 18218 100% 0.0 99% KY014304.1
18218 18218 100% 0.0 99% KU922960.1
18213 18213 100% 0.0 99% KY014296.1
18213 18213 100% 0.0 99% KX856011.1
18213 18213 100% 0.0 99% KX548902.1
18213 18213 100% 0.0 99% KX446951.1
18213 18213 100% 0.0 99% KU926310.1
18213 18213 100% 0.0 99% KU922923.1
18213 18213 100% 0.0 99% KU501215.1
18209 18209 100% 0.0 99% KX601168.1
18209 18209 100% 0.0 99% KX446950.1
18209 18209 100% 0.0 99% KX087101.2
18209 18209 100% 0.0 99% KU870645.1
18208 18208 100% 0.0 99% KX893855.1
18204 18204 100% 0.0 99% KX702400.1
18204 18204 100% 0.0 99% KX377337.1
18204 18204 100% 0.0 99% KU853013.1
18204 18204 100% 0.0 99% KU853012.1
18200 18200 100% 0.0 99% KY014300.1
18200 18200 100% 0.0 99% LC190723.1
18195 18195 100% 0.0 99% KY014321.1
18195 18195 100% 0.0 99% KU820898.1
18191 18191 100% 0.0 99% KY014295.1
18191 18191 100% 0.0 99% KX842449.2
18191 18191 100% 0.0 99% KX056898.1
18191 18191 100% 0.0 99% KU955590.1
18188 18188 100% 0.0 99% KX766028.1
18186 18186 100% 0.0 99% KX766029.1
18186 18186 100% 0.0 99% KU740184.2
18186 18186 100% 0.0 99% KU761564.1
18182 18182 100% 0.0 99% KX922707.1
18182 18182 100% 0.0 99% KX673530.1
18179 18179 100% 0.0 99% KY014320.1
18177 18177 100% 0.0 99% KY014323.1
18177 18177 100% 0.0 99% KY014314.1
18177 18177 100% 0.0 99% KX922703.1
18177 18177 100% 0.0 99% KX838905.2
18177 18177 100% 0.0 99% KX832731.1
18175 18175 100% 0.0 99% KX922706.1
18173 18173 100% 0.0 99% KY014316.1
18173 18173 100% 0.0 99% KX922704.1
18168 18168 100% 0.0 99% KY014322.1
18168 18168 100% 0.0 99% KX838906.2
18168 18168 100% 0.0 99% KX838904.2
18164 18164 100% 0.0 99% KY014324.1
18157 18157 100% 0.0 99% KX922705.1
18150 18150 100% 0.0 99% KX922708.1
18150 18150 99% 0.0 99% KU940224.1
18146 18146 100% 0.0 99% KY014299.1
18143 18143 100% 0.0 99% KY014317.1
18069 18069 100% 0.0 99% KX827309.1
18056 18056 100% 0.0 99% KX813683.1
18038 18038 100% 0.0 99% KU744693.1
18002 18002 100% 0.0 99% KU681081.3
17901 17901 100% 0.0 98% KY014319.1
17870 17870 100% 0.0 99% KX694532.1
17695 17695 100% 0.0 98% KU955593.1
17694 17694 99% 0.0 98% JN860885.1
17643 17643 98% 0.0 99% KF993678.1
17540 17540 100% 0.0 98% EU545988.1
17383 17383 100% 0.0 98% KU681082.3
16406 16406 100% 0.0 95% KX601167.1
16397 16397 100% 0.0 95% KX694533.1
16397 16397 99% 0.0 95% HQ234499.1
16392 16392 100% 0.0 95% KX377336.1
16157 16157 88% 0.0 99% KX447518.1
15573 17843 98% 0.0 99% KY014325.1
13268 13268 100% 0.0 89% KU955595.1
13259 13259 100% 0.0 89% KU955592.1
13257 13257 100% 0.0 89% KF383115.1
13252 13252 100% 0.0 89% DQ859059.1
13245 13733 100% 0.0 89% KX198134.1
13243 13243 100% 0.0 89% KF268949.1
13243 13243 100% 0.0 89% KF268948.1
13241 13241 100% 0.0 89% KX830960.1
13241 13241 100% 0.0 89% KU955591.1
13241 13241 100% 0.0 89% KU720415.1
13236 13236 100% 0.0 89% KF268950.1
13236 13236 99% 0.0 89% HQ234498.1
13227 13227 100% 0.0 89% KX377335.1
13223 13223 100% 0.0 89% KF383119.1
13218 13218 100% 0.0 89% LC002520.1
13216 13216 100% 0.0 89% KF383116.1
13209 13209 99% 0.0 89% HQ234501.1
13201 13201 100% 0.0 88% KX601169.1
13201 13201 100% 0.0 88% KU963573.1
13201 13201 100% 0.0 88% KU955594.1
13185 13185 100% 0.0 88% KX601166.1
13160 13160 100% 0.0 88% AY632535.2
13140 13242 100% 0.0 88% KU963574.1
13138 13138 99% 0.0 88% HQ234500.1
13133 13133 100% 0.0 88% KF383117.1
12895 12963 100% 0.0 88% KF383118.1
12825 12825 97% 0.0 88% KF383121.1
11472 15783 86% 0.0 99% KX447520.1
11254 17772 97% 0.0 99% KY014310.1
10881 18268 100% 0.0 99% KX576684.1
10826 10826 97% 0.0 84% KF383120.1
10002 16052 87% 0.0 99% KX447519.1
9822 14957 81% 0.0 99% KX447521.1
9357 13248 100% 0.0 89% KX830961.1
9261 17902 98% 0.0 99% KY014307.1
9256 17611 96% 0.0 99% KY014301.1
9227 17870 98% 0.0 99% KY014306.1
8745 17396 95% 0.0 99% KY014309.1
8662 17289 95% 0.0 99% KY014298.1
7631 15383 84% 0.0 99% KY014326.1
6408 17221 96% 0.0 98% KY014312.1
5332 16443 93% 0.0 98% KY014302.1
4998 14337 87% 0.0 95% KU940227.1
4971 4971 27% 0.0 99% KX212103.1
4946 4946 27% 0.0 99% KU758875.1
4944 4944 27% 0.0 99% KU758871.1
4937 4937 27% 0.0 99% KU758870.1
4935 4935 27% 0.0 99% KU758873.1
4935 4935 27% 0.0 99% KU312314.1
4922 4922 27% 0.0 99% KU758872.1
4911 4911 27% 0.0 99% KU758876.1
4908 4908 27% 0.0 99% KU312313.1
4901 4901 26% 0.0 99% KU758869.1
4875 4875 26% 0.0 99% KU758868.1
4870 4870 26% 0.0 99% KU758874.1
4765 15573 90% 0.0 96% KY014318.1
4596 4596 25% 0.0 99% KU646828.1
4587 4587 25% 0.0 99% KU646827.1
4525 13806 76% 0.0 99% KY014311.1
4471 14475 79% 0.0 99% KY014305.1
4190 13234 75% 0.0 95% KX101060.1
3920 13137 71% 0.0 99% KY014308.1
3608 3608 20% 0.0 98% KY007221.1
3398 3398 18% 0.0 99% KU312315.1
3202 3202 17% 0.0 99% KU740199.1
3178 3178 18% 0.0 98% KY003152.1
3074 13011 74% 0.0 99% KX101066.1
2863 4186 95% 0.0 71% DQ859064.1
2727 2727 14% 0.0 100% LC171327.1
2709 2709 14% 0.0 99% KX380263.1
2700 2700 14% 0.0 99% KX216635.1
2700 2700 14% 0.0 99% KX216634.1
2695 2695 14% 0.0 99% KX216638.1
2695 2695 14% 0.0 99% KX216637.1
2695 2695 14% 0.0 99% KX216633.1
2695 2695 14% 0.0 99% KX216632.1
2691 2691 14% 0.0 99% KX216640.1
2691 2691 14% 0.0 99% KX216636.1
2686 2686 14% 0.0 99% KX380262.1
2686 2686 14% 0.0 99% KJ634273.1
2673 2673 14% 0.0 99% KX928077.1
2673 2673 14% 0.0 99% KX216639.1
2268 10718 65% 0.0 92% KX101064.1
2197 2197 12% 0.0 97% KX867786.1
2048 2048 11% 0.0 99% KU686218.1
2012 2012 11% 0.0 99% KU179098.1
1849 1849 10% 0.0 99% KU886298.1
1837 1837 10% 0.0 99% KX954122.1
1829 1829 9% 0.0 99% KX059014.1
1829 1829 9% 0.0 99% KX059013.1
1828 13808 78% 0.0 99% KX101061.1
1777 13210 72% 0.0 99% KY014313.1
1743 1743 9% 0.0 99% KM078936.1
1739 1739 9% 0.0 99% KM078961.1
1737 1737 9% 0.0 99% KM078930.1
1736 1736 9% 0.0 99% KM078971.1
1736 1736 9% 0.0 99% KM078970.1
1736 1736 9% 0.0 99% KM078933.1
1734 1734 9% 0.0 99% KM078929.1
1680 1680 9% 0.0 99% KX377120.1
1649 1649 9% 0.0 99% KX173841.1
1649 1649 9% 0.0 99% KX173840.1
1593 1593 8% 0.0 99% KJ873160.1
1517 1517 8% 0.0 99% KX173843.1
1507 1507 8% 0.0 99% KX173844.1
1411 1411 7% 0.0 99% KJ873161.1
1373 1373 7% 0.0 99% KM851039.1
1337 1337 7% 0.0 98% KM851038.1
1335 1335 7% 0.0 99% KU985087.1
1328 1328 7% 0.0 99% KU556802.1
1306 1306 10% 0.0 88% AF013415.1
1283 1283 7% 0.0 99% KU724096.1
1227 1227 6% 0.0 99% KT200609.1
1222 1222 6% 0.0 99% KU232300.1
1213 1213 6% 0.0 99% KU232290.1
1211 1211 6% 0.0 99% KU232297.1
1202 1202 6% 0.0 99% KU232294.1
1200 1200 6% 0.0 99% KU232292.1
1196 1196 6% 0.0 99% KU232298.1
1193 1193 6% 0.0 99% KU232296.1
1193 1193 6% 0.0 99% KU232293.1

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
18969 18969 100% 0.0 100% LC191864.1
18759 18759 100% 0.0 99% KX806557.2
18737 18737 100% 0.0 99% KX447516.1
18737 18737 100% 0.0 99% KX447515.1
18737 18737 100% 0.0 99% KX447509.1
18731 18731 100% 0.0 99% KJ776791.2
18731 18731 100% 0.0 99% KX447512.1
18731 18731 100% 0.0 99% KX369547.1
18720 18720 100% 0.0 99% KX447514.1
18720 18720 100% 0.0 99% KX447513.1
18715 18715 100% 0.0 99% KX447511.1
18709 18709 100% 0.0 99% KX447510.1
18692 18692 100% 0.0 99% KX185891.1
18692 18692 100% 0.0 99% KX117076.1
18692 18692 100% 0.0 99% KU963796.1
18687 18687 100% 0.0 99% KX447517.1
18687 18687 100% 0.0 99% KX253996.1
18687 18687 100% 0.0 99% KU955589.1
18687 18687 100% 0.0 99% KU820899.2
18683 18683 100% 0.0 99% KX266255.1
18681 18681 100% 0.0 99% KU866423.2
18676 18676 100% 0.0 99% KU509998.3
18654 18654 100% 0.0 99% KX280026.1
18654 18654 100% 0.0 99% KX051563.1
18648 18648 100% 0.0 99% KX197205.1
18648 18648 100% 0.0 99% KU991811.1
18648 18648 100% 0.0 99% KU321639.1
18643 18643 100% 0.0 99% KX811222.1
18637 18637 100% 0.0 99% KU729218.1
18637 18637 100% 0.0 99% KU707826.1
18637 18637 100% 0.0 99% KU365779.1
18631 18631 100% 0.0 99% KX262887.1
18631 18631 100% 0.0 99% KX197192.1
18626 18626 100% 0.0 99% KU940228.1
18620 18620 100% 0.0 99% KX879604.1
18620 18620 100% 0.0 99% KX694534.1
18620 18620 100% 0.0 99% KX198135.1
18620 18620 100% 0.0 99% KU926309.1
18620 18620 100% 0.0 99% KU501217.1
18620 18620 100% 0.0 99% KU365780.1
18617 18617 99% 0.0 99% KU497555.1
18615 18615 100% 0.0 99% KY014303.1
18615 18615 100% 0.0 99% KX156774.1
18615 18615 100% 0.0 99% KU647676.1
18615 18615 100% 0.0 99% KU501216.1
18615 18615 100% 0.0 99% KU365777.1
18609 18609 100% 0.0 99% KX879603.1
18609 18609 100% 0.0 99% KU758877.1
18609 18609 100% 0.0 99% KX247646.1
18609 18609 100% 0.0 99% KX156776.1
18607 18607 100% 0.0 99% KY014297.1
18604 18604 100% 0.0 99% KX520666.1
18604 18604 100% 0.0 99% KU729217.2
18604 18604 100% 0.0 99% KU527068.1
18600 18600 100% 0.0 99% KY014327.1
18598 18598 100% 0.0 99% KU820897.5
18598 18598 100% 0.0 99% KX247632.1
18598 18598 100% 0.0 99% KU937936.1
18598 18598 100% 0.0 99% KX156775.1
18598 18598 100% 0.0 99% KX087102.1
18598 18598 100% 0.0 99% KU365778.1
18598 18598 100% 0.0 99% KU312312.1
18593 18593 100% 0.0 99% KY014315.1
18593 18593 100% 0.0 99% KY014304.1
18593 18593 100% 0.0 99% KU922960.1
18587 18587 100% 0.0 99% KY014296.1
18587 18587 100% 0.0 99% KX856011.1
18587 18587 100% 0.0 99% KX548902.1
18587 18587 100% 0.0 99% KX446951.1
18587 18587 100% 0.0 99% KU926310.1
18587 18587 100% 0.0 99% KU922923.1
18587 18587 100% 0.0 99% KU501215.1
18582 18582 100% 0.0 99% KX601168.1
18582 18582 100% 0.0 99% KX446950.1
18582 18582 100% 0.0 99% KX087101.2
18582 18582 100% 0.0 99% KU870645.1
18580 18580 100% 0.0 99% KX893855.1
18576 18576 100% 0.0 99% KX702400.1
18576 18576 100% 0.0 99% KX377337.1
18576 18576 100% 0.0 99% KU853013.1
18574 18574 100% 0.0 99% KU853012.1
18571 18571 100% 0.0 99% KY014300.1
18571 18571 100% 0.0 99% LC190723.1
18565 18565 100% 0.0 99% KY014321.1
18565 18565 100% 0.0 99% KU820898.1
18559 18559 100% 0.0 99% KY014295.1
18559 18559 100% 0.0 99% KX842449.2
18559 18559 100% 0.0 99% KX056898.1
18559 18559 100% 0.0 99% KU955590.1
18556 18556 100% 0.0 99% KX766028.1
18554 18554 100% 0.0 99% KX766029.1
18554 18554 100% 0.0 99% KU740184.2
18554 18554 100% 0.0 99% KU761564.1
18552 18552 100% 0.0 99% KY014320.1
18548 18548 100% 0.0 99% KX922707.1
18548 18548 100% 0.0 99% KX673530.1
18543 18543 100% 0.0 99% KY014323.1