Jump to content
Sign in to follow this  
Followers 0
niman

H7N2 Spread To Chester County Pennsylvania Shelter Cats

14 posts in this topic

Veterinarians at Pennsylvania’s Department of Agriculture have confirmed that almost a dozen cats that may have been exposed to an avian-type influenza virus in New York City shelters have been placed in special quarantine in one of three animal shelters in Chester County.

http://www.media.pa.gov/pages/Agriculture_details.aspx?newsid=506

Edited by niman

Share this post


Link to post
Share on other sites

12/23/2016

PA Agriculture Department Tests, Monitors Cats Possibly Exposed to Influenza in NYC Shelters

 

State Veterinarian Recommends Hand-Washing Following Exposure to Quarantined Cats

Harrisburg, PA - Veterinarians at Pennsylvania’s Department of Agriculture have confirmed that almost a dozen cats that may have been exposed to an avian-type influenza virus in New York City shelters have been placed in special quarantine in one of three animal shelters in Chester County.

The low-pathogenic influenza virus does not pose a health hazard to people, according to the Pennsylvania Department of Health, however, health officials reminded citizens to wash their hands thoroughly and exercise precautions recommended during flu season--especially for those people who may have come into contact with the quarantined cats that originated from the New York shelters or were exposed to cats from these shelters.

The Agriculture department is involved because the North American H7N2 virus has been sequenced and is reportedly identical to the virus found in turkeys and chickens in Pennsylvania and Virginia during the 2002-2003 winter season.

“The cats we're testing and monitoring were transferred last month from an animal shelter in New York before some of the cats developed symptoms similar to a head cold or mild case of the flu. The cats have a low-pathogenic variety of the avian influenza virus,” explained State Veterinarian Dr. David Wolfgang. “Fortunately, we have no indication that any poultry flocks have been exposed to an infected cat.”

There have been no reports of infected cats spreading the virus to other species, nor has the department received any information to suggest that the virus is causing any human illness, even among people in close contact with the cats.

The sick cats are being treated and are expected to recover fully. In the meanwhile, the Agriculture department has placed quarantines on three shelters in Chester County and has recommended that cat adoptions from those shelters should be postponed until further notice.

The Agriculture department is working with the three shelters to obtain records of any cats leaving these shelters since mid-November, when the affected cats were diagnosed. Representatives from the Agriculture department will contact anyone who has adopted or fostered cats from these shelters.

“During our outreach to those who have adopted or fostered any cats from these shelters, we ask whether they have backyard poultry or contact with commercial poultry flocks. If so, we will follow our normal avian influenza protocols, which involves treating the poultry as potentially exposed to avian influenza,” Wolfgang explained. “We would quarantine the poultry and test samples at least 14 days after the cat(s) arrived in the home.”

For the latest information on avian influenza, visit The Department of Agriculture’s Animal Health and Diagnostic Services page at AHDServices.http://www.agriculture.pa.gov/Protect/AHDServices/avian_influenza/Pages/default.aspx">AHDServices.>

MEDIA CONTACT: Bonnie McCann - 717-783-0133

Share this post


Link to post
Share on other sites
LOCUS       CY014896                1707 bp    cRNA    linear   VRL 21-SEP-2006
DEFINITION  Influenza A virus (A/chicken/Pennsylvania/143586/2002(H7N2))
            segment 4, complete sequence.
ACCESSION   CY014896
VERSION     CY014896.1
KEYWORDS    .
SOURCE      Influenza A virus (A/chicken/Pennsylvania/143586/2002(H7N2))
  ORGANISM  Influenza A virus (A/chicken/Pennsylvania/143586/2002(H7N2))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1707)
  AUTHORS   Obenauer,J.C., Denson,J., Mehta,P.K., Su,X., Mukatira,S.,
            Finkelstein,D.B., Xu,X., Wang,J., Ma,J., Fan,Y., Rakestraw,K.M.,
            Webster,R.G., Hoffmann,E., Krauss,S., Zheng,J., Zhang,Z. and
            Naeve,C.W.
  TITLE     Large-scale sequence analysis of avian influenza isolates
  JOURNAL   Science 311 (5767), 1576-1580 (2006)
   PUBMED   16439620
REFERENCE   2  (bases 1 to 1707)
  AUTHORS   Obenauer,J.C., Denson,J., Mehta,P.K., Su,X., Mukatira,S.,
            Finkelstein,D.B., Xu,X., Wang,J., Ma,J., Fan,Y., Rakestraw,K.M.,
            Webster,R.G., Hoffmann,E., Krauss,S., Zheng,J., Zhang,Z. and
            Naeve,C.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2006) Hartwell Center for Bioinformatics &
            Biotechnology, St. Jude Children's Research Hospital, 332 North
            Lauderdale Str., Memphis, TN 38105, USA
FEATURES             Location/Qualifiers
     source          1..1707
                     /organism="Influenza A virus
                     (A/chicken/Pennsylvania/143586/2002(H7N2))"
                     /mol_type="viral cRNA"
                     /strain="A/chicken/Pennsylvania/143586/2002"
                     /serotype="H7N2"
                     /host="Avian"
                     /db_xref="taxon:342184"
                     /segment="4"
                     /country="USA: Pennsylvania"
                     /collection_date="2002"
     primer_bind     1..19
                     /note="PCR amplification primer sequence"
     gene            22..1680
                     /gene="HA"
     CDS             22..1680
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="ABI84849.1"
                     /translation="MNIQILAFIACVLTGAKGDKICLGHHAVANGTKVNTLTERGIEV
                     VNATETVETANIKKICTQGKRPTDLGQCGLLGTLIGPPQCDQFLEFSSDLIIERREGT
                     DVCYPGKFTNEESLRQILRRSGGIGKESMGFTYSGIRTNGATSACTRSGSSFYAEMKW
                     LLSNSDNAAFPQMTKAYRNPRNKPALIIWGVHHSESVSEQTKLYGSGNKLITVRSSKY
                     QQSFTPSPGARRIDFHWLLLDPNDTVTFTFNGAFIAPDRASFFRGESLGVQSDAPLDS
                     SCRGDCFHSGGTIVSSLPFQNINSRTVGKCPRYVKQKSLLLATGMRNVPEKPKPRGLF
                     GAIAGFIENGWEGLINGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLNRLIGKTNQ
                     QFELIDNEFNEIEQQIGNVINWTRDAMTEIWSYNAELLVAMENQHTIDLADSEMSKLY
                     ERVKKQLRENAEEDGTGCFEIFHKCDDQCMESIRNNTYDHTQYRTESLQNRIQIDPVK
                     LSSGYKDIILWFSFGASCFLLLAIAMGLVFICIKNGNMQCTICI"
     sig_peptide     22..75
                     /gene="HA"
     mat_peptide     76..1014
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1015..1677
                     /gene="HA"
                     /product="HA2"
     primer_bind     complement(1688..1707)
                     /note="PCR amplification primer sequence"
ORIGIN      
        1 agcaaaagca ggggatacaa aatgaacatt caaattctgg cattcattgc ttgtgtgctg
       61 actggagcta aaggagacaa aatatgtctt gggcaccatg ctgtggcaaa tggaacaaaa
      121 gtgaacacat taacagagag ggggattgaa gtagtgaatg ccacagagac agtggaaact
      181 gcgaatatca agaaaatatg tacccagggg aaaaggccaa cagatctggg acaatgtgga
      241 cttctaggaa ccctaatagg acctccccaa tgtgatcaat tcctggagtt ttcctctgat
      301 ttgataattg agcgaagaga aggaaccgat gtatgctatc ccggtaaatt cacaaatgaa
      361 gaatcactga ggcagatcct tcgaagatca ggaggaattg gtaaggagtc aatgggcttc
      421 acctatagtg gaataagaac caatggagcg acaagtgcct gcacaagatc aggttcttct
      481 ttctatgcag agatgaagtg gttgctgtcg aattcagata atgcagcatt cccacagatg
      541 acaaaggcgt atagaaatcc cagaaacaaa ccagctctga taatttgggg agttcatcac
      601 tctgaatcgg ttagcgagca gaccaaactc tatggaagcg gaaacaagtt gataacagta
      661 agaagctcaa aataccagca atcattcacc ccaagtccgg gagcacggag aatcgatttt
      721 cactggctac tccttgatcc caatgacaca gtgaccttca ctttcaatgg ggcattcata
      781 gcccctgaca gggcaagttt ctttagggga gaatcactag gagtccagag tgatgctcct
      841 ttggattcta gttgtagagg ggattgcttt cacagtgggg gtacgatagt cagttccctg
      901 ccattccaaa acatcaactc tagaactgtg gggaaatgcc ctcggtatgt caaacagaaa
      961 agcctccttc tggctacagg aatgagaaat gttccagaga aaccaaagcc cagaggcctt
     1021 tttggagcaa ttgctggatt catagagaat ggatgggagg gtctcatcaa tggatggtat
     1081 ggtttcagac atcaaaatgc acaaggagag ggaactgcag ctgactacaa aagcacccag
     1141 tctgcaatag atcagatcac aggcaaattg aatcgtttaa ttggcaaaac aaatcagcag
     1201 tttgagctga tagacaatga gttcaatgag atagaacaac aaataggaaa tgtcattaat
     1261 tggacacgag acgcaatgac tgagatatgg tcgtataatg ctgagctgtt ggtggcaatg
     1321 gaaaatcagc atacaataga tcttgcggac tcagaaatga gcaaacttta tgagcgtgtc
     1381 aaaaaacaac taagggagaa tgctgaagaa gatggaactg gatgttttga gatatttcat
     1441 aagtgtgatg atcagtgtat ggagagcata aggaacaaca cgtatgacca tacccaatac
     1501 agaacagagt cattgcagaa tagaatacag atagacccag tgaaattgag tagtggatac
     1561 aaagacataa tcttatggtt tagcttcggg gcatcatgtt ttcttcttct agccattgca
     1621 atgggattgg ttttcatttg cataaagaat ggaaacatgc agtgcactat ttgtatatag
     1681 tttgagaaaa acacccttgt ttctact

Share this post


Link to post
Share on other sites
Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI42777 A/chicken/Pennsylvania/143586/2002 (A/H7N2) segment 4 (HA) 3064.7 0.000000e+00 1659/1659 (100%)
text_code_colored.png EPI159070 A/turkey/VA/158512/2002 (A/H7N2) segment 4 (HA) 3048.1 0.000000e+00 1656/1659 (99%)
text_code_colored.png EPI159046 A/unknown/NY/ 117932-11/2001 (A/H7N2) segment 4 (HA) 3042.6 0.000000e+00 1655/1659 (99%)
text_code_colored.png EPI18007 A/turkey/VA/55/02 (A/H7N2) segment 4 (HA) 3042.6 0.000000e+00 1655/1659 (99%)
text_code_colored.png EPI17981 A/chicken/PA/143586/01 (A/H7N2) segment 4 (HA) 3042.6 0.000000e+00 1649/1650 (99%)
text_code_colored.png EPI17947 A/avian/NY/7729-6/00 (A/H7N2) segment 4 (HA) 3037.0 0.000000e+00 1654/1659 (99%)
text_code_colored.png EPI290480 A/chicken/NY/119055-7/2001 (A/H7N2) segment 4 (HA) 3031.5 0.000000e+00 1653/1659 (99%)
text_code_colored.png EPI236435 A/Turkey/NC/11165/02_ (A/H7N2) segment 4 (HA) 3031.5 0.000000e+00 1653/1659 (99%)
text_code_colored.png EPI18009 A/turkey/VA/66/02 (A/H7N2) segment 4 (HA) 3031.5 0.000000e+00 1653/1659 (99%)
text_code_colored.png EPI17963 A/chicken/NY/119055-7/01 (A/H7N2) segment 4 (HA) 3031.5 0.000000e+00 1653/1659 (99%)
text_code_colored.png EPI17995 A/chicken/VA/32/02 (A/H7N2) segment 4 (HA) 3025.9 0.000000e+00 1652/1659 (99%)
text_code_colored.png EPI168842 A/chicken/New York/Sg-00386/2001 (A/H7N2) segment 4 (HA) 3020.4 0.000000e+00 1643/1647 (99%)
text_code_colored.png EPI235145 A/environment/NY/241365-18/2003 (A/H7N2) segment 4 (HA) 3014.9 0.000000e+00 1650/1659 (99%)
text_code_colored.png EPI168822 A/chicken/New York/Sg-00381/2001 (A/H7N2) segment 4 (HA) 3014.9 0.000000e+00 1642/1647 (99%)
text_code_colored.png EPI168783 A/avian/New York/Sg-00371/2001 (A/H7N2) segment 4 (HA) 3014.9 0.000000e+00 1642/1647 (99%)
text_code_colored.png EPI18011 A/turkey/VA/67/02 (A/H7N2) segment 4 (HA) 3014.9 0.000000e+00 1650/1659 (99%)
text_code_colored.png EPI17959 A/chicken/NJ/608/02 (A/H7N2) segment 4 (HA) 3014.9 0.000000e+00 1650/1659 (99%)
text_code_colored.png EPI168870 A/environment/New Jersey/Sg-00393/2002 (A/H7N2) segment 4 (HA) 3009.3 0.000000e+00 1641/1647 (99%)
text_code_colored.png EPI168755 A/avian/New York/Sg-00363/2001 (A/H7N2) segment 4 (HA) 3007.5 0.000000e+00 1638/1643 (99%)
text_code_colored.png EPI168799 A/avian/New York/Sg-00375/2001 (A/H7N2) segment 4 (HA) 3003.8 0.000000e+00 1634/1638 (99%)
text_code_colored.png EPI168779 A/avian/New York/Sg-00370/2001 (A/H7N2) segment 4 (HA) 3003.8 0.000000e+00 1638/1644 (99%)
text_code_colored.png EPI168896 A/avian/New York/Sg-00400/2003 (A/H7N2) segment 4 (HA) 3000.1 0.000000e+00 1639/1647 (99%)
text_code_colored.png EPI168862 A/guinea fowl/New Jersey/Sg-00391/2002 (A/H7N2) segment 4 (HA) 3000.1 0.000000e+00 1638/1645 (99%)
text_code_colored.png EPI168920 A/avian/New York/Sg-00406/2003 (A/H7N2) segment 4 (HA) 2994.5 0.000000e+00 1635/1642 (99%)
text_code_colored.png EPI168952 A/avian/New York/Sg-00414/2003 (A/H7N2) segment 4 (HA) 2992.7 0.000000e+00 1638/1647 (99%)
text_code_colored.png EPI168948 A/avian/New York/Sg-00413/2003 (A/H7N2) segment 4 (HA) 2992.7 0.000000e+00 1638/1647 (99%)
text_code_colored.png EPI168900 A/avian/New York/Sg-00401/2003 (A/H7N2) segment 4 (HA) 2992.7 0.000000e+00 1638/1647 (99%)
text_code_colored.png EPI168908 A/avian/New York/Sg-00403/2003 (A/H7N2) segment 4 (HA) 2990.8 0.000000e+00 1636/1644 (99%)
text_code_colored.png EPI168904 A/avian/New York/Sg-00402/2003 (A/H7N2) segment 4 (HA) 2989.0 0.000000e+00 1634/1642 (99%)
text_code_colored.png EPI168866 A/chicken/New Jersey/Sg-00392/2002 (A/H7N2) segment 4 (HA) 2989.0 0.000000e+00 1636/1645 (99%)
text_code_colored.png EPI235153 A/environmental/NY/268925-10/2003 (A/H7N2) segment 4 (HA) 2987.2 0.000000e+00 1645/1659 (99%)
text_code_colored.png EPI168944 A/avian/New York/Sg-00412/2003 (A/H7N2) segment 4 (HA) 2983.5 0.000000e+00 1633/1642 (99%)
text_code_colored.png EPI168928 A/avian/New York/Sg-00408/2003 (A/H7N2) segment 4 (HA) 2983.5 0.000000e+00 1633/1642 (99%)
text_code_colored.png EPI168892 A/avian/New York/Sg-00399/2003 (A/H7N2) segment 4 (HA) 2981.6 0.000000e+00 1634/1644 (99%)
text_code_colored.png EPI158444 A/Chicken/NJ/16224-6/99 (A/H7N2) segment 4 (HA) 2981.6 0.000000e+00 1644/1659 (99%)
text_code_colored.png EPI168960 A/chicken/New York/Sg-00416/2003 (A/H7N2) segment 4 (HA) 2976.1 0.000000e+00 1635/1647 (99%)
text_code_colored.png EPI168956 A/avian/New York/Sg-00415/2003 (A/H7N2) segment 4 (HA) 2976.1 0.000000e+00 1635/1647 (99%)
text_code_colored.png EPI17997 A/Chicken/NY/14858-12/99 (A/H7N2) segment 4 (HA) 2976.1 0.000000e+00 1643/1659 (99%)
text_code_colored.png EPI168940 A/avian/New York/Sg-00411/2003 (A/H7N2) segment 4 (HA) 2974.2 0.000000e+00 1630/1642 (99%)
text_code_colored.png EPI168912 A/avian/New York/Sg-00404/2003 (A/H7N2) segment 4 (HA) 2974.2 0.000000e+00 1631/1642 (99%)
text_code_colored.png EPI168924 A/avian/New York/Sg-00407/2003 (A/H7N2) segment 4 (HA) 2972.4 0.000000e+00 1631/1642 (99%)
text_code_colored.png EPI168916 A/avian/New York/Sg-00405/2003 (A/H7N2) segment 4 (HA) 2970.5 0.000000e+00 1630/1641 (99%)
text_code_colored.png EPI18015 A/Chicken/New Jersey/20621/99 (A/H7N2) segment 4 (HA) 2970.5 0.000000e+00 1643/1660 (98%)
text_code_colored.png EPI17973 A/chicken/NY/21586-8/99 (A/H7N2) segment 4 (HA) 2970.5 0.000000e+00 1642/1659 (98%)
text_code_colored.png EPI17957 A/chicken/NJ/15814-9/99 (A/H7N2) segment 4 (HA) 2970.5 0.000000e+00 1642/1659 (98%)
text_code_colored.png EPI159014 A/environment/NY/260422-10/2003 (A/H7N2) segment 4 (HA) 2965.0 0.000000e+00 1641/1659 (98%)
text_code_colored.png EPI168971 A/avian/New York/Sg-00419/2003 (A/H7N2) segment 4 (HA) 2963.1 0.000000e+00 1632/1646 (99%)
text_code_colored.png EPI168964 A/avian/New York/Sg-00417/2003 (A/H7N2) segment 4 (HA) 2959.5 0.000000e+00 1633/1648 (99%)
text_code_colored.png EPI166558 A/chicken/New Jersey/Sg-00334/1999 (A/H7N2) segment 4 (HA) 2950.2 0.000000e+00 1627/1642 (99%)
text_code_colored.png EPI159006 A/chicken/CT/260413-2/2003 (A/H7N2) segment 4 (HA) 2948.4 0.000000e+00 1638/1659 (98%)
text_code_colored.png EPI141612 A/New York/107/2003 (A/H7N2) segment 4 (HA) 2948.4 0.000000e+00 1638/1659 (98%)
text_code_colored.png EPI168936 A/avian/New York/Sg-00410/2003 (A/H7N2) segment 4 (HA) 2944.7 0.000000e+00 1626/1642 (99%)
text_code_colored.png EPI17943 A/avian/NY/76247-3/00 (A/H7N2) segment 4 (HA) 2942.8 0.000000e+00 1637/1659 (98%)
text_code_colored.png EPI18019 A/chicken/NJ/15827/99 (A/H7N2) segment 4 (HA) 2941.0 0.000000e+00 1637/1659 (98%)
text_code_colored.png EPI168719 A/avian/New York/Sg-00353/2000 (A/H7N2) segment 4 (HA) 2939.1 0.000000e+00 1629/1648 (98%)
text_code_colored.png EPI159038 A/unknown/NY/120485-5/2001 (A/H7N2) segment 4 (HA) 2937.3 0.000000e+00 1636/1659 (98%)
text_code_colored.png EPI17939 A/avian/NY/70411-12/00 (A/H7N2) segment 4 (HA) 2937.3 0.000000e+00 1636/1659 (98%)
text_code_colored.png EPI166566 A/chicken/New Jersey/Sg-00336/1999 (A/H7N2) segment 4 (HA) 2935.4 0.000000e+00 1619/1634 (99%)
text_code_colored.png EPI168715 A/chicken/New York/Sg-00352/2000 (A/H7N2) segment 4 (HA) 2933.6 0.000000e+00 1628/1648 (98%)
text_code_colored.png EPI168727 A/avian/New York/Sg-00355/2000 (A/H7N2) segment 4 (HA) 2931.8 0.000000e+00 1627/1647 (98%)
text_code_colored.png EPI160761 A/environment/New York/23165-5/2005 (A/H7N2) segment 4 (HA) 2931.8 0.000000e+00 1635/1659 (98%)
text_code_colored.png EPI156561 A/chicken/New York/30732-11/2005 (A/H7N2) segment 4 (HA) 2931.8 0.000000e+00 1635/1659 (98%)
text_code_colored.png EPI156553 A/chicken/New York/30732-10/2005 (A/H7N2) segment 4 (HA) 2931.8 0.000000e+00 1635/1659 (98%)
text_code_colored.png EPI156545 A/chicken/New York/30732-9/2005 (A/H7N2) segment 4 (HA) 2931.8 0.000000e+00 1635/1659 (98%)
text_code_colored.png EPI141468 A/environment/New York/30732-4/2005 (A/H7N2) segment 4 (HA) 2931.8 0.000000e+00 1635/1659 (98%)
text_code_colored.png EPI141436 A/chicken/New York/23165-6/2005 (A/H7N2) segment 4 (HA) 2931.8 0.000000e+00 1635/1659 (98%)
text_code_colored.png EPI166551 A/avian/New York/Sg-00331/1999 (A/H7N2) segment 4 (HA) 2929.9 0.000000e+00 1618/1634 (99%)
text_code_colored.png EPI168739 A/avian/New York/Sg-00358/2001 (A/H7N2) segment 4 (HA) 2928.1 0.000000e+00 1627/1648 (98%)
text_code_colored.png EPI171061 A/environment/New York/30732-1/2005 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1634/1659 (98%)
text_code_colored.png EPI168707 A/avian/New York/Sg-00350/2000 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1624/1644 (98%)
text_code_colored.png EPI166615 A/avian/New York/Sg-00349/2000 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1622/1641 (98%)
text_code_colored.png EPI166588 A/quail/New Jersey/Sg-00342/2000 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1616/1632 (99%)
text_code_colored.png EPI166555 A/chicken/New Jersey/Sg-00333/1999 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1616/1632 (99%)
text_code_colored.png EPI166540 A/avian/New York/Sg-00328/1999 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1616/1632 (99%)
text_code_colored.png EPI156569 A/muscovy duck/New York/30732-13/2005 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1634/1659 (98%)
text_code_colored.png EPI156537 A/chicken/New York/30732-8/2005 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1634/1659 (98%)
text_code_colored.png EPI156521 A/environment/New York/23165-1/2005 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1634/1659 (98%)
text_code_colored.png EPI152953 A/quail/New York/30732-12/2005 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1634/1659 (98%)
text_code_colored.png EPI141484 A/turkey/New York/30732-7/2005 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1634/1659 (98%)
text_code_colored.png EPI141476 A/chicken/New York/30732-6/2005 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1634/1659 (98%)
text_code_colored.png EPI141460 A/environment/New York/30732-3/2005 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1634/1659 (98%)
text_code_colored.png EPI141452 A/environment/New York/30732-2/2005 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1634/1659 (98%)
text_code_colored.png EPI18023 A/chicken/NY/34173-3/99 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1634/1659 (98%)
text_code_colored.png EPI17975 A/chicken/NY/22409-4/99 (A/H7N2) segment 4 (HA) 2926.2 0.000000e+00 1634/1659 (98%)
text_code_colored.png EPI168735 A/avian/New York/Sg-00357/2001 (A/H7N2) segment 4 (HA) 2924.4 0.000000e+00 1617/1634 (98%)
text_code_colored.png EPI166562 A/duck/New Jersey/Sg-00335/1999 (A/H7N2) segment 4 (HA) 2924.4 0.000000e+00 1617/1634 (98%)
text_code_colored.png EPI168932 A/avian/New York/Sg-00409/2003 (A/H7N2) segment 4 (HA) 2922.5 0.000000e+00 1623/1643 (98%)
text_code_colored.png EPI228453 A/chicken/DE/VIVA/2004 (A/H7N2) segment 4 (HA) 2920.7 0.000000e+00 1633/1659 (98%)
text_code_colored.png EPI168979 A/chicken/New Jersey/Sg-00421/2004 (A/H7N2) segment 4 (HA) 2920.7 0.000000e+00 1625/1647 (98%)
text_code_colored.png EPI168711 A/avian/New York/Sg-00351/2000 (A/H7N2) segment 4 (HA) 2920.7 0.000000e+00 1623/1644 (98%)
text_code_colored.png EPI160769 A/chicken/New York/23165-10/2005 (A/H7N2) segment 4 (HA) 2920.7 0.000000e+00 1633/1659 (98%)
text_code_colored.png EPI141596 A/environment/New York/23165-4/2005 (A/H7N2) segment 4 (HA) 2920.7 0.000000e+00 1633/1659 (98%)
text_code_colored.png EPI17945 A/avian/NY/81746-5/00 (A/H7N2) segment 4 (HA) 2920.7 0.000000e+00 1633/1659 (98%)
text_code_colored.png EPI166570 A/avian/New York/Sg-00337/1999 (A/H7N2) segment 4 (HA) 2918.8 0.000000e+00 1616/1634 (98%)
text_code_colored.png EPI168751 A/avian/New York/Sg-00362/2001 (A/H7N2) segment 4 (HA) 2917.0 0.000000e+00 1623/1645 (98%)
text_code_colored.png EPI168723 A/avian/New York/Sg-00354/2000 (A/H7N2) segment 4 (HA) 2917.0 0.000000e+00 1623/1645 (98%)
text_code_colored.png EPI141604 A/chicken/New York/23165-7/2005 (A/H7N2) segment 4 (HA) 2917.0 0.000000e+00 1633/1660 (98%)
text_code_colored.png EPI228452 A/chicken/DE/HOBO/2004 (A/H7N2) segment 4 (HA) 2915.1 0.000000e+00 1633/1660 (98%)
text_code_colored.png EPI177151 A/unknown/New York/11646-9/2005 (A/H7N2) segment 4 (HA) 2915.1 0.000000e+00 1633/1660 (98%)
text_code_colored.png EPI177135 A/chicken/New York/23165-9/2005 (A/H7N2) segment 4 (HA) 2915.1 0.000000e+00 1632/1659 (98%)

Share this post


Link to post
Share on other sites
Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI42779 A/chicken/Pennsylvania/143586/2002 (A/H7N2) segment 6 (NA) 2545.8 0.000000e+00 1378/1378 (100%)
text_code_colored.png EPI18327 A/chicken/PA/143586/01 (A/H7N2) segment 6 (NA) 2545.8 0.000000e+00 1378/1378 (100%)
text_code_colored.png EPI236438 A/Turkey/NC/11165/O2 (A/H7N2) segment 6 (NA) 2529.2 0.000000e+00 1375/1378 (99%)
text_code_colored.png EPI18365 A/Turkey/VA/158512/02 (A/H7N2) segment 6 (NA) 2529.2 0.000000e+00 1375/1378 (99%)
text_code_colored.png EPI18339 A/chicken/VA/32/02 (A/H7N2) segment 6 (NA) 2523.6 0.000000e+00 1374/1378 (99%)
text_code_colored.png EPI18363 A/turkey/VA/67/02 (A/H7N2) segment 6 (NA) 2518.1 0.000000e+00 1373/1378 (99%)
text_code_colored.png EPI18359 A/turkey/VA/55/02 (A/H7N2) segment 6 (NA) 2518.1 0.000000e+00 1373/1378 (99%)
text_code_colored.png EPI234181 A/avian/New York/Sg-00396/2002 (A/H7N2) segment 6 (NA) 2499.6 0.000000e+00 1357/1359 (99%)
text_code_colored.png EPI159012 A/environment/NY/260422-10/2003 (A/H7N2) segment 6 (NA) 2495.9 0.000000e+00 1369/1378 (99%)
text_code_colored.png EPI234183 A/avian/New York/Sg-00398/2002 (A/H7N2) segment 6 (NA) 2490.4 0.000000e+00 1352/1354 (99%)
text_code_colored.png EPI235147 A/environment/NY/241365-18/2003 (A/H7N2) segment 6 (NA) 2484.9 0.000000e+00 1367/1378 (99%)
text_code_colored.png EPI159036 A/unknown/NY/120485-5/2001 (A/H7N2) segment 6 (NA) 2484.9 0.000000e+00 1367/1378 (99%)
text_code_colored.png EPI159004 A/chicken/CT/260413-2/2003 (A/H7N2) segment 6 (NA) 2484.9 0.000000e+00 1367/1378 (99%)
text_code_colored.png EPI18361 A/turkey/VA/66/02 (A/H7N2) segment 6 (NA) 2484.9 0.000000e+00 1367/1378 (99%)
text_code_colored.png EPI234182 A/avian/New York/Sg-00397/2002 (A/H7N2) segment 6 (NA) 2483.0 0.000000e+00 1350/1353 (99%)
text_code_colored.png EPI177161 A/unknown/New York/13479-4/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI167392 A/unknown/New York/13479-2/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI167384 A/unknown/New York/13479-1/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI164980 A/environment/New York/26792-3/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI164948 A/unknown/New York/13479-5/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI164940 A/unknown/New York/13479-3/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI160787 A/environment/New York/26792-1/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI156595 A/environment/New York/37982-2/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI152979 A/environment/New York/37982-1/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI141582 A/guinea fowl/New York/10196-7/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI141566 A/environment/New York/10196-2/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI63700 A/duck/New York/21211-6/2005 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI18281 A/avian/NY/81746-5/00 (A/H7N2) segment 6 (NA) 2479.3 0.000000e+00 1366/1378 (99%)
text_code_colored.png EPI68375 A/chicken/New York/21211-1/2005 (A/H7N2) segment 6 (NA) 2477.5 0.000000e+00 1365/1377 (99%)
text_code_colored.png EPI63681 A/chicken/New York/21211-2/2005 (A/H7N2) segment 6 (NA) 2477.5 0.000000e+00 1365/1377 (99%)
text_code_colored.png EPI152995 A/chicken/New York/42217/2005 (A/H7N2) segment 6 (NA) 2475.6 0.000000e+00 1365/1378 (99%)
text_code_colored.png EPI164844 A/environment/New York/26792-4/2005 (A/H7N2) segment 6 (NA) 2473.8 0.000000e+00 1365/1378 (99%)
text_code_colored.png EPI160795 A/environment/New York/26792-2/2005 (A/H7N2) segment 6 (NA) 2473.8 0.000000e+00 1365/1378 (99%)
text_code_colored.png EPI160723 A/environment/New York/10196-3/2005 (A/H7N2) segment 6 (NA) 2473.8 0.000000e+00 1365/1378 (99%)
text_code_colored.png EPI152987 A/guinea fowl/New York/37982-3/2005 (A/H7N2) segment 6 (NA) 2473.8 0.000000e+00 1365/1378 (99%)
text_code_colored.png EPI68394 A/chukar/New York/21211-7/2005 (A/H7N2) segment 6 (NA) 2473.8 0.000000e+00 1365/1378 (99%)
text_code_colored.png EPI18285 A/chicken/NJ/118878-5/01 (A/H7N2) segment 6 (NA) 2473.8 0.000000e+00 1365/1378 (99%)
text_code_colored.png EPI156603 A/chicken/New York/37982-4/2005 (A/H7N2) segment 6 (NA) 2470.1 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI327489 A/chicken/New York/79672/2005 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI235155 A/environmental/NY/268925-10/2003 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI234194 A/avian/New York/Sg-00409/2003 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1346/1351 (99%)
text_code_colored.png EPI164892 A/Guinea fowl/New York/101276-1/2005 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI160739 A/chicken/New York/10196-5/2005 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI160731 A/chicken/New York/10196-4/2005 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI159028 A/guinea fowl/NJ/119063-8/2001 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI158842 A/chicken/NJ/294508-12/2004 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI141616 A/New York/107/2003 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI141574 A/chicken/New York/10196-6/2005 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI141558 A/environment/New York/10196-1/2005 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI18341 A/guineafowl/MA/148081/02 (A/H7N2) segment 6 (NA) 2468.2 0.000000e+00 1364/1378 (98%)
text_code_colored.png EPI234188 A/avian/New York/Sg-00403/2003 (A/H7N2) segment 6 (NA) 2466.4 0.000000e+00 1351/1359 (99%)
text_code_colored.png EPI172277 A/Guinea fowl/New York/98616-3/2005 (A/H7N2) segment 6 (NA) 2464.6 0.000000e+00 1362/1376 (98%)
text_code_colored.png EPI18305 A/Chicken/NY/14858-12/99 (A/H7N2) segment 6 (NA) 2462.7 0.000000e+00 1363/1378 (98%)
text_code_colored.png EPI18283 A/Chicken/NJ/118555-2/01 (A/H7N2) segment 6 (NA) 2462.7 0.000000e+00 1363/1378 (98%)
text_code_colored.png EPI18277 A/avian/NY/118353-1/2001 (A/H7N2) segment 6 (NA) 2462.7 0.000000e+00 1363/1378 (98%)
text_code_colored.png EPI227584 A/unknown/New York/98616-6/2006 (A/H7N2) segment 6 (NA) 2459.0 0.000000e+00 1361/1376 (98%)
text_code_colored.png EPI234205 A/avian/New York/Sg-00420/2003 (A/H7N2) segment 6 (NA) 2457.2 0.000000e+00 1344/1351 (99%)
text_code_colored.png EPI234184 A/avian/New York/Sg-00399/2003 (A/H7N2) segment 6 (NA) 2457.2 0.000000e+00 1344/1351 (99%)
text_code_colored.png EPI234138 A/avian/New York/Sg-00353/2000 (A/H7N2) segment 6 (NA) 2457.2 0.000000e+00 1344/1351 (99%)
text_code_colored.png EPI152867 A/chicken/New York/22067-12/2005 (A/H7N2) segment 6 (NA) 2457.2 0.000000e+00 1362/1378 (98%)
text_code_colored.png EPI152859 A/chicken/New York/22067-7/2005 (A/H7N2) segment 6 (NA) 2457.2 0.000000e+00 1362/1378 (98%)
text_code_colored.png EPI141414 A/environment/New York/22067-4/2005 (A/H7N2) segment 6 (NA) 2457.2 0.000000e+00 1362/1378 (98%)
text_code_colored.png EPI131830 A/environment/New York/22067-2/2005 (A/H7N2) segment 6 (NA) 2457.2 0.000000e+00 1362/1378 (98%)
text_code_colored.png EPI131811 A/environment/New York/22067-1/2005 (A/H7N2) segment 6 (NA) 2457.2 0.000000e+00 1362/1378 (98%)
text_code_colored.png EPI234185 A/avian/New York/Sg-00400/2003 (A/H7N2) segment 6 (NA) 2453.5 0.000000e+00 1344/1352 (99%)
text_code_colored.png EPI164876 A/duck/New York/98616-5/2005 (A/H7N2) segment 6 (NA) 2453.5 0.000000e+00 1360/1376 (98%)
text_code_colored.png EPI164868 A/duck/New York/98616-4/2005 (A/H7N2) segment 6 (NA) 2453.5 0.000000e+00 1360/1376 (98%)
text_code_colored.png EPI327539 A/environment/New York/641/2005 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI234200 A/avian/New York/Sg-00415/2003 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1343/1351 (99%)
text_code_colored.png EPI234199 A/avian/New York/Sg-00414/2003 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1343/1351 (99%)
text_code_colored.png EPI234193 A/avian/New York/Sg-00408/2003 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1343/1351 (99%)
text_code_colored.png EPI234190 A/avian/New York/Sg-00405/2003 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1343/1351 (99%)
text_code_colored.png EPI234186 A/avian/New York/Sg-00401/2003 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1343/1351 (99%)
text_code_colored.png EPI160755 A/duck/New York/22067-11/2005 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI160747 A/guinea fowl/New York/22067-10/2005 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI156515 A/chicken/New York/22067-9/2005 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI156507 A/chicken/New York/22067-8/2005 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI156499 A/environment/New York/22067-6/2005 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI141422 A/environment/New York/22067-5/2005 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI131773 A/chicken/New York/16326-4/2005 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI76972 A/environment/New York/16326-2/2005 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI68413 A/environment/New York/22067-3/2005 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI63624 A/environment/New York/16326-1/2005 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI18279 A/avian/NY/76247-3/00 (A/H7N2) segment 6 (NA) 2451.6 0.000000e+00 1361/1378 (98%)
text_code_colored.png EPI234170 A/avian/New York/Sg-00385/2001 (A/H7N2) segment 6 (NA) 2449.8 0.000000e+00 1348/1359 (99%)
text_code_colored.png EPI228455 A/chicken/DE/HOBO/2004 (A/H7N2) segment 6 (NA) 2449.8 0.000000e+00 1350/1362 (99%)
text_code_colored.png EPI160867 A/environment/New York/98616-2/2005 (A/H7N2) segment 6 (NA) 2447.9 0.000000e+00 1359/1376 (98%)
text_code_colored.png EPI327527 A/quail/New York/23164-12/2005 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1360/1378 (98%)
text_code_colored.png EPI234202 A/avian/New York/Sg-00417/2003 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1342/1351 (99%)
text_code_colored.png EPI234192 A/avian/New York/Sg-00407/2003 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1342/1351 (99%)
text_code_colored.png EPI234189 A/avian/New York/Sg-00404/2003 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1342/1351 (99%)
text_code_colored.png EPI234137 A/chicken/New York/Sg-00352/2000 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1342/1351 (99%)
text_code_colored.png EPI164932 A/unknown/New York/11675/2005 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1360/1378 (98%)
text_code_colored.png EPI152939 A/turkey/New York/23164-11/2005 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1360/1378 (98%)
text_code_colored.png EPI152915 A/chicken/New York/23164-7/2005 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1360/1378 (98%)
text_code_colored.png EPI152907 A/chicken/New York/23164-5/2005 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1360/1378 (98%)
text_code_colored.png EPI152891 A/environment/New York/23164-2/2005 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1360/1378 (98%)
text_code_colored.png EPI141606 A/chicken/New York/23165-7/2005 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1360/1378 (98%)
text_code_colored.png EPI141590 A/chicken/New York/23164-6/2005 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1360/1378 (98%)
text_code_colored.png EPI141438 A/chicken/New York/23165-6/2005 (A/H7N2) segment 6 (NA) 2446.1 0.000000e+00 1360/1378 (98%)

Share this post


Link to post
Share on other sites
Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI18095 A/chicken/PA/143586/01 (A/H7N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
text_code_colored.png EPI18140 A/turkey/VA/55/02 (A/H7N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
text_code_colored.png EPI236436 A/Turkey/NC/11165/02 (A/H7N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
text_code_colored.png EPI18137 A/Turkey/VA/158512/02 (A/H7N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI18143 A/turkey/VA/67/02 (A/H7N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI18122 A/guineafowl/MA/148081-11/02 (A/H7N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI159005 A/chicken/CT/260413-2/2003 (A/H7N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI18113 A/chicken/VA/32/02 (A/H7N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI235146 A/environment/NY/241365-18/2003 (A/H7N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI159013 A/environment/NY/260422-10/2003 (A/H7N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI63602 A/environment/New York/11678-4/2005 (A/H7N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
text_code_colored.png EPI63583 A/environment/New York/11678-3/2005 (A/H7N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
text_code_colored.png EPI327521 A/environment/New York/30732-5/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI227003 A/chicken/New York/11678-5/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI171062 A/environment/New York/30732-1/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI156570 A/muscovy duck/New York/30732-13/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI156562 A/chicken/New York/30732-11/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI156554 A/chicken/New York/30732-10/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI156546 A/chicken/New York/30732-9/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI156538 A/chicken/New York/30732-8/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI152954 A/quail/New York/30732-12/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI141485 A/turkey/New York/30732-7/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI141477 A/chicken/New York/30732-6/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI141469 A/environment/New York/30732-4/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI141461 A/environment/New York/30732-3/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI141453 A/environment/New York/30732-2/2005 (A/H7N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
text_code_colored.png EPI307276 A/chicken/MD/MinhMa/2004 (A/H7N2) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
text_code_colored.png EPI235154 A/environmental/NY/268925-10/2003 (A/H7N2) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
text_code_colored.png EPI63564 A/environment/New York/11678-2/2005 (A/H7N2) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
text_code_colored.png EPI63545 A/environment/New York/11678-1/2005 (A/H7N2) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
text_code_colored.png EPI164979 A/environment/New York/26792-3/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI164931 A/unknown/New York/11675/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI164843 A/environment/New York/26792-4/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI160858 A/quail/New York/89641/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI160794 A/environment/New York/26792-2/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI160786 A/environment/New York/26792-1/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI160754 A/duck/New York/22067-11/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI160746 A/guinea fowl/New York/22067-10/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI160722 A/environment/New York/10196-3/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI156514 A/chicken/New York/22067-9/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI156506 A/chicken/New York/22067-8/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI156498 A/environment/New York/22067-6/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI154164 A/New York/107/2003 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 970/983 (98%)
text_code_colored.png EPI152994 A/chicken/New York/42217/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI152858 A/chicken/New York/22067-7/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI141557 A/environment/New York/10196-1/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI141421 A/environment/New York/22067-5/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI141413 A/environment/New York/22067-4/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI131827 A/environment/New York/22067-2/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI131808 A/environment/New York/22067-1/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI68410 A/environment/New York/22067-3/2005 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI18056 A/Chicken/NJ/16224-6/99 (A/H7N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
text_code_colored.png EPI327535 A/chicken/New York/23164-4/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI327530 A/chicken/New York/23164-8/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI327517 A/environment/New York/31621-4/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI327512 A/chicken/New York/31621-6/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI327509 A/chicken/New York/31621-7/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI327479 A/environment/New York/98616-1/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI327476 A/unknown/New York/11646-7/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI227191 A/environment/New York/30720-1/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI177152 A/unknown/New York/11646-9/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI172284 A/unknown/New York/11646-8/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI172276 A/Guinea fowl/New York/98616-3/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI167391 A/unknown/New York/13479-2/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI167375 A/Guinea fowl/New York/11646-3/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI167367 A/chicken/New York/11646-2/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI167327 A/environment/New York/31621-1/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI164947 A/unknown/New York/13479-5/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI164939 A/unknown/New York/13479-3/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI164923 A/unknown/New York/11646-6/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI164907 A/Muscovy duck/New York/11646-4/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI164875 A/duck/New York/98616-5/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI160866 A/environment/New York/98616-2/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI160802 A/environment/New York/31621-5/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI158843 A/chicken/NJ/294508-12/2004 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI156602 A/chicken/New York/37982-4/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI156594 A/environment/New York/37982-2/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI156586 A/guinea fowl/New York/31621-8/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI152986 A/guinea fowl/New York/37982-3/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI152978 A/environment/New York/37982-1/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI152970 A/chicken/New York/31621-9/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI152962 A/environment/New York/31621-3/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI152938 A/turkey/New York/23164-11/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI152922 A/chicken/New York/23164-9/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI152914 A/chicken/New York/23164-7/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI152906 A/chicken/New York/23164-5/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI152890 A/environment/New York/23164-2/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI141589 A/chicken/New York/23164-6/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI141445 A/environment/New York/30720-3/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI141429 A/chukar/New York/23164-13/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI68372 A/chicken/New York/21211-1/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI63697 A/duck/New York/21211-6/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI63678 A/chicken/New York/21211-2/2005 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI18080 A/Chicken/NY/14858-12/99 (A/H7N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
text_code_colored.png EPI327528 A/quail/New York/23164-12/2005 (A/H7N2) segment 7 (MP) 1735.1 0.000000e+00 967/981 (98%)
text_code_colored.png EPI327503 A/environment/New York/63806-1/2005 (A/H7N2) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
text_code_colored.png EPI327493 A/chicken/New York/63806-7/2005 (A/H7N2) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
text_code_colored.png EPI327490 A/chicken/New York/79672/2005 (A/H7N2) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
text_code_colored.png EPI227583 A/unknown/New York/98616-6/2006 (A/H7N2) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
text_code_colored.png EPI177160 A/unknown/New York/13479-4/2005 (A/H7N2) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)

Share this post


Link to post
Share on other sites
Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI125544 A/chicken/PA/143586/01 (A/H7N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
text_code_colored.png EPI42786 A/chicken/Pennsylvania/143586/2002 (A/H7N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
text_code_colored.png EPI159047 A/unknown/NY/ 117932-11/2001 (A/H7N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
text_code_colored.png EPI168839 A/chicken/New York/Sg-00386/2001 (A/H7N2) segment 1 (PB2) 4181.9 0.000000e+00 2266/2267 (99%)
text_code_colored.png EPI235955 A/guinea hen/MA/14801-11/2002 (A/H7N2) segment 1 (PB2) 4178.2 0.000000e+00 2274/2280 (99%)
text_code_colored.png EPI168819 A/chicken/New York/Sg-00381/2001 (A/H7N2) segment 1 (PB2) 4178.2 0.000000e+00 2266/2268 (99%)
text_code_colored.png EPI159069 A/turkey/VA/158512/2002 (A/H7N2) segment 1 (PB2) 4172.7 0.000000e+00 2273/2280 (99%)
text_code_colored.png EPI168780 A/avian/New York/Sg-00371/2001 (A/H7N2) segment 1 (PB2) 4156.1 0.000000e+00 2258/2263 (99%)
text_code_colored.png EPI162360 A/turkey/VA/55/2002 (A/H7N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI168855 A/guinea fowl/Massachusetts/Sg-00390/2002 (A/H7N2) segment 1 (PB2) 4154.2 0.000000e+00 2261/2267 (99%)
text_code_colored.png EPI307294 A/turkey/VA/SEP-67/2002 (A/H7N2) segment 1 (PB2) 4148.7 0.000000e+00 2268/2279 (99%)
text_code_colored.png EPI168867 A/environment/New Jersey/Sg-00393/2002 (A/H7N2) segment 1 (PB2) 4148.7 0.000000e+00 2262/2270 (99%)
text_code_colored.png EPI168859 A/guinea fowl/New Jersey/Sg-00391/2002 (A/H7N2) segment 1 (PB2) 4148.7 0.000000e+00 2260/2267 (99%)
text_code_colored.png EPI168796 A/avian/New York/Sg-00375/2001 (A/H7N2) segment 1 (PB2) 4145.0 0.000000e+00 2250/2253 (99%)
text_code_colored.png EPI168808 A/avian/New York/Sg-00378/2001 (A/H7N2) segment 1 (PB2) 4141.3 0.000000e+00 2250/2254 (99%)
text_code_colored.png EPI168863 A/chicken/New Jersey/Sg-00392/2002 (A/H7N2) segment 1 (PB2) 4133.9 0.000000e+00 2258/2268 (99%)
text_code_colored.png EPI168877 A/avian/New York/Sg-00396/2002 (A/H7N2) segment 1 (PB2) 4128.4 0.000000e+00 2257/2268 (99%)
text_code_colored.png EPI168881 A/avian/New York/Sg-00397/2002 (A/H7N2) segment 1 (PB2) 4119.1 0.000000e+00 2252/2263 (99%)
text_code_colored.png EPI168885 A/avian/New York/Sg-00398/2002 (A/H7N2) segment 1 (PB2) 4117.3 0.000000e+00 2255/2268 (99%)
text_code_colored.png EPI166600 A/avian/New York/Sg-00346/2000 (A/H7N2) segment 1 (PB2) 4117.3 0.000000e+00 2247/2256 (99%)
text_code_colored.png EPI158445 A/Chicken/NJ/16224-6/99 (A/H7N2) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI168756 A/avian/New York/Sg-00364/2001 (A/H7N2) segment 1 (PB2) 4109.9 0.000000e+00 2241/2249 (99%)
text_code_colored.png EPI169619 A/chicken/NY/21586-8/99 (A/H7N2) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI166596 A/avian/New York/Sg-00345/2000 (A/H7N2) segment 1 (PB2) 4080.4 0.000000e+00 2243/2260 (99%)
text_code_colored.png EPI166585 A/quail/New Jersey/Sg-00342/2000 (A/H7N2) segment 1 (PB2) 4078.5 0.000000e+00 2240/2256 (99%)
text_code_colored.png EPI158412 A/Chicken/New Jersey/30739-6/00 (A/H7N2) segment 1 (PB2) 4067.4 0.000000e+00 2254/2280 (98%)
text_code_colored.png EPI166537 A/avian/New York/Sg-00328/1999 (A/H7N2) segment 1 (PB2) 4063.7 0.000000e+00 2234/2251 (99%)
text_code_colored.png EPI168704 A/avian/New York/Sg-00350/2000 (A/H7N2) segment 1 (PB2) 4060.1 0.000000e+00 2244/2267 (98%)
text_code_colored.png EPI166563 A/chicken/New Jersey/Sg-00336/1999 (A/H7N2) segment 1 (PB2) 4050.8 0.000000e+00 2229/2247 (99%)
text_code_colored.png EPI166559 A/duck/New Jersey/Sg-00335/1999 (A/H7N2) segment 1 (PB2) 4050.8 0.000000e+00 2230/2249 (99%)
text_code_colored.png EPI166556 A/chicken/New Jersey/Sg-00334/1999 (A/H7N2) segment 1 (PB2) 4050.8 0.000000e+00 2229/2247 (99%)
text_code_colored.png EPI166552 A/chicken/New Jersey/Sg-00333/1999 (A/H7N2) segment 1 (PB2) 4050.8 0.000000e+00 2229/2247 (99%)
text_code_colored.png EPI122286 A/chicken/NY/30749-3/00 (A/H7N2) segment 1 (PB2) 4050.8 0.000000e+00 2251/2280 (98%)
text_code_colored.png EPI168728 A/avian/New York/Sg-00356/2001 (A/H7N2) segment 1 (PB2) 4045.3 0.000000e+00 2228/2247 (99%)
text_code_colored.png EPI166567 A/avian/New York/Sg-00337/1999 (A/H7N2) segment 1 (PB2) 4045.3 0.000000e+00 2228/2247 (99%)
text_code_colored.png EPI243241 A/avian/New York/Sg-00338/1999 (A/H7N2) segment 1 (PB2) 4039.7 0.000000e+00 2227/2247 (99%)
text_code_colored.png EPI168740 A/avian/New York/Sg-00359/2001 (A/H7N2) segment 1 (PB2) 4037.9 0.000000e+00 2238/2264 (98%)
text_code_colored.png EPI168708 A/avian/New York/Sg-00351/2000 (A/H7N2) segment 1 (PB2) 4037.9 0.000000e+00 2242/2270 (98%)
text_code_colored.png EPI188104 A/avian/New York/Sg-00368/2001 (A/H7N2) segment 1 (PB2) 4034.2 0.000000e+00 2248/2280 (98%)
text_code_colored.png EPI159062 A/unknown/NY/85161/2000 (A/H7N2) segment 1 (PB2) 4034.2 0.000000e+00 2248/2280 (98%)
text_code_colored.png EPI166548 A/avian/New York/Sg-00331/1999 (A/H7N2) segment 1 (PB2) 4028.7 0.000000e+00 2225/2247 (99%)
text_code_colored.png EPI159031 A/guinea fowl/NJ/119063-8/2001 (A/H7N2) segment 1 (PB2) 4028.7 0.000000e+00 2247/2280 (98%)
text_code_colored.png EPI120353 A/avian/NY/118353-1/2001 (A/H7N2) segment 1 (PB2) 4017.6 0.000000e+00 2245/2280 (98%)
text_code_colored.png EPI166612 A/avian/New York/Sg-00349/2000 (A/H7N2) segment 1 (PB2) 4013.9 0.000000e+00 2225/2251 (98%)
text_code_colored.png EPI168724 A/avian/New York/Sg-00355/2000 (A/H7N2) segment 1 (PB2) 4012.0 0.000000e+00 2222/2247 (98%)
text_code_colored.png EPI122308 A/chicken/NJ/118878-5/01 (A/H7N2) segment 1 (PB2) 4012.0 0.000000e+00 2244/2280 (98%)
text_code_colored.png EPI168823 A/guinea fowl/New Jersey/Sg-00382/2001 (A/H7N2) segment 1 (PB2) 4008.4 0.000000e+00 2236/2269 (98%)
text_code_colored.png EPI168716 A/avian/New York/Sg-00353/2000 (A/H7N2) segment 1 (PB2) 4008.4 0.000000e+00 2224/2251 (98%)
text_code_colored.png EPI166608 A/avian/New York/Sg-00348/2000 (A/H7N2) segment 1 (PB2) 4008.4 0.000000e+00 2224/2251 (98%)
text_code_colored.png EPI166578 A/chicken/New Jersey/Sg-00340/2000 (A/H7N2) segment 1 (PB2) 4006.5 0.000000e+00 2221/2247 (98%)
text_code_colored.png EPI159039 A/unknown/NY/120485-5/2001 (A/H7N2) segment 1 (PB2) 4006.5 0.000000e+00 2244/2281 (98%)
text_code_colored.png EPI166574 A/avian/New York/Sg-00339/2000 (A/H7N2) segment 1 (PB2) 4001.0 0.000000e+00 2220/2247 (98%)
text_code_colored.png EPI168764 A/avian/New York/Sg-00366/2001 (A/H7N2) segment 1 (PB2) 3995.4 0.000000e+00 2219/2247 (98%)
text_code_colored.png EPI168748 A/avian/New York/Sg-00362/2001 (A/H7N2) segment 1 (PB2) 3995.4 0.000000e+00 2223/2253 (98%)
text_code_colored.png EPI168712 A/chicken/New York/Sg-00352/2000 (A/H7N2) segment 1 (PB2) 3995.4 0.000000e+00 2223/2253 (98%)
text_code_colored.png EPI168760 A/avian/New York/Sg-00365/2001 (A/H7N2) segment 1 (PB2) 3993.6 0.000000e+00 2232/2267 (98%)
text_code_colored.png EPI168768 A/avian/New York/Sg-00367/2001 (A/H7N2) segment 1 (PB2) 3991.7 0.000000e+00 2231/2266 (98%)
text_code_colored.png EPI166581 A/chicken/New Jersey/Sg-00341/2000 (A/H7N2) segment 1 (PB2) 3989.9 0.000000e+00 2218/2247 (98%)
text_code_colored.png EPI166451 A/chicken/New York/Sg-00306/1998 (A/H7N2) segment 1 (PB2) 3989.9 0.000000e+00 2218/2247 (98%)
text_code_colored.png EPI159054 A/chicken/FL/90348-4/2001 (A/H7N2) segment 1 (PB2) 3989.9 0.000000e+00 2240/2280 (98%)
text_code_colored.png EPI168800 A/avian/New York/Sg-00376/2001 (A/H7N2) segment 1 (PB2) 3988.0 0.000000e+00 2229/2264 (98%)
text_code_colored.png EPI168835 A/avian/New York/Sg-00385/2001 (A/H7N2) segment 1 (PB2) 3984.3 0.000000e+00 2232/2269 (98%)
text_code_colored.png EPI168720 A/avian/New York/Sg-00354/2000 (A/H7N2) segment 1 (PB2) 3984.3 0.000000e+00 2221/2253 (98%)
text_code_colored.png EPI168831 A/chicken/New York/Sg-00384/2001 (A/H7N2) segment 1 (PB2) 3982.5 0.000000e+00 2230/2267 (98%)
text_code_colored.png EPI166447 A/chicken/New York/Sg-00305/1998 (A/H7N2) segment 1 (PB2) 3975.1 0.000000e+00 2218/2251 (98%)
text_code_colored.png EPI162447 A/Chicken/New York/3202-7/96 (A/H7N2) segment 1 (PB2) 3973.3 0.000000e+00 2237/2280 (98%)
text_code_colored.png EPI168815 A/chicken/New Jersey/Sg-00380/2001 (A/H7N2) segment 1 (PB2) 3965.9 0.000000e+00 2219/2255 (98%)
text_code_colored.png EPI158567 A/chicken/PA/7777-1/1997 (A/H7N2) segment 1 (PB2) 3956.6 0.000000e+00 2234/2280 (97%)
text_code_colored.png EPI158552 A/chicken/PA/11767/1997 (A/H7N2) segment 1 (PB2) 3940.0 0.000000e+00 2231/2280 (97%)
text_code_colored.png EPI159023 A/chicken/PA/19241/1997 (A/H7N2) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
text_code_colored.png EPI158557 A/chicken/RI/4328-1/1995 (A/H7N2) segment 1 (PB2) 3923.4 0.000000e+00 2229/2281 (97%)
text_code_colored.png EPI122295 A/Chicken/New York/3112-1/95 (A/H7N2) segment 1 (PB2) 3917.9 0.000000e+00 2227/2280 (97%)
text_code_colored.png EPI166424 A/chicken/New York/Sg-00298/1997 (A/H7N2) segment 1 (PB2) 3916.0 0.000000e+00 2204/2246 (98%)
text_code_colored.png EPI158542 A/chicken/PA/149092-1/02 (A/H7N2) segment 1 (PB2) 3912.3 0.000000e+00 2226/2280 (97%)
text_code_colored.png EPI158547 A/chicken/NY/13833-7/1995 (A/H7N2) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
text_code_colored.png EPI158432 A/quail/NY/13989-51/1998 (A/H7N2) segment 1 (PB2) 3901.2 0.000000e+00 2226/2282 (97%)
text_code_colored.png EPI122324 A/Turkey/Pennsylvania/7975/97 (A/H7N2) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
text_code_colored.png EPI166387 A/chicken/New York/Sg-00288/1996 (A/H7N2) segment 1 (PB2) 3890.2 0.000000e+00 2208/2259 (97%)
text_code_colored.png EPI166379 A/duck/New Jersey/Sg-00286/1996 (A/H7N2) segment 1 (PB2) 3888.3 0.000000e+00 2207/2258 (97%)
text_code_colored.png EPI166394 A/goose/New Jersey/Sg-00290/1996 (A/H7N2) segment 1 (PB2) 3886.5 0.000000e+00 2208/2260 (97%)
text_code_colored.png EPI158428 A/Chicken/Pennsylvania/13552-1/98 (A/H7N2) segment 1 (PB2) 3884.6 0.000000e+00 2221/2280 (97%)
text_code_colored.png EPI166363 A/chicken/Rhode Island/Sg-00282/1996 (A/H7N2) segment 1 (PB2) 3882.8 0.000000e+00 2207/2259 (97%)
text_code_colored.png EPI166391 A/chicken/New York/Sg-00289/1996 (A/H2N2) segment 1 (PB2) 3880.9 0.000000e+00 2207/2260 (97%)
text_code_colored.png EPI166409 A/chicken/New York/Sg-00294/1996 (A/H7N2) segment 1 (PB2) 3879.1 0.000000e+00 2206/2259 (97%)
text_code_colored.png EPI158562 A/chicken/NY/8030-2/1997 (A/H7N2) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
text_code_colored.png EPI166383 A/turkey/New Jersey/Sg-00287/1996 (A/H7N2) segment 1 (PB2) 3875.4 0.000000e+00 2203/2256 (97%)
text_code_colored.png EPI307275 A/chicken/PA/9801289/1998 (A/H7N2) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
text_code_colored.png EPI166413 A/chicken/New Jersey/Sg-00295/1996 (A/H7N2) segment 1 (PB2) 3873.5 0.000000e+00 2205/2259 (97%)
text_code_colored.png EPI166510 A/environment/Pennsylvania/Sg-00321/1998 (A/H7N2) segment 1 (PB2) 3869.9 0.000000e+00 2197/2248 (97%)
text_code_colored.png EPI166467 A/duck/New York/Sg-00310/1998 (A/H7N2) segment 1 (PB2) 3868.0 0.000000e+00 2196/2247 (97%)
text_code_colored.png EPI166375 A/chicken/New York/Sg-00285/1996 (A/H7N2) segment 1 (PB2) 3864.3 0.000000e+00 2198/2251 (97%)
text_code_colored.png EPI166337 A/chicken/New York/Sg-00274/1995 (A/H7N2) segment 1 (PB2) 3864.3 0.000000e+00 2202/2257 (97%)
text_code_colored.png EPI166398 A/duck/New York/Sg-00291/1996 (A/H7N2) segment 1 (PB2) 3862.5 0.000000e+00 2203/2259 (97%)
text_code_colored.png EPI158837 A/goose/NY/8600-3/1998 (A/H7N2) segment 1 (PB2) 3862.5 0.000000e+00 2217/2280 (97%)
text_code_colored.png EPI158424 A/Chicken/New York/13142-5/94 (A/H7N2) segment 1 (PB2) 3862.5 0.000000e+00 2217/2280 (97%)
text_code_colored.png EPI166479 A/chicken/New Jersey/Sg-00313/1998 (A/H7N2) segment 1 (PB2) 3856.9 0.000000e+00 2194/2247 (97%)
text_code_colored.png EPI166459 A/chicken/New York/Sg-00308/1998 (A/H7N2) segment 1 (PB2) 3856.9 0.000000e+00 2194/2247 (97%)
text_code_colored.png EPI166443 A/chicken/New Jersey/Sg-00304/1997 (A/H7N2) segment 1 (PB2) 3856.9 0.000000e+00 2194/2247 (97%)
text_code_colored.png EPI166359 A/chicken/New York/Sg-00281/1996 (A/H7N2) segment 1 (PB2) 3856.9 0.000000e+00 2200/2256 (97%)
text_code_colored.png EPI166463 A/guinea fowl/New York/Sg-00309/1998 (A/H7N2) segment 1 (PB2) 3845.8 0.000000e+00 2192/2247 (97%)

Share this post


Link to post
Share on other sites
Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI125546 A/chicken/PA/143586/01 (A/H7N2) segment 2 (PB1) 4200.4 0.000000e+00 2274/2274 (100%)
text_code_colored.png EPI42783 A/chicken/Pennsylvania/143586/2002 (A/H7N2) segment 2 (PB1) 4200.4 0.000000e+00 2274/2274 (100%)
text_code_colored.png EPI159048 A/unknown/NY/ 117932-11/2001 (A/H7N2) segment 2 (PB1) 4148.7 0.000000e+00 2264/2274 (99%)
text_code_colored.png EPI307293 A/turkey/VA/SEP-67/2002 (A/H7N2) segment 2 (PB1) 4145.0 0.000000e+00 2264/2274 (99%)
text_code_colored.png EPI162359 A/turkey/VA/55/2002 (A/H7N2) segment 2 (PB1) 4145.0 0.000000e+00 2264/2274 (99%)
text_code_colored.png EPI159068 A/turkey/VA/158512/2002 (A/H7N2) segment 2 (PB1) 4145.0 0.000000e+00 2264/2274 (99%)
text_code_colored.png EPI168797 A/avian/New York/Sg-00375/2001 (A/H7N2) segment 2 (PB1) 4143.2 0.000000e+00 2255/2261 (99%)
text_code_colored.png EPI168820 A/chicken/New York/Sg-00381/2001 (A/H7N2) segment 2 (PB1) 4135.8 0.000000e+00 2255/2263 (99%)
text_code_colored.png EPI168840 A/chicken/New York/Sg-00386/2001 (A/H7N2) segment 2 (PB1) 4130.2 0.000000e+00 2254/2263 (99%)
text_code_colored.png EPI235954 A/guinea hen/MA/14801-11/2002 (A/H7N2) segment 2 (PB1) 4128.4 0.000000e+00 2261/2274 (99%)
text_code_colored.png EPI168856 A/guinea fowl/Massachusetts/Sg-00390/2002 (A/H7N2) segment 2 (PB1) 4113.6 0.000000e+00 2251/2263 (99%)
text_code_colored.png EPI168860 A/guinea fowl/New Jersey/Sg-00391/2002 (A/H7N2) segment 2 (PB1) 4091.4 0.000000e+00 2247/2263 (99%)
text_code_colored.png EPI168713 A/chicken/New York/Sg-00352/2000 (A/H7N2) segment 2 (PB1) 4087.8 0.000000e+00 2247/2264 (99%)
text_code_colored.png EPI168761 A/avian/New York/Sg-00365/2001 (A/H7N2) segment 2 (PB1) 4085.9 0.000000e+00 2246/2263 (99%)
text_code_colored.png EPI166613 A/avian/New York/Sg-00349/2000 (A/H7N2) segment 2 (PB1) 4084.1 0.000000e+00 2245/2263 (99%)
text_code_colored.png EPI168721 A/avian/New York/Sg-00354/2000 (A/H7N2) segment 2 (PB1) 4082.2 0.000000e+00 2244/2261 (99%)
text_code_colored.png EPI168864 A/chicken/New Jersey/Sg-00392/2002 (A/H7N2) segment 2 (PB1) 4080.4 0.000000e+00 2245/2263 (99%)
text_code_colored.png EPI168717 A/avian/New York/Sg-00353/2000 (A/H7N2) segment 2 (PB1) 4076.7 0.000000e+00 2245/2264 (99%)
text_code_colored.png EPI168749 A/avian/New York/Sg-00362/2001 (A/H7N2) segment 2 (PB1) 4074.8 0.000000e+00 2244/2263 (99%)
text_code_colored.png EPI120350 A/avian/NY/118353-1/2001 (A/H7N2) segment 2 (PB1) 4073.0 0.000000e+00 2251/2274 (98%)
text_code_colored.png EPI168868 A/environment/New Jersey/Sg-00393/2002 (A/H7N2) segment 2 (PB1) 4069.3 0.000000e+00 2243/2263 (99%)
text_code_colored.png EPI168737 A/avian/New York/Sg-00358/2001 (A/H7N2) segment 2 (PB1) 4065.6 0.000000e+00 2243/2264 (99%)
text_code_colored.png EPI166609 A/avian/New York/Sg-00348/2000 (A/H7N2) segment 2 (PB1) 4065.6 0.000000e+00 2241/2262 (99%)
text_code_colored.png EPI122310 A/chicken/NJ/118878-5/01 (A/H7N2) segment 2 (PB1) 4061.9 0.000000e+00 2249/2274 (98%)
text_code_colored.png EPI159040 A/unknown/NY/120485-5/2001 (A/H7N2) segment 2 (PB1) 4056.4 0.000000e+00 2248/2274 (98%)
text_code_colored.png EPI168801 A/avian/New York/Sg-00376/2001 (A/H7N2) segment 2 (PB1) 4052.7 0.000000e+00 2240/2263 (98%)
text_code_colored.png EPI168832 A/chicken/New York/Sg-00384/2001 (A/H7N2) segment 2 (PB1) 4047.1 0.000000e+00 2239/2263 (98%)
text_code_colored.png EPI168816 A/chicken/New Jersey/Sg-00380/2001 (A/H7N2) segment 2 (PB1) 4047.1 0.000000e+00 2239/2263 (98%)
text_code_colored.png EPI168812 A/chicken/New Jersey/Sg-00379/2001 (A/H7N2) segment 2 (PB1) 4045.3 0.000000e+00 2238/2262 (98%)
text_code_colored.png EPI169618 A/chicken/NY/21586-8/99 (A/H7N2) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
text_code_colored.png EPI166560 A/duck/New Jersey/Sg-00335/1999 (A/H7N2) segment 2 (PB1) 4037.9 0.000000e+00 2236/2261 (98%)
text_code_colored.png EPI168836 A/avian/New York/Sg-00385/2001 (A/H7N2) segment 2 (PB1) 4036.0 0.000000e+00 2237/2263 (98%)
text_code_colored.png EPI166553 A/chicken/New Jersey/Sg-00333/1999 (A/H7N2) segment 2 (PB1) 4032.4 0.000000e+00 2235/2261 (98%)
text_code_colored.png EPI166549 A/avian/New York/Sg-00331/1999 (A/H7N2) segment 2 (PB1) 4032.4 0.000000e+00 2235/2261 (98%)
text_code_colored.png EPI158413 A/Chicken/New Jersey/30739-6/00 (A/H7N2) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
text_code_colored.png EPI166568 A/avian/New York/Sg-00337/1999 (A/H7N2) segment 2 (PB1) 4015.7 0.000000e+00 2232/2261 (98%)
text_code_colored.png EPI166538 A/avian/New York/Sg-00328/1999 (A/H7N2) segment 2 (PB1) 4010.2 0.000000e+00 2223/2249 (98%)
text_code_colored.png EPI188102 A/chicken/New Jersey/Sg-00340/2000 (A/H7N2) segment 2 (PB1) 3999.1 0.000000e+00 2229/2261 (98%)
text_code_colored.png EPI168886 A/avian/New York/Sg-00398/2002 (A/H7N2) segment 2 (PB1) 3997.3 0.000000e+00 2230/2263 (98%)
text_code_colored.png EPI168882 A/avian/New York/Sg-00397/2002 (A/H7N2) segment 2 (PB1) 3997.3 0.000000e+00 2230/2263 (98%)
text_code_colored.png EPI168878 A/avian/New York/Sg-00396/2002 (A/H7N2) segment 2 (PB1) 3997.3 0.000000e+00 2230/2263 (98%)
text_code_colored.png EPI166452 A/chicken/New York/Sg-00306/1998 (A/H7N2) segment 2 (PB1) 3988.0 0.000000e+00 2227/2261 (98%)
text_code_colored.png EPI243242 A/avian/New York/Sg-00338/1999 (A/H7N2) segment 2 (PB1) 3984.3 0.000000e+00 2219/2250 (98%)
text_code_colored.png EPI166448 A/chicken/New York/Sg-00305/1998 (A/H7N2) segment 2 (PB1) 3954.8 0.000000e+00 2221/2261 (98%)
text_code_colored.png EPI159055 A/chicken/FL/90348-4/2001 (A/H7N2) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
text_code_colored.png EPI166575 A/avian/New York/Sg-00339/2000 (A/H7N2) segment 2 (PB1) 3910.5 0.000000e+00 2205/2249 (98%)
text_code_colored.png EPI162446 A/Chicken/New York/3202-7/96 (A/H7N2) segment 2 (PB1) 3890.2 0.000000e+00 2218/2274 (97%)
text_code_colored.png EPI159024 A/chicken/PA/19241/1997 (A/H7N2) segment 2 (PB1) 3890.2 0.000000e+00 2218/2274 (97%)
text_code_colored.png EPI166425 A/chicken/New York/Sg-00298/1997 (A/H7N2) segment 2 (PB1) 3884.6 0.000000e+00 2208/2262 (97%)
text_code_colored.png EPI158568 A/chicken/PA/7777-1/1997 (A/H7N2) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
text_code_colored.png EPI122326 A/Turkey/Pennsylvania/7975/97 (A/H7N2) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
text_code_colored.png EPI307274 A/chicken/PA/9801289/1998 (A/H7N2) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
text_code_colored.png EPI158553 A/chicken/PA/11767/1997 (A/H7N2) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
text_code_colored.png EPI166444 A/chicken/New Jersey/Sg-00304/1997 (A/H7N2) segment 2 (PB1) 3862.5 0.000000e+00 2204/2261 (97%)
text_code_colored.png EPI158543 A/chicken/PA/149092-1/02 (A/H7N2) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
text_code_colored.png EPI370644 A/chicken/New Jersey/13839-17/1995 (A/H2N2) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
text_code_colored.png EPI158429 A/Chicken/Pennsylvania/13552-1/98 (A/H7N2) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
text_code_colored.png EPI370580 A/guinea fowl/New Jersey/6322-8/1995 (A/H0) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
text_code_colored.png EPI166376 A/chicken/New York/Sg-00285/1996 (A/H7N2) segment 2 (PB1) 3849.5 0.000000e+00 2202/2261 (97%)
text_code_colored.png EPI370612 A/guinea fowl/New Jersey/7290-19/1994 (A/H2N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
text_code_colored.png EPI166511 A/environment/Pennsylvania/Sg-00321/1998 (A/H7N2) segment 2 (PB1) 3844.0 0.000000e+00 2201/2261 (97%)
text_code_colored.png EPI166503 A/duck/New Jersey/Sg-00319/1998 (A/H7N2) segment 2 (PB1) 3844.0 0.000000e+00 2193/2249 (97%)
text_code_colored.png EPI370636 A/guinea fowl/New York/13824/1995 (A/H2N2) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
text_code_colored.png EPI370492 A/duck/New Jersey/7872-27/1995 (A/H0) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
text_code_colored.png EPI158433 A/quail/NY/13989-51/1998 (A/H7N2) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
text_code_colored.png EPI166456 A/chicken/New York/Sg-00307/1998 (A/H7N2) segment 2 (PB1) 3838.5 0.000000e+00 2201/2262 (97%)
text_code_colored.png EPI166460 A/chicken/New York/Sg-00308/1998 (A/H7N2) segment 2 (PB1) 3836.6 0.000000e+00 2198/2258 (97%)
text_code_colored.png EPI370604 A/guinea fowl/New York/4449-12/1994 (A/H2N2) segment 2 (PB1) 3834.8 0.000000e+00 2208/2274 (97%)
text_code_colored.png EPI166472 A/chicken/New Jersey/Sg-00311/1998 (A/H7N2) segment 2 (PB1) 3834.8 0.000000e+00 2200/2262 (97%)
text_code_colored.png EPI166507 A/guinea fowl/New Jersey/Sg-00320/1998 (A/H7N2) segment 2 (PB1) 3832.9 0.000000e+00 2191/2249 (97%)
text_code_colored.png EPI370596 A/chicken/New Jersey/16264-16/1995 (A/H2N2) segment 2 (PB1) 3829.2 0.000000e+00 2208/2275 (97%)
text_code_colored.png EPI166384 A/turkey/New Jersey/Sg-00287/1996 (A/H7N2) segment 2 (PB1) 3829.2 0.000000e+00 2198/2261 (97%)
text_code_colored.png EPI122317 A/Chicken/New York/6777-3/97 (A/H7N2) segment 2 (PB1) 3829.2 0.000000e+00 2208/2275 (97%)
text_code_colored.png EPI42630 A/guinea fowl/New York/20221-11/1995 (A/H2N2) segment 2 (PB1) 3829.2 0.000000e+00 2207/2274 (97%)
text_code_colored.png EPI166464 A/guinea fowl/New York/Sg-00309/1998 (A/H7N2) segment 2 (PB1) 3827.4 0.000000e+00 2199/2262 (97%)
text_code_colored.png EPI166484 A/chicken/New Jersey/Sg-00314/1998 (A/H7N2) segment 2 (PB1) 3825.5 0.000000e+00 2196/2261 (97%)
text_code_colored.png EPI370628 A/chicken/New Jersey/10977-2/1994 (A/H2N2) segment 2 (PB1) 3823.7 0.000000e+00 2207/2275 (97%)
text_code_colored.png EPI166399 A/duck/New York/Sg-00291/1996 (A/H7N2) segment 2 (PB1) 3823.7 0.000000e+00 2198/2262 (97%)
text_code_colored.png EPI188074 A/duck/New Jersey/Sg-00266/1995 (A/H2N2) segment 2 (PB1) 3821.8 0.000000e+00 2199/2264 (97%)
text_code_colored.png EPI166388 A/chicken/New York/Sg-00288/1996 (A/H7N2) segment 2 (PB1) 3821.8 0.000000e+00 2197/2262 (97%)
text_code_colored.png EPI166480 A/chicken/New Jersey/Sg-00313/1998 (A/H7N2) segment 2 (PB1) 3820.0 0.000000e+00 2188/2248 (97%)
text_code_colored.png EPI166315 A/guinea fowl/New Jersey/Sg-00265/1995 (A/H2N2) segment 2 (PB1) 3820.0 0.000000e+00 2198/2263 (97%)
text_code_colored.png EPI158548 A/chicken/NY/13833-7/1995 (A/H7N2) segment 2 (PB1) 3818.1 0.000000e+00 2206/2275 (96%)
text_code_colored.png EPI122333 A/Chicken/New York/4447-7/94 (A/H7N2) segment 2 (PB1) 3818.1 0.000000e+00 2206/2275 (96%)
text_code_colored.png EPI166333 A/guinea fowl/New York/Sg-00272/1995 (A/H2N2) segment 2 (PB1) 3816.3 0.000000e+00 2196/2261 (97%)
text_code_colored.png EPI370588 A/guinea fowl/New Jersey/14600-21/1995 (A/H2N2) segment 2 (PB1) 3812.6 0.000000e+00 2205/2275 (96%)
text_code_colored.png EPI166487 A/duck/New Jersey/Sg-00315/1998 (A/H7N2) segment 2 (PB1) 3810.8 0.000000e+00 2195/2261 (97%)
text_code_colored.png EPI166350 A/guinea fowl/New York/Sg-00278/1995 (A/H2N2) segment 2 (PB1) 3808.9 0.000000e+00 2196/2263 (97%)
text_code_colored.png EPI166499 A/quail/New Jersey/Sg-00318/1998 (A/H7N2) segment 2 (PB1) 3807.1 0.000000e+00 2190/2254 (97%)
text_code_colored.png EPI158446 A/Chicken/NJ/16224-6/99 (A/H7N2) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
text_code_colored.png EPI158425 A/Chicken/New York/13142-5/94 (A/H7N2) segment 2 (PB1) 3807.1 0.000000e+00 2205/2276 (96%)
text_code_colored.png EPI42647 A/guinea fowl/New York/13820-3/1995 (A/H7N2) segment 2 (PB1) 3807.1 0.000000e+00 2204/2275 (96%)
text_code_colored.png EPI239005 A/chuckar/New Jersey/Sg-00317/1998 (A/H7N2) segment 2 (PB1) 3805.2 0.000000e+00 2195/2262 (97%)
text_code_colored.png EPI188086 A/chicken/New Jersey/Sg-00276/1995 (A/H2N2) segment 2 (PB1) 3805.2 0.000000e+00 2195/2262 (97%)
text_code_colored.png EPI166491 A/waterfowl/New Jersey/Sg-00316/1998 (A/H7N2) segment 2 (PB1) 3805.2 0.000000e+00 2195/2262 (97%)
text_code_colored.png EPI166476 A/turkey/New Jersey/Sg-00312/1998 (A/H7N2) segment 2 (PB1) 3805.2 0.000000e+00 2194/2261 (97%)
text_code_colored.png EPI166468 A/duck/New York/Sg-00310/1998 (A/H7N2) segment 2 (PB1) 3803.4 0.000000e+00 2189/2254 (97%)
text_code_colored.png EPI188061 A/duck/New York/Sg-00259/1994 (A/H7N2) segment 2 (PB1) 3801.5 0.000000e+00 2195/2263 (96%)
text_code_colored.png EPI166320 A/chicken/New Jersey/Sg-00268/1995 (A/H2N2) segment 2 (PB1) 3801.5 0.000000e+00 2195/2263 (96%)
text_code_colored.png EPI125565 A/turkey/NY/13820-3/1995 (A/H7N2) segment 2 (PB1) 3801.5 0.000000e+00 2203/2275 (96%)
3797.8 0.000000e+00 2195/2264 (96%)
Edited by niman

Share this post


Link to post
Share on other sites
Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI125549 A/chicken/PA/143586/01 (A/H7N2) segment 3 (PA) 3973.3 0.000000e+00 2151/2151 (100%)
text_code_colored.png EPI168762 A/avian/New York/Sg-00365/2001 (A/H7N2) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
text_code_colored.png EPI168722 A/avian/New York/Sg-00354/2000 (A/H7N2) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
text_code_colored.png EPI188105 A/avian/New York/Sg-00368/2001 (A/H7N2) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
text_code_colored.png EPI168813 A/chicken/New Jersey/Sg-00379/2001 (A/H7N2) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
text_code_colored.png EPI236951 A/avian/New York/Sg-00372/2001 (A/H5N2) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
text_code_colored.png EPI168802 A/avian/New York/Sg-00376/2001 (A/H7N2) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
text_code_colored.png EPI168750 A/avian/New York/Sg-00362/2001 (A/H7N2) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
text_code_colored.png EPI159049 A/unknown/NY/ 117932-11/2001 (A/H7N2) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
text_code_colored.png EPI168770 A/avian/New York/Sg-00367/2001 (A/H7N2) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
text_code_colored.png EPI168718 A/avian/New York/Sg-00353/2000 (A/H7N2) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
text_code_colored.png EPI168841 A/chicken/New York/Sg-00386/2001 (A/H7N2) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
text_code_colored.png EPI166610 A/avian/New York/Sg-00348/2000 (A/H7N2) segment 3 (PA) 3858.8 0.000000e+00 2117/2131 (99%)
text_code_colored.png EPI168861 A/guinea fowl/New Jersey/Sg-00391/2002 (A/H7N2) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
text_code_colored.png EPI168833 A/chicken/New York/Sg-00384/2001 (A/H7N2) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
text_code_colored.png EPI168869 A/environment/New Jersey/Sg-00393/2002 (A/H7N2) segment 3 (PA) 3845.8 0.000000e+00 2128/2151 (98%)
text_code_colored.png EPI166614 A/avian/New York/Sg-00349/2000 (A/H7N2) segment 3 (PA) 3844.0 0.000000e+00 2114/2131 (99%)
text_code_colored.png EPI168865 A/chicken/New Jersey/Sg-00392/2002 (A/H7N2) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
text_code_colored.png EPI159041 A/unknown/NY/120485-5/2001 (A/H7N2) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
text_code_colored.png EPI236956 A/avian/New York/Sg-00377/2001 (A/H5N2) segment 3 (PA) 3834.8 0.000000e+00 2127/2152 (98%)
text_code_colored.png EPI235953 A/guinea hen/MA/14801-11/2002 (A/H7N2) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
text_code_colored.png EPI168857 A/guinea fowl/Massachusetts/Sg-00390/2002 (A/H7N2) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
text_code_colored.png EPI120348 A/avian/NY/118353-1/2001 (A/H7N2) segment 3 (PA) 3834.8 0.000000e+00 2127/2152 (98%)
text_code_colored.png EPI169617 A/chicken/NY/21586-8/99 (A/H7N2) segment 3 (PA) 3829.2 0.000000e+00 2126/2152 (98%)
text_code_colored.png EPI159067 A/turkey/VA/158512/2002 (A/H7N2) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
text_code_colored.png EPI188101 A/avian/New York/Sg-00338/1999 (A/H7N2) segment 3 (PA) 3820.0 0.000000e+00 2121/2147 (98%)
text_code_colored.png EPI307292 A/turkey/VA/SEP-67/2002 (A/H7N2) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
text_code_colored.png EPI168887 A/avian/New York/Sg-00398/2002 (A/H7N2) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
text_code_colored.png EPI168883 A/avian/New York/Sg-00397/2002 (A/H7N2) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
text_code_colored.png EPI168879 A/avian/New York/Sg-00396/2002 (A/H7N2) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
text_code_colored.png EPI168837 A/avian/New York/Sg-00385/2001 (A/H7N2) segment 3 (PA) 3818.1 0.000000e+00 2115/2139 (98%)
text_code_colored.png EPI166561 A/duck/New Jersey/Sg-00335/1999 (A/H7N2) segment 3 (PA) 3812.6 0.000000e+00 2109/2131 (98%)
text_code_colored.png EPI162358 A/turkey/VA/55/2002 (A/H7N2) segment 3 (PA) 3812.6 0.000000e+00 2122/2151 (98%)
text_code_colored.png EPI166565 A/chicken/New Jersey/Sg-00336/1999 (A/H7N2) segment 3 (PA) 3807.1 0.000000e+00 2108/2131 (98%)
text_code_colored.png EPI158414 A/Chicken/New Jersey/30739-6/00 (A/H7N2) segment 3 (PA) 3807.1 0.000000e+00 2123/2153 (98%)
text_code_colored.png EPI166550 A/avian/New York/Sg-00331/1999 (A/H7N2) segment 3 (PA) 3805.2 0.000000e+00 2107/2130 (98%)
text_code_colored.png EPI166539 A/avian/New York/Sg-00328/1999 (A/H7N2) segment 3 (PA) 3805.2 0.000000e+00 2107/2130 (98%)
text_code_colored.png EPI166554 A/chicken/New Jersey/Sg-00333/1999 (A/H7N2) segment 3 (PA) 3801.5 0.000000e+00 2107/2131 (98%)
text_code_colored.png EPI168919 A/avian/New York/Sg-00406/2003 (A/H7N2) segment 3 (PA) 3796.0 0.000000e+00 2119/2151 (98%)
text_code_colored.png EPI168899 A/avian/New York/Sg-00401/2003 (A/H7N2) segment 3 (PA) 3796.0 0.000000e+00 2119/2151 (98%)
text_code_colored.png EPI168907 A/avian/New York/Sg-00403/2003 (A/H7N2) segment 3 (PA) 3784.9 0.000000e+00 2117/2151 (98%)
text_code_colored.png EPI122291 A/chicken/NY/30749-3/00 (A/H7N2) segment 3 (PA) 3784.9 0.000000e+00 2118/2152 (98%)
text_code_colored.png EPI235150 A/environment/NY/241365-18/2003 (A/H7N2) segment 3 (PA) 3779.4 0.000000e+00 2116/2151 (98%)
text_code_colored.png EPI168963 A/avian/New York/Sg-00417/2003 (A/H7N2) segment 3 (PA) 3779.4 0.000000e+00 2116/2151 (98%)
text_code_colored.png EPI168915 A/avian/New York/Sg-00405/2003 (A/H7N2) segment 3 (PA) 3779.4 0.000000e+00 2116/2151 (98%)
text_code_colored.png EPI166587 A/quail/New Jersey/Sg-00342/2000 (A/H7N2) segment 3 (PA) 3779.4 0.000000e+00 2103/2131 (98%)
text_code_colored.png EPI168955 A/avian/New York/Sg-00415/2003 (A/H7N2) segment 3 (PA) 3775.7 0.000000e+00 2115/2151 (98%)
text_code_colored.png EPI168923 A/avian/New York/Sg-00407/2003 (A/H7N2) segment 3 (PA) 3775.7 0.000000e+00 2116/2152 (98%)
text_code_colored.png EPI168959 A/chicken/New York/Sg-00416/2003 (A/H7N2) segment 3 (PA) 3773.8 0.000000e+00 2115/2151 (98%)
text_code_colored.png EPI168943 A/avian/New York/Sg-00412/2003 (A/H7N2) segment 3 (PA) 3773.8 0.000000e+00 2116/2152 (98%)
text_code_colored.png EPI168911 A/avian/New York/Sg-00404/2003 (A/H7N2) segment 3 (PA) 3773.8 0.000000e+00 2115/2151 (98%)
text_code_colored.png EPI166579 A/chicken/New Jersey/Sg-00340/2000 (A/H7N2) segment 3 (PA) 3773.8 0.000000e+00 2103/2132 (98%)
text_code_colored.png EPI166576 A/avian/New York/Sg-00339/2000 (A/H7N2) segment 3 (PA) 3773.8 0.000000e+00 2102/2131 (98%)
text_code_colored.png EPI166569 A/avian/New York/Sg-00337/1999 (A/H7N2) segment 3 (PA) 3773.8 0.000000e+00 2094/2119 (98%)
text_code_colored.png EPI168798 A/avian/New York/Sg-00375/2001 (A/H7N2) segment 3 (PA) 3770.1 0.000000e+00 2115/2152 (98%)
text_code_colored.png EPI168935 A/avian/New York/Sg-00410/2003 (A/H7N2) segment 3 (PA) 3768.3 0.000000e+00 2114/2151 (98%)
text_code_colored.png EPI168903 A/avian/New York/Sg-00402/2003 (A/H7N2) segment 3 (PA) 3768.3 0.000000e+00 2114/2151 (98%)
text_code_colored.png EPI168951 A/avian/New York/Sg-00414/2003 (A/H7N2) segment 3 (PA) 3762.7 0.000000e+00 2113/2151 (98%)
text_code_colored.png EPI168895 A/avian/New York/Sg-00400/2003 (A/H7N2) segment 3 (PA) 3762.7 0.000000e+00 2114/2152 (98%)
text_code_colored.png EPI168891 A/avian/New York/Sg-00399/2003 (A/H7N2) segment 3 (PA) 3762.7 0.000000e+00 2113/2151 (98%)
text_code_colored.png EPI159056 A/chicken/FL/90348-4/2001 (A/H7N2) segment 3 (PA) 3762.7 0.000000e+00 2115/2153 (98%)
text_code_colored.png EPI168734 A/avian/New York/Sg-00357/2001 (A/H7N2) segment 3 (PA) 3759.1 0.000000e+00 2113/2152 (98%)
text_code_colored.png EPI169017 A/chicken/New Jersey/Sg-00431/2004 (A/H7N2) segment 3 (PA) 3751.7 0.000000e+00 2112/2152 (98%)
text_code_colored.png EPI169013 A/avian/New York/Sg-00430/2004 (A/H7N3) segment 3 (PA) 3751.7 0.000000e+00 2111/2151 (98%)
text_code_colored.png EPI169009 A/chicken/New Jersey/Sg-00429/2004 (A/H7N2) segment 3 (PA) 3751.7 0.000000e+00 2111/2151 (98%)
text_code_colored.png EPI168947 A/avian/New York/Sg-00413/2003 (A/H7N2) segment 3 (PA) 3751.7 0.000000e+00 2111/2151 (98%)
text_code_colored.png EPI168927 A/avian/New York/Sg-00408/2003 (A/H7N2) segment 3 (PA) 3751.7 0.000000e+00 2111/2151 (98%)
text_code_colored.png EPI159017 A/environment/NY/260422-10/2003 (A/H7N2) segment 3 (PA) 3751.7 0.000000e+00 2111/2151 (98%)
text_code_colored.png EPI159009 A/chicken/CT/260413-2/2003 (A/H7N2) segment 3 (PA) 3751.7 0.000000e+00 2111/2151 (98%)
text_code_colored.png EPI166583 A/chicken/New Jersey/Sg-00341/2000 (A/H7N2) segment 3 (PA) 3749.8 0.000000e+00 2097/2130 (98%)
text_code_colored.png EPI168986 A/environment/New Jersey/Sg-00423/2004 (A/H7N2) segment 3 (PA) 3746.1 0.000000e+00 2110/2151 (98%)
text_code_colored.png EPI168939 A/avian/New York/Sg-00411/2003 (A/H7N2) segment 3 (PA) 3746.1 0.000000e+00 2108/2151 (98%)
text_code_colored.png EPI158847 A/chicken/NJ/294508-12/2004 (A/H7N2) segment 3 (PA) 3746.1 0.000000e+00 2110/2151 (98%)
text_code_colored.png EPI169033 A/chicken/New Jersey/Sg-00435/2004 (A/H7N2) segment 3 (PA) 3740.6 0.000000e+00 2110/2152 (98%)
text_code_colored.png EPI168978 A/chicken/New Jersey/Sg-00421/2004 (A/H7N2) segment 3 (PA) 3740.6 0.000000e+00 2109/2151 (98%)
text_code_colored.png EPI168970 A/avian/New York/Sg-00419/2003 (A/H7N2) segment 3 (PA) 3736.9 0.000000e+00 2109/2152 (98%)
text_code_colored.png EPI243853 A/avian/New York/Sg-00428/2004 (A/H7N2) segment 3 (PA) 3735.0 0.000000e+00 2108/2151 (98%)
text_code_colored.png EPI307279 A/chicken/MD/MinhMa/2004 (A/H7N2) segment 3 (PA) 3729.5 0.000000e+00 2107/2151 (97%)
text_code_colored.png EPI162445 A/Chicken/New York/3202-7/96 (A/H7N2) segment 3 (PA) 3729.5 0.000000e+00 2110/2154 (97%)
text_code_colored.png EPI169029 A/chicken/New Jersey/Sg-00434/2004 (A/H7N2) segment 3 (PA) 3724.0 0.000000e+00 2106/2151 (97%)
text_code_colored.png EPI169021 A/chicken/New York/Sg-00432/2004 (A/H7N2) segment 3 (PA) 3724.0 0.000000e+00 2106/2151 (97%)
text_code_colored.png EPI158569 A/chicken/PA/7777-1/1997 (A/H7N2) segment 3 (PA) 3724.0 0.000000e+00 2109/2154 (97%)
text_code_colored.png EPI169056 A/chicken/New Jersey/Sg-00441/2005 (A/H7N2) segment 3 (PA) 3712.9 0.000000e+00 2104/2151 (97%)
text_code_colored.png EPI158544 A/chicken/PA/149092-1/02 (A/H7N2) segment 3 (PA) 3712.9 0.000000e+00 2107/2154 (97%)
text_code_colored.png EPI164935 A/unknown/New York/11675/2005 (A/H7N2) segment 3 (PA) 3707.3 0.000000e+00 2104/2152 (97%)
text_code_colored.png EPI154163 A/New York/107/2003 (A/H7N2) segment 3 (PA) 3707.3 0.000000e+00 2104/2152 (97%)
text_code_colored.png EPI152862 A/chicken/New York/22067-7/2005 (A/H7N2) segment 3 (PA) 3707.3 0.000000e+00 2104/2152 (97%)
text_code_colored.png EPI68420 A/environment/New York/22067-3/2005 (A/H7N2) segment 3 (PA) 3707.3 0.000000e+00 2104/2152 (97%)
text_code_colored.png EPI169025 A/chicken/New York/Sg-00433/2004 (A/H7N2) segment 3 (PA) 3701.8 0.000000e+00 2103/2152 (97%)
text_code_colored.png EPI160806 A/environment/New York/31621-5/2005 (A/H7N2) segment 3 (PA) 3701.8 0.000000e+00 2102/2151 (97%)
text_code_colored.png EPI158554 A/chicken/PA/11767/1997 (A/H7N2) segment 3 (PA) 3701.8 0.000000e+00 2105/2154 (97%)
text_code_colored.png EPI156582 A/environment/New York/31621-2/2005 (A/H7N2) segment 3 (PA) 3701.8 0.000000e+00 2102/2151 (97%)
text_code_colored.png EPI152870 A/chicken/New York/22067-12/2005 (A/H7N2) segment 3 (PA) 3701.8 0.000000e+00 2104/2153 (97%)
text_code_colored.png EPI141417 A/environment/New York/22067-4/2005 (A/H7N2) segment 3 (PA) 3701.8 0.000000e+00 2104/2153 (97%)
text_code_colored.png EPI131837 A/environment/New York/22067-2/2005 (A/H7N2) segment 3 (PA) 3701.8 0.000000e+00 2104/2153 (97%)
text_code_colored.png EPI131818 A/environment/New York/22067-1/2005 (A/H7N2) segment 3 (PA) 3701.8 0.000000e+00 2104/2153 (97%)
text_code_colored.png EPI235158 A/environmental/NY/268925-10/2003 (A/H7N2) segment 3 (PA) 3700.0 0.000000e+00 2086/2127 (98%)
text_code_colored.png EPI227007 A/chicken/New York/11678-5/2005 (A/H7N2) segment 3 (PA) 3696.3 0.000000e+00 2101/2151 (97%)
text_code_colored.png EPI169049 A/chicken/New Jersey/Sg-00439/2005 (A/H7N2) segment 3 (PA) 3696.3 0.000000e+00 2101/2151 (97%)
text_code_colored.png EPI167331 A/environment/New York/31621-1/2005 (A/H7N2) segment 3 (PA) 3696.3 0.000000e+00 2101/2151 (97%)

Share this post


Link to post
Share on other sites
Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI125551 A/chicken/PA/143586/01 (A/H7N2) segment 5 (NP) 2765.6 0.000000e+00 1497/1497 (100%)
text_code_colored.png EPI42781 A/chicken/Pennsylvania/143586/2002 (A/H7N2) segment 5 (NP) 2765.6 0.000000e+00 1497/1497 (100%)
text_code_colored.png EPI307278 A/chicken/MD/MinhMa/2004 (A/H7N2) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
text_code_colored.png EPI235148 A/environment/NY/241365-18/2003 (A/H7N2) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
text_code_colored.png EPI159018 A/environment/NY/260422-10/2003 (A/H7N2) segment 5 (NP) 2688.0 0.000000e+00 1483/1497 (99%)
text_code_colored.png EPI159010 A/chicken/CT/260413-2/2003 (A/H7N2) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
text_code_colored.png EPI177138 A/chicken/New York/23165-9/2005 (A/H7N2) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
text_code_colored.png EPI160764 A/environment/New York/23165-5/2005 (A/H7N2) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
text_code_colored.png EPI156524 A/environment/New York/23165-1/2005 (A/H7N2) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
text_code_colored.png EPI152876 A/guinea fowl/New York/22071/2005 (A/H7N2) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
text_code_colored.png EPI141599 A/environment/New York/23165-4/2005 (A/H7N2) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
text_code_colored.png EPI122306 A/chicken/NY/119256-7/01 (A/H7N2) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
text_code_colored.png EPI327525 A/environment/New York/23165-3/2005 (A/H7N2) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
text_code_colored.png EPI327505 A/unknown/New York/38651/2005 (A/H7N2) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
text_code_colored.png EPI235156 A/environmental/NY/268925-10/2003 (A/H7N2) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
text_code_colored.png EPI160772 A/chicken/New York/23165-10/2005 (A/H7N2) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
text_code_colored.png EPI158840 A/goose/NY/8600-3/1998 (A/H7N2) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
text_code_colored.png EPI172310 A/chicken/New York/87493-2/2005 (A/H7N2) segment 5 (NP) 2662.1 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI227193 A/environment/New York/30720-1/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI164853 A/Muscovy duck/New York/87493-3/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI160780 A/chicken/New York/23165-11/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI160756 A/duck/New York/22067-11/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI160748 A/guinea fowl/New York/22067-10/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI159050 A/unknown/NY/ 117932-11/2001 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI159042 A/unknown/NY/120485-5/2001 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI156532 A/muscovy duck/New York/23165-13/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI156516 A/chicken/New York/22067-9/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI156508 A/chicken/New York/22067-8/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI156500 A/environment/New York/22067-6/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI152948 A/guinea fowl/New York/23165-12/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI152868 A/chicken/New York/22067-12/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI152860 A/chicken/New York/22067-7/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI141447 A/environment/New York/30720-3/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI141423 A/environment/New York/22067-5/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI141415 A/environment/New York/22067-4/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI131832 A/environment/New York/22067-2/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI131813 A/environment/New York/22067-1/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI125561 A/chicken/NJ/118878-5/01 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI63569 A/environment/New York/11678-2/2005 (A/H7N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
text_code_colored.png EPI327486 A/chicken/New York/87493-1/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1475/1494 (98%)
text_code_colored.png EPI227005 A/chicken/New York/11678-5/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI171064 A/environment/New York/30732-1/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI167401 A/chicken/New York/122501-1/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI167393 A/unknown/New York/13479-2/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI164957 A/turkey/New York/122501-2/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI164949 A/unknown/New York/13479-5/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI164941 A/unknown/New York/13479-3/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI156604 A/chicken/New York/37982-4/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI156572 A/muscovy duck/New York/30732-13/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI156564 A/chicken/New York/30732-11/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI156556 A/chicken/New York/30732-10/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI156548 A/chicken/New York/30732-9/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI156540 A/chicken/New York/30732-8/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI152996 A/chicken/New York/42217/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI152988 A/guinea fowl/New York/37982-3/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI152956 A/quail/New York/30732-12/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI141487 A/turkey/New York/30732-7/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI141479 A/chicken/New York/30732-6/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI141463 A/environment/New York/30732-3/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI141455 A/environment/New York/30732-2/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI120346 A/avian/NY/118353-1/2001 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI68415 A/environment/New York/22067-3/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI68377 A/chicken/New York/21211-1/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI63702 A/duck/New York/21211-6/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI63683 A/chicken/New York/21211-2/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI63607 A/environment/New York/11678-4/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI63550 A/environment/New York/11678-1/2005 (A/H7N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
text_code_colored.png EPI141567 A/environment/New York/10196-2/2005 (A/H7N2) segment 5 (NP) 2652.9 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI327520 A/environment/New York/30732-5/2005 (A/H7N2) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI177162 A/unknown/New York/13479-4/2005 (A/H7N2) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI167385 A/unknown/New York/13479-1/2005 (A/H7N2) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI164933 A/unknown/New York/11675/2005 (A/H7N2) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI160724 A/environment/New York/10196-3/2005 (A/H7N2) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI159034 A/guinea fowl/NJ/119063-8/2001 (A/H7N2) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI156596 A/environment/New York/37982-2/2005 (A/H7N2) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI141583 A/guinea fowl/New York/10196-7/2005 (A/H7N2) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI141471 A/environment/New York/30732-4/2005 (A/H7N2) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI68396 A/chukar/New York/21211-7/2005 (A/H7N2) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI63588 A/environment/New York/11678-3/2005 (A/H7N2) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
text_code_colored.png EPI159065 A/unknown/NY/85161/2000 (A/H7N2) segment 5 (NP) 2645.5 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI307291 A/turkey/VA/SEP-67/2002 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI235952 A/guinea hen/MA/14801-11/2002 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI164877 A/duck/New York/98616-5/2005 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI164869 A/duck/New York/98616-4/2005 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI160740 A/chicken/New York/10196-5/2005 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI160732 A/chicken/New York/10196-4/2005 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI159066 A/turkey/VA/158512/2002 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI152980 A/environment/New York/37982-1/2005 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI141607 A/chicken/New York/23165-7/2005 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI141575 A/chicken/New York/10196-6/2005 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI141559 A/environment/New York/10196-1/2005 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI141439 A/chicken/New York/23165-6/2005 (A/H7N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
text_code_colored.png EPI158570 A/chicken/PA/7777-1/1997 (A/H7N2) segment 5 (NP) 2640.0 0.000000e+00 1473/1495 (98%)
text_code_colored.png EPI158555 A/chicken/PA/11767/1997 (A/H7N2) segment 5 (NP) 2640.0 0.000000e+00 1473/1495 (98%)
text_code_colored.png EPI164893 A/Guinea fowl/New York/101276-1/2005 (A/H7N2) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
text_code_colored.png EPI162357 A/turkey/VA/55/2002 (A/H7N2) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
text_code_colored.png EPI160860 A/quail/New York/89641/2005 (A/H7N2) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
text_code_colored.png EPI122293 A/chicken/NY/30749-3/00 (A/H7N2) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
text_code_colored.png EPI172278 A/Guinea fowl/New York/98616-3/2005 (A/H7N2) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
text_code_colored.png EPI160868 A/environment/New York/98616-2/2005 (A/H7N2) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)

Share this post


Link to post
Share on other sites
Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI125553 A/chicken/PA/143586/01 (A/H7N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
text_code_colored.png EPI236437 A/Turkey/NC/11165/02 (A/H7N2) segment 8 (NS) 1524.6 0.000000e+00 833/837 (99%)
text_code_colored.png EPI18249 A/turkey/VA/55/02 (A/H7N2) segment 8 (NS) 1524.6 0.000000e+00 833/837 (99%)
text_code_colored.png EPI18246 A/Turkey/VA/158512/02 (A/H7N2) segment 8 (NS) 1524.6 0.000000e+00 833/837 (99%)
text_code_colored.png EPI18228 A/chicken/VA/32/02 (A/H7N2) segment 8 (NS) 1519.1 0.000000e+00 832/837 (99%)
text_code_colored.png EPI159003 A/chicken/CT/260413-2/2003 (A/H7N2) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
text_code_colored.png EPI235149 A/environment/NY/241365-18/2003 (A/H7N2) segment 8 (NS) 1508.0 0.000000e+00 830/837 (99%)
text_code_colored.png EPI18255 A/turkey/VA/67/02 (A/H7N2) segment 8 (NS) 1508.0 0.000000e+00 830/837 (99%)
text_code_colored.png EPI18252 A/turkey/VA/66/02 (A/H7N2) segment 8 (NS) 1508.0 0.000000e+00 830/837 (99%)
text_code_colored.png EPI18152 A/avian/NY/81746-5/00 (A/H7N2) segment 8 (NS) 1508.0 0.000000e+00 830/837 (99%)
text_code_colored.png EPI18198 A/chicken/NY/21586-8/99 (A/H7N2) segment 8 (NS) 1504.3 0.000000e+00 830/838 (99%)
text_code_colored.png EPI18195 A/Chicken/NY/14858-12/99 (A/H7N2) segment 8 (NS) 1504.3 0.000000e+00 830/838 (99%)
text_code_colored.png EPI18168 A/Chicken/NJ/16224-6/99 (A/H7N2) segment 8 (NS) 1504.3 0.000000e+00 830/838 (99%)
text_code_colored.png EPI159011 A/environment/NY/260422-10/2003 (A/H7N2) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
text_code_colored.png EPI307277 A/chicken/MD/MinhMa/2004 (A/H7N2) segment 8 (NS) 1496.9 0.000000e+00 828/837 (98%)
text_code_colored.png EPI18146 A/avian/NY/70411-12/00 (A/H7N2) segment 8 (NS) 1493.2 0.000000e+00 828/838 (98%)
text_code_colored.png EPI235157 A/environmental/NY/268925-10/2003 (A/H7N2) segment 8 (NS) 1491.4 0.000000e+00 827/837 (98%)
text_code_colored.png EPI160781 A/chicken/New York/23165-11/2005 (A/H7N2) segment 8 (NS) 1491.4 0.000000e+00 827/837 (98%)
text_code_colored.png EPI160773 A/chicken/New York/23165-10/2005 (A/H7N2) segment 8 (NS) 1491.4 0.000000e+00 827/837 (98%)
text_code_colored.png EPI160765 A/environment/New York/23165-5/2005 (A/H7N2) segment 8 (NS) 1491.4 0.000000e+00 827/837 (98%)
text_code_colored.png EPI156533 A/muscovy duck/New York/23165-13/2005 (A/H7N2) segment 8 (NS) 1491.4 0.000000e+00 827/837 (98%)
text_code_colored.png EPI154165 A/New York/107/2003 (A/H7N2) segment 8 (NS) 1491.4 0.000000e+00 827/837 (98%)
text_code_colored.png EPI152949 A/guinea fowl/New York/23165-12/2005 (A/H7N2) segment 8 (NS) 1491.4 0.000000e+00 827/837 (98%)
text_code_colored.png EPI177139 A/chicken/New York/23165-9/2005 (A/H7N2) segment 8 (NS) 1487.7 0.000000e+00 826/837 (98%)
text_code_colored.png EPI18231 A/guineafowl/MA/148081-11/02 (A/H7N2) segment 8 (NS) 1487.7 0.000000e+00 827/838 (98%)
text_code_colored.png EPI18204 A/chicken/NY/30749-3/00 (A/H7N2) segment 8 (NS) 1487.7 0.000000e+00 827/838 (98%)
text_code_colored.png EPI18201 A/chicken/NY/22409-4/99 (A/H7N2) segment 8 (NS) 1487.7 0.000000e+00 827/838 (98%)
text_code_colored.png EPI18183 A/chicken/NY/119256-7/01 (A/H7N2) segment 8 (NS) 1487.7 0.000000e+00 827/838 (98%)
text_code_colored.png EPI18162 A/chicken/NJ/150383-7/02 (A/H7N2) segment 8 (NS) 1487.7 0.000000e+00 823/832 (98%)
text_code_colored.png EPI327548 A/chicken/New York/16326-3/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI327529 A/chicken/New York/23164-8/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI327524 A/environment/New York/23165-3/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI327519 A/environment/New York/30732-5/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI327515 A/environment/New York/31621-4/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI327510 A/chicken/New York/31621-6/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI327508 A/chicken/New York/31621-7/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI327507 A/muscovy duck/New York/31621-10/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI172247 A/environment/New York/88291-2/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI171081 A/environment/New York/88291-3/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI171065 A/environment/New York/30732-1/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI167362 A/unknown/New York/88291-16/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI167346 A/Guinea fowl/New York/88291-9/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI167330 A/environment/New York/31621-1/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI160853 A/unknown/New York/88291-17/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI160805 A/environment/New York/31621-5/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI158841 A/chicken/NJ/294508-12/2004 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI156589 A/guinea fowl/New York/31621-8/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI156581 A/environment/New York/31621-2/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI156573 A/muscovy duck/New York/30732-13/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI156565 A/chicken/New York/30732-11/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI156557 A/chicken/New York/30732-10/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI156549 A/chicken/New York/30732-9/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI156541 A/chicken/New York/30732-8/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI156525 A/environment/New York/23165-1/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI152973 A/chicken/New York/31621-9/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI152965 A/environment/New York/31621-3/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI152957 A/quail/New York/30732-12/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI152909 A/chicken/New York/23164-5/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI152877 A/guinea fowl/New York/22071/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI141608 A/chicken/New York/23165-7/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI141600 A/environment/New York/23165-4/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI141488 A/turkey/New York/30732-7/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI141480 A/chicken/New York/30732-6/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI141472 A/environment/New York/30732-4/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI141464 A/environment/New York/30732-3/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI141456 A/environment/New York/30732-2/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI141440 A/chicken/New York/23165-6/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI131777 A/chicken/New York/16326-4/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI76976 A/environment/New York/16326-2/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI63666 A/chicken/New York/16330/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI63647 A/chicken/New York/16326-5/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI63628 A/environment/New York/16326-1/2005 (A/H7N2) segment 8 (NS) 1485.8 0.000000e+00 826/837 (98%)
text_code_colored.png EPI177147 A/environment/New York/88291-4/2005 (A/H7N2) segment 8 (NS) 1482.1 0.000000e+00 825/837 (98%)
text_code_colored.png EPI164862 A/chicken/New York/88291-8/2005 (A/H7N2) segment 8 (NS) 1482.1 0.000000e+00 825/837 (98%)
text_code_colored.png EPI327538 A/environment/New York/641/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI327533 A/chicken/New York/23164-4/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI327482 A/turkey/New York/88291-7/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI172271 A/chicken/New York/88291-15/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI172263 A/chicken/New York/88291-14/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI172255 A/duck/New York/88291-12/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI172239 A/environment/New York/88291-1/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI171073 A/environment/New York/81928-2/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI167354 A/chicken/New York/88291-10/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI160861 A/quail/New York/89641/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI160837 A/chicken/New York/88291-11/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI160829 A/chicken/New York/88291-6/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI160821 A/environment/New York/88291-5/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI152941 A/turkey/New York/23164-11/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI152933 A/muscovy duck/New York/23164-10/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI152925 A/chicken/New York/23164-9/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI152917 A/chicken/New York/23164-7/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI152901 A/guinea fowl/New York/23164-3-05/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI152885 A/environment/New York/23164-1/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI141592 A/chicken/New York/23164-6/2005 (A/H7N2) segment 8 (NS) 1480.3 0.000000e+00 825/837 (98%)
text_code_colored.png EPI159058 A/unknown/NY/85161/2000 (A/H7N2) segment 8 (NS) 1476.6 0.000000e+00 825/838 (98%)
text_code_colored.png EPI159027 A/guinea fowl/NJ/119063-8/2001 (A/H7N2) segment 8 (NS) 1476.6 0.000000e+00 825/838 (98%)
text_code_colored.png EPI18149 A/avian/NY/76247-3/00 (A/H7N2) segment 8 (NS) 1476.6 0.000000e+00 825/838 (98%)
text_code_colored.png EPI327502 A/environment/New York/63806-1/2005 (A/H7N2) segment 8 (NS) 1474.7 0.000000e+00 824/837 (98%)
text_code_colored.png EPI327500 A/environment/New York/63806-2/2005 (A/H7N2) segment 8 (NS) 1474.7 0.000000e+00 824/837 (98%)
text_code_colored.png EPI327495 A/environment/New York/63806-5/2005 (A/H7N2) segment 8 (NS) 1474.7 0.000000e+00 824/837 (98%)

Share this post


Link to post
Share on other sites

Pennsylvania: Shelter cats may have avian flu

 
 
 
 
 

HARRISBURG, Pa. — Pennsylvania agriculture officials are warning that a dozen shelter cats may have been exposed to an avian flu virus similar to one that spread through the poultry industry a decade ago.

The state Department of Agriculture says the cats came from New York City shelters and have been put in quarantine in three Chester County shelters.

Officials say the virus is not harmful to humans. But they are reminding people to wash their hands frequently during flu season. Authorities are also reaching out to anyone who brought cats home from the affected shelters to see if they have backyard poultry.

The 2002-2003 outbreak caused millions of dollars in losses to the poultry industry in Virginia and Pennsylvania.

State veterinarian Dr. David Wolfgang says there’s no evidence any poultry flocks have been exposed.

https://www.washingtonpost.com/national/pennsylvania-shelter-cats-may-have-avian-flu/2016/12/23/0bfcf7da-c941-11e6-acda-59924caa2450_story.html?utm_term=.b505a4c610cc

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.

×