Sign in to follow this  
Followers 0
niman

Indiana H7N8 HPAI & LPAI Sequences At Genbank

38 posts in this topic

Veterinary Services is making the HPAI genomic sequence, as well as the HPAI virus courtesy of the Indiana State Board of Animal Health, available to facilities to encourage disease research and development to benefit the U.S. poultry industry. The complete genomic sequence for the HPAI can be found in the attached file. Sequence information has also been submitted to GenBank and will be available for both HPAI and LPAI viruses soon under accessions as follows: H7N8 HPAI KU558903-8910; H7N8 LPAI KU585905-12 and KU585913-20. 

https://www.aphis.usda.gov/animal_health/vet_biologics/publications/notice_16_02.pdf

Share this post


Link to post
Share on other sites

CENTER FOR VETERINARY BIOLOGICS NOTICE NO. 16-02

TO: Biologics Licensees, Permittees, and Applicants Directors, Center for Veterinary Biologics Veterinary Services Leadership Team

FROM: Byron Rippke Director

SUBJECT: Availability of Avian Influenza Isolate and Sequence Information I.

PURPOSE The purpose of this notice is to furnish interested parties with the genetic sequences from the H7N8 highly pathogenic avian influenza (HPAI) virus and low pathogenic (LPAI) viruses isolated from turkeys in Indiana on January 15, 2016. The notice is also to inform interested parties that the HPAI isolate will be available for purchase from the National Veterinary Services Laboratories (NVSL) by mid-February 2016. II.

BACKGROUND The National Veterinary Services Laboratories confirmed H7N8 HPAI in a commercial turkey flock experiencing significant mortality in Dubois County, Indiana, on January 15, 2016. Subsequent H7N8 detections were found to be H7N8 LPAI. Based upon the full genome sequence, the index HPAI case and subsequent LPAI viruses detected in turkeys are all of North American wild bird lineage with high similarity across all eight gene segments to other wild bird viruses collected from Midwest and western states between 2011 and 2013. North American H7N8 LPAI virus has been detected previously in wild bird surveillance in the United States, but this is the first instance of H7N8 HPAI virus detection in any species. Further information on the H7N8 findings is available in the Newsroom 2016 section at https://www.aphis.usda.gov/wps/portal/aphis/newsroom/news. III.

ACTION Veterinary Services is making the HPAI genomic sequence, as well as the HPAI virus courtesy of the Indiana State Board of Animal Health, available to facilities to encourage disease research and development to benefit the U.S. poultry industry. The complete genomic sequence for the HPAI can be found in the attached file. Sequence information has also been submitted to GenBank and will be available for both HPAI and LPAI viruses soon under accessions as follows: H7N8 HPAI KU558903-8910; H7N8 LPAI KU585905-12 and KU585913-20.

Animal and Plant Health Inspection Service Veterinary Services Center for Veterinary Biologics 1920 Dayton Avenue PO Box 844 Ames, IA 50010 (515) 337

-6100 CENTER FOR VETERINARY BIOLOGICS NOTICE NO. 16-XX Page 2 An Equal Opportunity Provider and Employer Available isolate:

• A/turkey/Indiana/16-001403-1/2016 – courtesy of the Indiana State Board of Animal Health Biologics firms that wish to obtain samples of these isolates for research purposes should:

A. Contact the NVSL Diagnostic Virology Laboratory at (515) 337-7551 for guidance regarding the appropriate forms and payments to submit.

B. Submit the completed forms and the payment associated with the order by one of the following methods:

1. Mail: NVSL User Fees, Box 844, Ames, Iowa 50010

2. Email: NVSL_concerns@aphis.usda.gov. The NVSL will inform customers when the virus is ready to ship.

C. Note that the HPAI isolate must be transferred in compliance with the Select Agent Regulations. No Material Transfer Agreement will be required. This isolate is a not pre-tested Master Seed; it is being made available for research and development. The availability of this isolate does not infer any impending change in vaccination policy. IV. IMPLEMENTATION/ APPLICABILITY The HPAI sequence is posted in this announcement, and the referenced reagent will be available from the NVSL no later than February 15, 2016. 

Share this post


Link to post
Share on other sites

>Seq1 [organism=Influenza A virus](A/turkey/Indiana/16-001403-1/2016(H7N8)) segment 1, polymerase PB2 (PB2) gene, complete cds. ATGGAGAGAATAAAAGAATTAAGAGATCTAATGTCACAGTCTCGCACTCGCGAGATACTAACCAAAACCACTGTT GACCACATGGCCATAATCAAAAAGTACACATCGGGAAGGCAAGAGAAGAACCCCGCACTCAGGATGAAATGGAT GATGGCAATGAAATATCCAATCACAGCAGATAAGCGAATAATGGAAATGATCCCTGAAAGGAATGAACAAGGGC AAACCCTCTGGAGCAAAACAAACGATGCCGGATCAGACCGAGTGATGGTATCACCTCTGGCTGTGACATGGTGGA ATAGGAATGGACCAACAACAAGTACAATTCACTACCCAAAGGTATATAAAACTTATTTCGAAAAAGTTGAAAGATT GAAACACGGGACCTTTGGCCCTGTACACTTCAGAAACCAAGTTAAGATAAGACGGAGAGTCGACATAAACCCGGG CCATGCTGACCTCAGTGCCAAAGAGGCGCAGGATGTAATCATGGAAGTTGTCTTTCCAAATGAAGTGGGAGCGAG AATACTGACATCGGAGTCACAACTGACAATAACAAAGGAGAAGAAGGAAGAACTCCAGGACTGCAAAATCGCCC CTCTGATGGTTGCATACATGCTAGAAAGAGAGTTGGTCCGCAAGACGAGGTTTCTCCCAGTGGCTGGTGGAACAA GCAGTGTCTACATTGAGGTGCTGCATCTGACCCAGGGGACATGCTGGGAGCAGATGTATACTCCAGGAGGAGAA GTGAGAAACGATGATGTAGACCAGAGCTTGATTATTGCTGCCAGGAACATAGTAAGAAGAGCAACAGTATCAGCA GACCCACTAGCGTCTCTATTGGAGATGTGCCACAGCACACAAATTGGGGGAATAAGGATGGTAGACATTCTTCGG CAAAATCCAACAGAGGAACAAGCCGTGGACATATGCAAGGCAGCAATGGGCCTGAGGATTAGCTCATCTTTCAGC TTCGGTGGATTCACTTTTAAAAGAACAAGTGGATCGTCAGTCAAAAGAGAAGAAGAAGTGCTTACGGGCAACCTT CAGACATTGAAAATAAGAGTACATGAGGGATATGAAGAGTTCACAATGGTTGGAAGAAGAGCAACGGCCATTCT CAGGAAGGCAACCAGAAGGCTGGTCCAGCTAATAGTAAGTGGAAGAGACGAGCAGTCAATTGCTGAAGCAATAA TTGTGGCCATGGTATTCTCACAAGAGGACTGCATGATTAAGGCAGTTCGAGGTGACCTGAATTTTGTCAATAGGGC GAACCAGCGGCTGAACCCAATGCATCAACTCTTGCGACACTTCCAAAAGGATGCAAAAGTGCTTTTCCAAAATTGG GGAATTGAACCCATTGACAATGTTATGGGAATGATCGGGATATTGCCCGACATGACCCCAAGTACTGAAATGTCG CTGAGGGGAATAAGAGTCAGTAAGATGGGAGTAGATGAATACTCCAGTACAGAGCGGGTAGTAGTAAGCATCGA CCGATTTTTAAGAGTTCGAGACCAACGGGGGAACGTACTATTGTCACCCGAGGAAGTCAGCGAGACACAAGGAAC GGAGAAATTGACAATCACTTATTCGTCATCAATGATGTGGGAGATCAATGGTCCTGAGTCGGTGTTGGTCAATACC TATCAGTGGATAATCAGAAACTGGGAAACTGTAAAAATTCAATGGTCACAGGATCCCACAATGTTGTATAATAAGA TGGAGTTCGAGCCATTTCAGTCTCTAGTCCCTAAGGCAGCCAGAGGTCAATACAGTGGGTTCGTGAGGACACTATT CCAGCAAATGCGAGATGTGCTTGGAACATTTGACACTGTTCAGATAATAAAACTCCTCCCCTTTGCTGCTGCCCCAC CGGAGCAAAGTAGGATGCAGTTCTCCTCCCTGACTGTGAATGTGAGAGGATCAGGAATGAGAATACTGGTAAGA GGCAATTCCCCGGTGTTCAATTACAACAAGGCCACCAAGAGGCTCACAGTTCTCGGGAAAGATGCAGGTGCATTG ACCGAAGATCCAGATGAAGGCACAGCTGGAGTGGAGTCTGCTGTTTTAAGAGGATTCCTCATTTTGGGCAAAGAA GACAAGAGATATGGCCCAGCACTGAGCATCAATGAGCTGAGCAATCTTGCAAAGGGAGAGAAGGCTAATGTGCT AATTGGGCAAGGAGACGTAGTGTTGGTGATGAAACGGAAACGGAACTCTAGCATACTTACTGACAGCCAGACAG CGACCAAAAGAATTCGGATGGCCATCAATTAGTGTCGAA

Share this post


Link to post
Share on other sites

>Seq2 [organism=Influenza A virus](A/turkey/Indiana/16-001403-1/2016(H7N8)) segment 2, polymerase PB1 (PB1) gene, complete cds. ATGGATGTCAATCCGACTTTACTTTTCTTGAAAGTTCCAGCGCAAAATGCCATAAGCACCACATTCCCGTATACTGG AGATCCTCCATACAGCCATGGAACAGGAACAGGATATACCATGGACACGGTTAACAGAACACATCAATATTCAGA AAAGGGGAAATGGACAACAAACTCAGAGACTGGAGCACCTCAGCTCAATCCAATTGATGGACCATTGCCTGAGGA CAATGAACCAAGTGGATATGCACAAACAGACTGTGTCCTTGAAGCAATGGCTTTTCTTGAAGAGTCCCACCCAGGA ATCTTTGAAAACTCGTGTCTTGAAACGATGGAAGTTGTTCAACAAACAAGAGTGGACAAATTGACCCAAGGTCGCC AGACCTATGATTGGACATTAAACAGGAATCAGCCGGCTGCAACTGCATTAGCCAATACTATAGAGGTCTTCAGATC GAACGGTCTTACAGCTAATGAATCAGGAAGACTAATAGATTTTCTCAAAGATGTGATGGAATCAATGGATAAAGA GGAAATGGAAATAACAACGCATTTCCAAAGGAAAAGAAGAGTGAGAGACAACATGACCAAGAAAATGGTCACAC AAAGGACAATAGGAAAGAAGAAGCAGAGGCTAAACAAAAAGAGCTATCTAATAAGAGCATTAACACTGAACACA ATGACAAAAGACGCCGAAAGAGGCAAATTGAAGAGAAGAGCAATTGCAACACCCGGAATGCAAATCAGAGGGTT TGTGTACTTTGTTGAAACATTAGCAAGGAGCATTTGTGAAAAGCTCGAACAATCTGGACTCCCAGTTGGAGGCAAT GAAAAGAAGGCTAAACTGGCAAATGTTGTGAGAAAAATGATGACTAATTCGCAAGACACAGAGCTCTCTTTCACA ATCACTGGAGACAACACCAAATGGAATGAAAACCAGAACCCTAGGATGTTTCTGGCAATGATAACGTATATAACA AGAAACCAACCTGAATGGTTCAGGAATGTCTTGAGTATTGCACCTATAATGTTCTCAAATAAAATGGCAAGACTAG GGAAAGGATACATGTTCGAAAGTAAGAGCATGAAGCTTCGAACACAAATACCGGCAGAAATGTTAGCAAGCATT GATCTGAAGTATTTCAATGAGTCAACACGGAAGAAAATAGAAAAGATAAGACCTCTTCTAATAGATGGTACAGCC TCATTGAGCCCTGGAATGATGATGGGCATGTTCAACATGTTGAGTACAGTTCTGGGAGTTTCGATTCTAAACCTAG GGCAAAAGAGGTACACCAAAACAACATACTGGTGGGACGGACTCCAATCCTCTGATGACTTTGCCCTCATAGTGA ATGCTCCGAATCATGAGGGAATACAAGCAGGTGTAGACAGATTCTACAGAACCTGCAAGCTGGTCGGAATCAACA TGAGCAAAAAGAAGTCCTACATAAACAGAACAGGGACATTTGAATTCACAAGTTTTTTCTACCGCTATGGATTCGT AGCCAACTTCAGCATGGAGTTGCCCAGCTTTGGAGTGTCCGGGATCAATGAATCTGCAGACATGAGCATTGGAGT AACAGTGATAAAAAACAACATGATCAACAATGATCTTGGACCAGCAACAGCCCAAATGGCTCTTCAGCTATTCATC AAGGATTACAGATACACGTATCGGTGTCACAGAGGAGACACACAAATTCAGACAAGGAGGTCATTCGAGCTGAA GAAGCTATGGGAACAAACCCGTTCAAAGGCAGGACTACTGGTCTCCGATGGAGGGCCAAATCTATACAATATCCG GAATCTCCACATTCCGGAAGTTTGCCTGAAATGGGAGCTAATGGATGAAGACTATCAGGGAAGGCTTTGTAACCC CCTGAATCCGTTTGTCAGCCACAAAGAGATAGAGTCTGTAAACAATGCTGTAGTGATGCCAGCTCATGGTCCAGCC AAGAGCATGGAATATGATGCTGTTGCCACCACGCATTCCTGGATACCTAAGAGGAACCGCTCCATTCTCAATACAA GCCAAAGGGGAATCCTTGAAGACGAACAGATGTATCAAAAGTGCTGCAATTTATTCGAGAAATTCTTCCCTAGCAG TTCATACAGGAGGCCGGTTGGAATTTCCAGCATGGTGGAGGCCATGGTTTCTAGGGCCCGAATTGATGCGCGAAT TGACTTCGAATCTGGACGGATCAAGAAGGAGGAGTTTGCTGAGATCATGAAGATCTGTTCCACCATTGAAGAGCT CAGACGGCAGAAATAGTGAATTTGGCTTGTCC

Share this post


Link to post
Share on other sites

>Seq3 [organism=Influenza A virus](A/turkey/Indiana/16-001403-1/2016(H7N8)) segment 3, polymerase PA (PA) gene, complete cds. ATGGAAGACTTTGTGCGACAATGCTTCAATCCAATGATCGTCGAGCTTGCGGAAAAGGCAATGAAAGAATATGGG GAAGATCCGAAAATCGAAACTAACAAGTTCGCTGCAATATGCACTCATTTGGAAGTCTGTTTCATGTATTCGGATTT CCATTTCATTGATGAACGGGGCGAATCAATAATTGTGGAATCTGGTGATCCAAATGCATTACTGAAGCATCGATTT GAGATAATTGAAGGAAGAGACAGAACAATGGCCTGGACAGTGGTGAATAGCATCTGCAACACCACGGGGGTCGA GAAGCCTAAGTTCCTTCCGGATCTGTATGATTACAAGGAGAACCGATTCATTGAAATTGGGGTGACACGGAGAGA GGTCCATATATATTACCTAGAGAAAGCCAACAAGATAAAATCCGAGAAGACACACATTCACATCTTCTCATTCACT GGAGAAGAGATGGCCACCAAAGCAGACTACACCCTTGACGAAGAAAGCAGAGCAAGGATTAAAACCAGACTATT CACTATAAGACAAGAGATGGCCAGCAGAGGTCTATGGGATTCCTTTCGTCAGTCCGAAAGAGGCGAAGAGACAAT TGAAGAAAGATTTGAAATCACAGGAACCATGCGCAGGCTTGCCGACCAAAGTCTCCCACCGAACTTCTCCAGCCTT GAAAACTTTAGAGCCTATGTGGATGGATTCGAACCGAACGGCTGCATTGAGGGCAAGCTTTCTCAAATGTCCAAA GAAGTGAACGCCAGAATTGAGCCATTTTTGAAAACAACACCACGCCCTCTCAAATTGCCTGATGGGCCCCCTTGCT CTCAGCGGTCAAAATTCTTGCTGATGGATGCCTTGAAACTAAGCATTGAAGACCCAAGTCATGAGGGAGAGGGGA TACCGCTGTACGATGCAATTAAATGCATGAAGACATTTTTCGGCTGGAAAGAGCCCAATATAATCAAACCACATGA AAAGGGCATAAACCCTAACTATCTCCTGGCTTGGAAGCAAGTGCTAGCAGAACTCCAGGGCCTTGAAAATGAAGA GAAAATTCCAAAGACGAAGAACATGAAGAAAACAAGTCAATTAAAGTGGGCACTTGGCGAGAATATGGCACCAG AAAAAGTGGACTTTGAGGATTGCAAGGATGTTGGCGATCTAAAACAGTATGATAGCGATGAGCCAGAGCCTAGAT CGCTAGCAAGCTGGATCCAGAGTGAATTCAACAAGGCATGTGAATTGACCGACTCAAGCTGGATAGAACTGGATG AAATAGGGGAAGATGTTGCTCCGATTGAACACATTGCAAGTATGAGGAGGAATTATTTCACAGCAGAAGTGTCCC ATTGCAGGGCCACTGAATACATAATGAAAGGAGTCTACATAAATACAGCTCTGCTCAATGCATCTTGCGCGGCCAT GGATGACTTCCAGCTGATTCCAATGATAAGCAAATGTAGGACCAAAGAAGGAAGACGGAAAACAAACCTGTATG GGTTCATCATAAAGGGAAGGTCTCATTTGAGGAATGATACCGATGTGGTAAATTTTGTAAGTATGGAGTTTTCTCT CACCGACCCAAGGCTGGAACCACACAAATGGGAAAAGTACTGCGTTCTTGAGGTGGGAGATATGCTCCTGAGGAC TGCAATAGGCCAAGTATCAAGACCCATGTTCCTGTATGTTAGGACCAACGGGACCTCCAAAATCAAGATGAAATG GGGTATGGAGATGAGGCGTTGCCTTCTTCAGTCTCTTCAACAGATTGAAAGCATGATTGAGGCCGAGTCCTCAGTC AAAGAAAAAGACATGACCAAAGAATTTTTTGAGAACAAGTCGGAAACGTGGCCAATTGGAGAGTCCCCCAGAGG GGTAGAGGAAGGATCCATTGGGAAGGTATGCAGAACCCTGCTAGCAAAATCTGTGTTCAACAGTCTATATGCATC CCCACAACTTGAGGGATTTTCAGCAGAATCGAgGAAACTGCTTCTCATTGTTCAGGCACTTAGGGACAACCTGGAA CCTGGAACCTTCGATCTTGGAGGGCTATACGAAGCAATTGAGGAGTGCCTGATTAATGATCCCTGGGTTTTGCTTA ATGCATCTTGGTTCAACTCCTTCCTCACACATGCACTGAAATAGTTGTGGCAATGCTACTATTTGCTATCCATAC

Share this post


Link to post
Share on other sites

>Seq4 [organism=Influenza A virus](A/turkey/Indiana/16-001403-1/2016(H7N8)) segment 4, hemagglutinin (HA) gene, complete cds. TACAAAATGAACACTCAAATTTTGGCACTCATTGCTTGTATGCTGATCGGAGCTAAAGGAGACAAAATATGTCTTG GGCACCATGCTGTGGCAAATGGAACAAAAGTGAACACACTAACAGAGAGAGGAATCGAAGTGGTAAATGCCACA GAAACGGTGGAGACTGCAAATATTAAGAAAATATGCACTCAGGGGAAAAGACCAACAGATCTGGGACAATGCGG ACTTCTAGGAACCCTAATAGGACCTCCCCAATGCGATCAATTCCTGGAGTTTGACGCTGATTTAATAATTGAACGG AGAGAAGGAACGGATGTGTGTTATCCTGGGAAGTTCACAAATAAAGAATCACTGAGGCAGATCCTCCGAGGGTC AGGAGGAATTGATAAGGAATCAATGGGTTTCACTTATAGTGGAATAAGAACCAATGGGGCAACGAGTGCTTGCA GAAGATCAGGTTCTTCCTTCTATGCGGAGATGAAGTGGTTATTGTCGAATTCAGACAATGCGGCTTTTCCCCAAAT GACTAAGTCGTACAGAAATCCCAGGAGCAAACCAGCTCTAATAATTTGGGGAGTGCATCACTCTGGATCGGTTACT GAACAGACCAAACTCTATGGGAGTGGAAACAAGTTGATAACAGTAGGAAGCTCGAAATACCAGCAGTCATTCACC CCAAGCCCGGGGGCACGACCACAGGTGAATGGGCAATCAGGAAGGATTGATTTTCATTGGCTACTCCTTGACCCC AACGACACAGTGACTTTCACTTTCAATGGGGCATTCATAGCTCCTGACAGAGCAAGTTTCCTTAGAGGGGAGTCAC TAGGAGTTCAAAGTGACGTTCCTTTGGATTCTAGTTGCAAGGGGGATTGCTTCCACAATGGAGGTACGATAGTGA GCTCACTGCCATTCCAGAACATCAACCCTAGAACAGTGGGAAAATGCCCTCGATATGTCAAACAGACAAGCCTCCT CTTGGCTACAGGGATGAGGAACGTCCCAGAGAACCCCAAAAAAAGAAAGACCAGAGGTCTTTTTGGAGCGATTG CTGGATTCATAGAGAATGGGTGGGAAGGCCTCATTGATGGATGGTACGGTTTCAGGCATCAAAATGCACAAGGA GAAGGTACTGCAGCTGATTACAAAAGCACTCAATCTGCAATAGATCAGATCACAGGCAAATTGAATCGTCTAATTG ACAAAACAAATCAGCAGTTTGAACTGATAGACAACGAATTCAGTGAAATAGAACAACAGATTGGGAATGTCATTA ATTGGACACGAGATTCAATGACTGAAGTATGGTCGTATAATGCTGAACTGCTGGTAGCTATGGAAAATCAGCACA CAATAGATCTTGCAGACTCAGAAATGAACAAACTTTACGAGCGTGTAAGGAAACAACTGAGGGAGAATGCTGAA GAGGATGGGACTGGATGCTTTGAGATATTCCATAAGTGTGATGATCAATGCATGGAGAGCATAAGGAACAACACC TACGACCATACCCAATACAGAGCAGAGTCATTGCAGAATAGAATACAGATAGACCCAGTGAAACTGAGTAGTGGA TACAAAGACATAATCTTATGGTTTAGCTTCGGGGCATCATGTTTTCTTCTTCTAGCCATTGCAATGGGATTGGTCTT CATTTGCATAAAGAATGGAAACATGCGGTGCACTATTTGTATATAGTTTGAGA

Share this post


Link to post
Share on other sites

>Seq5 [organism=Influenza A virus](A/turkey/Indiana/16-001403-1/2016(H7N8)) segment 5, nucleoprotein (NP) gene, complete cds. TCACTCACTGAGTGACATCCACATCATGGCGTCTCAAGGCACCAAACGATCTTACGAACAAATGGAAACTGGTGG GGAACGCCAGAATGCCACTGAAATCAGAGCATCTGTTGGAAGAATGGTTGGCGGAATCGGGAGATTCTACATACA GATGTGCACTGAGCTCAAACTCAGTGACTACGAAGGGAGACTGATCCAAAACAGCATTACCATAGAGAGGATGGT TCTCTCAGCATTTGATGAGAGGAGAAACAAGTATCTGGAGGAGCATCCCAGTGCTGGGAAAGATCCCAAGAAGAC TGGAGGCCCAATCTACAGAAGGAGAGATGGCAAATGGATGAGAGAGTTGATCCTATATGACAAAGAAGAGATCA GAAGAATTTGGCGTCAAGCTAATAATGGGGAGGACGCAACTGCTGGTCTCACCCATATGATGATTTGGCATTCTA ATCTGAATGATGCCACATACCAGAGAACAAGGGCACTTGTGCGTACTGGAATGGACCCCAGGATGTGCTCTCTGA TGCAAGGCTCAACCCTCCCAAGGAGGTCTGGGGCTGCAGGAGCGGCAGTGAAAGGGGTTGGGACAATGGTGAT GGAATTGATCCGGATGATCAAGCGAGGGATCAATGATCGGAATTTCTGGAGAGGCGAAAATGGACGGAGAACTA GAATTGCCTACGAGAGAATGTGCAACATCCTCAAGGGAAAATTCCAAACAGCAGCACAACGAGCAATGATGGACC AAGTGAGGGAAAGCCGGAATCCTGGGAACGCTGAAATTGAAGATCTCATCTTTCTCGCACGGTCTGCTCTCATTCT GAGGGGATCAGTGGCTCATAAGTCCTGCCTGCCTGCTTGTGTGTATGGACTTGCTGTAGTCAGTGGATACGACTTT GAGAGAGAGGGGTACTCTCTAGTCGGAATTGATCCTTTCCGTCTGCTCCAAAACAGCCAAGTCTTCAGTCTCATCA GACCAAACGAAAATCCAGCGCACAAAAGTCAGCTGGTATGGATGGCATGCCACTCTGCAGCATTTGAAGATCTGA GAGTGTCAAGCTTCATCAGAGGAACAAGAGTAGTCCCAAGAGGACAACTGTCCACCAGAGGAGTTCAGATTGCTT CAAATGAGAACATGGAGACAATGGACTCCAATACTCTTGAATTGAGGAGCAGATACTGGGCTATAAGAACAAGAA GCGGAGGGAACACCAACCAGCAGAGGGCATCTGCAGGACAAATCAGCGTACAGCCCACATTCTCTGTGCAGAGA AACCTCCCATTCGAGAGAGCAACCATCATGGCAGCATTTACGGGAAACACTGAGGGCAGAACTTCAGACATGAGA ACTGAGATCATAAGGATGATGGAAAATGCCAGACCTGAAGATGTGTCTTTCCAGGGGCGGGGAGTCTTCGAGCTC TCGGACGAAAAGGCAACGAACCCGATCGTGCCTTCCTTTGACATGAGTAATGAAGGATCTTATTTCTTCGGAGACA ATGCAGAGGAGTATGACAATTAAAG

Share this post


Link to post
Share on other sites

>Seq6 [organism=Influenza A virus](A/turkey/Indiana/16-001403-1/2016(H7N8)) segment 6, neuraminidase (NA) gene, complete cds. ATGAATCCAAATAAGAAAATAATAACCATTGGTTCAGTGTCCTTAGGATTGGTAGTCCTTAACATTCTCCTACATAT AGTTAGCATTACAGTAACAGTGTTAGTTCTTCCTGGAAATGGAAATAACGGGAATTGCAATGAAACAGTCATTAGA GAATACAATGAAACAGTAAGGATTGAGAAGGTAACACAATGGCACAATACCAATGTCATTGAGTATATAGAAAGG CCAGAGAATGATCATTTCATGAACAATACAGAAGCATTGTGTGATGCCAAGGGGTTTGCACCCTTTTCCAAAGACA ATGGAATAAGAATTGGATCGAGAGGTCATATTTTTGTTATAAGAGAACCATTTGTTTCTTGCTCTCCAACAGAGTG CAGGACGTTCTTCCTTACTCAGGGTTCCTTACTCAATGACAAACACTCCAATGGCACAGTAAAAGACCGGAGCCCT TATAGAACTCTAATGAGTGTAGAAATAGGGCAGTCACCCAATGTGTACCAGGCAAGGTTTGAGGCAGTAGCGTGG TCAGCCACTGCATGTCATGATGGGAAGAAATGGATGACAATTGGAGTGACGGGCCCTGATGCCGAAGCAGTAGC AGTAGTGCACTATGGGGGAATTCCTACTGATGTAATCAATTCCTGGGCAGGGGATATTCTAAGAACTCAGGAATC ATCATGTACTTGCATTCAAGGTGAATGTTATTGGGTAATGACGGACGGACCAGCAAACAGACAAGCACAATATAG AGCATTCAAGGCCAAGCAGGGGAAAATAGTTGGGCAAACTGAAATCAGTTTTAATGGAGGCCATATAGAAGAAT GTTCATGCTACCCTAATGAAGGTAAAGTGGAATGTGTTTGTAGGGACAATTGGACTGGAACCAACAGACCAGTAT TGGTGATTTCTCCAGATTTGTCTTACAGAGTCGGATACTTGTGTGCAGGTCTCCCCAGTGACACTCCAAGAGGAGA AGATAGTCAGTTCACAGGATCCTGCACTAGCCCGATGGGAAATCAGGGATATGGAGTTAAGGGATTTGGATTCAG GCAGGGCAATGATTTATGGATGGGAAGGACCATTAGCAGAACATCAAGATCAGGATTTGAAATCCTGAAAGTCAG AAATGGCTGGGTACAAAATAGTAAAGAGCAGATCAAAAGGCAAGTTGTGGTCGATAACCTGAACTGGTCAGGAT ACAGTGGTTCCTTCACACTACCGGTGGAGTTGACAAAAAGAAATTGTCTGGTTCCATGCTTTTGGGTTGAGATGAT AAGGGGGAAGCCAGAAGAAAAGACTATATGGACCTCAAGTAGCTCCATTGTGATGTGTGGAGTAGACCATGAGA TTGCCGACTGGTCATGGCACGATGGAGCTATTCTTCCTTTTGACATCGACAAGATGTAATTTACG

Share this post


Link to post
Share on other sites

>Seq7 [organism=Influenza A virus](A/turkey/Indiana/16-001403-1/2016(H7N8)) segment 7, matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds. GAAAGATGAGTCTTCTAACCGAGGTAGAAACGTACGTTCTCTCTATCGTCCCGTCAGGCCCCCTCAAAGCCGAGAT CGCGCAGAGACTTGAAGATGTGTTTGCAGGGAAAAACACCGACCTTGAGGCGCTCATGGAATGGCTAAAGACAA GACCAATCCTGTCACCTCTGACTAAGGGGATTTTGGGATTTGTGTTCACGCTCACCGTGCCCAGTGAGCGAGGACT GCAGCGTAGACGCTTTGTCCAAAATGCCCTTAATGGGAATGGGGATCCAAACAACATGGACAGAGCAGTTAAACT GTACAGGAAGCTTAAAAGGGAAATAACATTCCATGGGGCAAAAGAGGTGGCACTCAGTTATTCGACTGGTGCACT TGCCAGCTGCATGGGCCTCATATACAACAGAATGGGGACGGTGACCACTGAGGTGGCATTTGGCCTGGTGTGTGC CACATGTGAGCAGATTGCTGATTCCCAGCATCGGTCTCACAGACAAATGGTGACAACAACCAACCCGCTGATCAG GCACGAGAACAGGATGGTACTGGCCAGTACTACGGCTAAGGCCATGGAACAAATGGCAGGATCAAGTGAGCAGG CAGCAGAGGCCATAGAGGTTGCTAGTCAGGCTAGGCAGATGGTGCAGGCAATGAGGACCATTGGGACTCATCCT AGCTCCAGTGCTGGTCTGAAAGATGATCTTCTTGAAAATTTGCAGGCCTACCAGAAACGGATGGGAGTGCAAATG CAACGATTCAAGTGATCCTCTCGTTATTGCCGCAAGTATCATTGGGATCTTGCACTTGATATTGTGGATTCTTGATC GCCTTTTCTTCAAATGCATTTATCGTCGCCTTAAATACGGTTTGAAAAGAGGGCCTTCTACGGAAGGAGTGCCTGA GTCTATGAGGGAAGAATATCGGCAGGAACAGCAGAGTGCTGTGGATGTTGACGATGGTCATTTTGTCAACATAGA GCTGGAGTAA

Share this post


Link to post
Share on other sites

>Seq8 [organism=Influenza A virus](A/turkey/Indiana/16-001403-1/2016(H7N8)) segment 8, nonstructural protein NS1 and non-structural protein NS2 (NS) gene, complete cds. TACATAATGGATTCCAACACGATAACCTCGTTTCAGGTAGATTGCTATCTATGGCACATAAGGAAGCTGCTCAGCA TGAGAGACATGTGTGATGCTCCCTTTGATGACAGACTCAGGAGAGATCAAAAGGCATTAAAGGGAAGAGGTAGC ACACTTGGGCTCGATCTGCGAGTGGCCACAATGGACGGTAAAAAGATTGTTGAAGACATCCTGAAAAGTGAGACT GATGAAAATCTCAAAATTGCAATTGCATCCAGCCCTGCTCCTCGGTATATTACCGATATGAGTATAGAGGAAATAA GTAGAGAATGGTACATGCTCATGCCAAGACAGAAGATAACAGGGGGTCTGATGGTGAAAATGGACCAGGCAATC ATGGATAAGAGAATAATACTCAAAGCAAACTTTTCTGTCCTATTTGATCAATTGGAAACATTAGTCTCACTGAGGG CTTTCACCGACGATGGCGCCATTGTAGCTGAAATATCTCCCATTCCTTCTATGCCAGGACATTCTACAGAGGATGTC AAAGATGCAATTGGAATCCTCATCGGTGGACTTGAATGGAATGATAACTCAATTCGAGCGTCTGAAAATATACAG AGATATGCTTGGGGAATCCGTGATGAGAATGGGGGATCTCCATTCCCTCCAAAGCAGAAACGCCACATGGCGAGA AGAGTTGAGTCAGAAGTTTGAAGAGATCAGATGGCTGATTGCAGAGTGCAGGAACATATTAACCAAAACTGAAA ACAGTTTCGAGCAGATAACGTTCTTGCAAGCATTGCAACTCTTACTTGAAGTTGAGAGTGAGATAAGAACATTTTC TTTTCAGCTTATTTAATACTAA

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI645556A/blue-winged teal/Iowa/13OS2316/2013 (A/H7N3) segment 4 (HA)2900.40.000000e+001653/1692 (97%)
text_code_colored.pngEPI594839A/mallard/Maryland/13OS3019/2014 (A/H0) segment 4 (HA)2872.70.000000e+001648/1692 (97%)
text_code_colored.pngEPI526172A/blue-winged teal/Ohio/13OS2037/2013 (A/H7N1) segment 4 (HA)2867.10.000000e+001647/1692 (97%)
text_code_colored.pngEPI419496A/American green-winged teal/Mississippi/11OS247/2011 (A/H0) segment 4 (HA)2784.00.000000e+001632/1692 (96%)
text_code_colored.pngEPI413380A/mallard/Missouri/10MO0551/2010 (A/H7N7) segment 4 (HA)2761.90.000000e+001628/1692 (96%)
text_code_colored.pngEPI689616A/blue winged teal/Minnesota/A00137660/2009 (A/H7N3) segment 4 (HA)2756.30.000000e+001627/1692 (96%)
text_code_colored.pngEPI419540A/American green-winged teal/Mississippi/11OS259/2011 (A/H0) segment 4 (HA)2756.30.000000e+001627/1692 (96%)
text_code_colored.pngEPI419497A/American green-winged teal/Mississippi/11OS250/2011 (A/H7N3) segment 4 (HA)2756.30.000000e+001627/1692 (96%)
text_code_colored.pngEPI419085A/American black duck/Wisconsin/10OS3949/2010 (A/H7N8) segment 4 (HA)2756.30.000000e+001627/1692 (96%)
text_code_colored.pngEPI418762A/American green-winged teal/Illinois/10OS3368/2010 (A/H7N7) segment 4 (HA)2756.30.000000e+001627/1692 (96%)
text_code_colored.pngEPI418759A/American green-winged teal/Illinois/10OS3329/2010 (A/H7N7) segment 4 (HA)2756.30.000000e+001627/1692 (96%)
text_code_colored.pngEPI616891A/mallard/Alberta/590/2010 (A/H7N8) segment 4 (HA)2750.80.000000e+001626/1692 (96%)
text_code_colored.pngEPI418597A/northern shoveler/Arkansas/11OS333/2011 (A/H0) segment 4 (HA)2750.80.000000e+001626/1692 (96%)
text_code_colored.pngEPI419446A/northern shoverl/Mississippi/11OS145/2011 (A/H7N9) segment 4 (HA)2745.20.000000e+001625/1692 (96%)
text_code_colored.pngEPI419234A/northern shoveler/Missouri/10OS4750/2010 (A/H7N3) segment 4 (HA)2745.20.000000e+001625/1692 (96%)
text_code_colored.pngEPI419498A/American green-winged teal/Mississippi/11OS255/2011 (A/H7N7) segment 4 (HA)2739.70.000000e+001624/1692 (95%)
text_code_colored.pngEPI419181A/northern shoveler/Missouri/10OS4632/2010 (A/H7N7) segment 4 (HA)2739.70.000000e+001624/1692 (95%)
text_code_colored.pngEPI418570A/northern shoveler/Arkansas/11OS171/2011 (A/H0) segment 4 (HA)2739.70.000000e+001624/1692 (95%)
text_code_colored.pngEPI419184A/northern shoveler/Missouri/10OS4700/2010 (A/H0) segment 4 (HA)2734.20.000000e+001623/1692 (95%)
text_code_colored.pngEPI616787A/blue-winged teal/Texas/AI12-909/2012 (A/H7N1) segment 4 (HA)2728.60.000000e+001622/1692 (95%)
text_code_colored.pngEPI419703A/American wigeon/Missouri/10MO0530/2010 (A/H0) segment 4 (HA)2728.60.000000e+001622/1692 (95%)
text_code_colored.pngEPI419542A/northern shoveler/Mississippi/11OS202/2011 (A/H7N7) segment 4 (HA)2728.60.000000e+001623/1693 (95%)
text_code_colored.pngEPI419233A/gadwall/Missouri/10OS4731/2010 (A/H7N3) segment 4 (HA)2728.60.000000e+001622/1692 (95%)
text_code_colored.pngEPI689523A/American green winged teal/Mississippi/A00630203/2009 (A/H7N6) segment 4 (HA)2723.10.000000e+001621/1692 (95%)
text_code_colored.pngEPI419543A/northern shoveler/Mississippi/11OS289/2011 (A/H7N3) segment 4 (HA)2723.10.000000e+001621/1692 (95%)
text_code_colored.pngEPI299451A/northern shoveler/Mississippi/09OS643/2009 (A/H7N7) segment 4 (HA)2723.10.000000e+001621/1692 (95%)
text_code_colored.pngEPI690006A/northern shoveler/Mississippi/A00602284/2009 (A/H0) segment 4 (HA)2717.50.000000e+001620/1692 (95%)
text_code_colored.pngEPI690005A/northern shoveler/Louisiana/A00557321/2009 (A/H7N3) segment 4 (HA)2717.50.000000e+001620/1692 (95%)
text_code_colored.pngEPI689614A/blue winged teal/Louisiana/A00557206/2009 (A/H7N7) segment 4 (HA)2717.50.000000e+001620/1692 (95%)
text_code_colored.pngEPI616857A/blue-winged teal/Louisiana/AI11-2911/2011 (A/H7N3) segment 4 (HA)2717.50.000000e+001620/1692 (95%)
text_code_colored.pngEPI512246A/northern shoveler/Mississippi/12OS231/2012 (A/H0) segment 4 (HA)2717.50.000000e+001620/1692 (95%)
text_code_colored.pngEPI512215A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 4 (HA)2717.50.000000e+001620/1692 (95%)
text_code_colored.pngEPI512201A/American green-winged teal/Mississippi/12OS397/2012 (A/H7N7) segment 4 (HA)2717.50.000000e+001620/1692 (95%)
text_code_colored.pngEPI512194A/northern shoveler/Mississippi/12OS362/2012 (A/H7N7) segment 4 (HA)2717.50.000000e+001620/1692 (95%)
text_code_colored.pngEPI487352A/guinea fowl/Nebraska/17096/2011 (A/H7N9) segment 4 (HA)2717.50.000000e+001621/1693 (95%)
text_code_colored.pngEPI487328A/goose/Nebraska/17097/2011 (A/H7N9) segment 4 (HA)2717.50.000000e+001621/1693 (95%)
text_code_colored.pngEPI399915A/goose/Nebraska/17097-4/2011 (A/H7N9) segment 4 (HA)2717.50.000000e+001621/1693 (95%)
text_code_colored.pngEPI398565A/chicken/Jalisco/12283/2012 (A/H7N3) segment 4 (HA)2717.50.000000e+001631/1707 (95%)
text_code_colored.pngEPI299347A/American green-winged teal/Mississippi/09OS046/2009 (A/H7N7) segment 4 (HA)2717.50.000000e+001620/1692 (95%)
text_code_colored.pngEPI690008A/northern shoveler/Mississippi/A00682947/2008 (A/H7N7) segment 4 (HA)2712.00.000000e+001619/1692 (95%)
text_code_colored.pngEPI689690A/bufflehead/Virginia/A00120022/2008 (A/H7N2) segment 4 (HA)2712.00.000000e+001619/1692 (95%)
text_code_colored.pngEPI512180A/northern shoveler/Mississippi/12OS347/2012 (A/H7N7) segment 4 (HA)2712.00.000000e+001619/1692 (95%)
text_code_colored.pngEPI399917A/guinea fowl/Nebraska/17096-1/2011 (A/H7N9) segment 4 (HA)2712.00.000000e+001620/1693 (95%)
text_code_colored.pngEPI383755A/chicken/Jalisco/CPA1/2012 (A/H7N3) segment 4 (HA)2712.00.000000e+001630/1707 (95%)
text_code_colored.pngEPI689774A/mallard/New Jersey/A00122457/2008 (A/H7N8) segment 4 (HA)2706.50.000000e+001618/1692 (95%)
text_code_colored.pngEPI616845A/blue-winged teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 4 (HA)2706.50.000000e+001618/1692 (95%)
text_code_colored.pngEPI512299A/northern shoveler/Arkansas/12OS158/2012 (A/H7N1) segment 4 (HA)2706.50.000000e+001618/1692 (95%)
text_code_colored.pngEPI449900A/blue-winged Teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 4 (HA)2706.50.000000e+001618/1692 (95%)
text_code_colored.pngEPI418798A/American green-winged teal/Illinois/10OS4014/2010 (A/H7N3) segment 4 (HA)2706.50.000000e+001618/1692 (95%)
text_code_colored.pngEPI569396A/blue-winged teal/LA/AI11-2911/2011 (A/H7N3) segment 4 (HA)2704.60.000000e+001612/1684 (95%)
text_code_colored.pngEPI585179A/redhead/Ohio/13OS0406/2013 (A/H7N3) segment 4 (HA)2700.90.000000e+001617/1692 (95%)
text_code_colored.pngEPI512431A/northern shoveler/Illinois/11OS4404/2011 (A/H7N3) segment 4 (HA)2700.90.000000e+001618/1693 (95%)
text_code_colored.pngEPI487317A/turkey/Minnesota/32710/2011 (A/H7N9) segment 4 (HA)2700.90.000000e+001618/1693 (95%)
text_code_colored.pngEPI487309A/turkey/Minnesota/31900/2011 (A/H7N9) segment 4 (HA)2700.90.000000e+001618/1693 (95%)
text_code_colored.pngEPI689773A/mallard/Nebraska/A00709657/2009 (A/H7N3) segment 4 (HA)2695.40.000000e+001617/1693 (95%)
text_code_colored.pngEPI689619A/blue winged teal/South Dakota/A00772794/2009 (A/H7N7) segment 4 (HA)2695.40.000000e+001616/1692 (95%)
text_code_colored.pngEPI689831A/mallard/New Jersey/A00926089/2010 (A/H7N3) segment 4 (HA)2689.80.000000e+001615/1692 (95%)
text_code_colored.pngEPI616382A/northern shoveler/Illinois/12OS4951/2012 (A/H7N3) segment 4 (HA)2689.80.000000e+001615/1692 (95%)
text_code_colored.pngEPI393388A/Mexico/InDRE7218/2012 (A/H7N3) segment 4 (HA)2689.80.000000e+001626/1707 (95%)
text_code_colored.pngEPI463745A/mallard/Minnesota/AI09-1714/2009 (A/H7N1) segment 4 (HA)2686.10.000000e+001614/1692 (95%)
text_code_colored.pngEPI689769A/mallard/Iowa/A00558620/2008 (A/H7N3) segment 4 (HA)2684.30.000000e+001615/1693 (95%)
text_code_colored.pngEPI689688A/blue winged teal/Texas/A00605473/2009 (A/H7N3) segment 4 (HA)2684.30.000000e+001614/1692 (95%)
text_code_colored.pngEPI689550A/American green winged teal/Texas/A00604814/2009 (A/H7N3) segment 4 (HA)2684.30.000000e+001614/1692 (95%)
text_code_colored.pngEPI689549A/American green winged teal/Texas/A00604032/2009 (A/H7N3) segment 4 (HA)2684.30.000000e+001614/1692 (95%)
text_code_colored.pngEPI689546A/American green winged teal/Texas/A00604024/2009 (A/H7N3) segment 4 (HA)2684.30.000000e+001614/1692 (95%)
text_code_colored.pngEPI418896A/common goldeneye/Wisconsin/10OS4202/2010 (A/H7N6) segment 4 (HA)2684.30.000000e+001614/1692 (95%)
text_code_colored.pngEPI689707A/blue winged teal/Texas/A00676566/2009 (A/H7N3) segment 4 (HA)2678.80.000000e+001613/1692 (95%)
text_code_colored.pngEPI689522A/American green winged teal/Mississippi/A00468514/2009 (A/H7N7) segment 4 (HA)2678.80.000000e+001613/1692 (95%)
text_code_colored.pngEPI526461A/American green-winged teal/Wisconsin/13OS3468/2013 (A/H7N3) segment 4 (HA)2678.80.000000e+001613/1692 (95%)
text_code_colored.pngEPI689547A/American green winged teal/Texas/A00604029/2009 (A/H7N3) segment 4 (HA)2673.20.000000e+001612/1692 (95%)
text_code_colored.pngEPI434477A/mallard/Nova Scotia/00372/2010 (A/H7N7) segment 4 (HA)2673.20.000000e+001612/1692 (95%)
text_code_colored.pngEPI434430A/American black duck/New Brunswick/00344/2010 (A/H7N7) segment 4 (HA)2673.20.000000e+001612/1692 (95%)
text_code_colored.pngEPI434481A/green-winged teal/New Brunswick/00392/2010 (A/H7N7) segment 4 (HA)2667.70.000000e+001611/1692 (95%)
text_code_colored.pngEPI616037A/northern shoveler/Ohio/12OS5539/2012 (A/H7N3) segment 4 (HA)2662.10.000000e+001610/1692 (95%)
text_code_colored.pngEPI645360A/American green-winged teal/Ohio/13OS1769/2013 (A/H7N2) segment 4 (HA)2656.60.000000e+001610/1693 (95%)
text_code_colored.pngEPI645353A/blue-winged teal/Ohio/13OS1770/2013 (A/H7N3) segment 4 (HA)2656.60.000000e+001610/1693 (95%)
text_code_colored.pngEPI616030A/American green-winged teal/Ohio/12OS5538/2012 (A/H7N3) segment 4 (HA)2656.60.000000e+001609/1692 (95%)
text_code_colored.pngEPI526457A/blue-winged teal/Ohio/13OS1773/2013 (A/H7N3) segment 4 (HA)2656.60.000000e+001610/1693 (95%)
text_code_colored.pngEPI526270A/American green-winged teal/Ohio/13OS1777/2013 (A/H7N3) segment 4 (HA)2656.60.000000e+001610/1693 (95%)
text_code_colored.pngEPI487934A/turkey/Minnesota/20400/2009 (A/H7N9) segment 4 (HA)2645.50.000000e+001608/1693 (94%)
text_code_colored.pngEPI487926A/turkey/Minnesota/18421/2009 (A/H7N9) segment 4 (HA)2645.50.000000e+001608/1693 (94%)
text_code_colored.pngEPI487918A/turkey/Minnesota/15591/2009 (A/H7N9) segment 4 (HA)2645.50.000000e+001608/1693 (94%)
text_code_colored.pngEPI487295A/turkey/Minnesota/14135-2/2009 (A/H7N9) segment 4 (HA)2645.50.000000e+001608/1693 (94%)
text_code_colored.pngEPI690004A/northern pintail/Texas/A00466052/2009 (A/H7N3) segment 4 (HA)2640.00.000000e+001607/1693 (94%)
text_code_colored.pngEPI689871A/mallard/Oklahoma/A00744383/2009 (A/H7N3) segment 4 (HA)2640.00.000000e+001606/1692 (94%)
text_code_colored.pngEPI689771A/mallard/Michigan/A00869519/2009 (A/H7N3) segment 4 (HA)2640.00.000000e+001606/1692 (94%)
text_code_colored.pngEPI689739A/mallard/Illinois/A00325439/2009 (A/H7N3) segment 4 (HA)2640.00.000000e+001606/1692 (94%)
text_code_colored.pngEPI414400A/northern pintail/Interior Alaska/10BM02539R0/2010 (A/H7N3) segment 4 (HA)2640.00.000000e+001607/1693 (94%)
text_code_colored.pngEPI690010A/northern shoveler/Oklahoma/A00744384/2009 (A/H7N3) segment 4 (HA)2634.40.000000e+001605/1692 (94%)
text_code_colored.pngEPI689838A/mallard/Oklahoma/A00749161/2009 (A/H7N3) segment 4 (HA)2634.40.000000e+001605/1692 (94%)
text_code_colored.pngEPI689767A/mallard/Illinois/A00755320/2009 (A/H7N3) segment 4 (HA)2634.40.000000e+001605/1692 (94%)
text_code_colored.pngEPI616996A/mallard/Alberta/192/2010 (A/H7N3) segment 4 (HA)2634.40.000000e+001606/1693 (94%)
text_code_colored.pngEPI616983A/mallard/Alberta/167/2010 (A/H7N3) segment 4 (HA)2634.40.000000e+001606/1693 (94%)
text_code_colored.pngEPI487910A/turkey/Minnesota/14659/2009 (A/H7N9) segment 4 (HA)2634.40.000000e+001606/1693 (94%)
text_code_colored.pngEPI487303A/turkey/Minnesota/31676/2009 (A/H7N9) segment 4 (HA)2634.40.000000e+001607/1694 (94%)
text_code_colored.pngEPI451949A/northern pintail/Interior Alaska/10BM11038R0/2010 (A/H7N3) segment 4 (HA)2634.40.000000e+001605/1692 (94%)
text_code_colored.pngEPI451921A/northern pintail/Interior Alaska/10BM11366R0/2010 (A/H7N3) segment 4 (HA)2634.40.000000e+001605/1692 (94%)
text_code_colored.pngEPI451746A/northern pintail/Interior Alaska/10BM09348R0/2010 (A/H7N3) segment 4 (HA)2634.40.000000e+001605/1692 (94%)
text_code_colored.pngEPI451739A/northern pintail/Interior Alaska/10BM09347R0/2010 (A/H7N3) segment 4 (HA)2634.40.000000e+001605/1692 (94%)
text_code_colored.pngEPI451697A/northern pintail/Interior Alaska/10BM08586R0/2010 (A/H7N3) segment 4 (HA)2634.40.000000e+001605/1692 (94%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI512876A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 6 (NA)2544.00.000000e+001401/1413 (99%)
text_code_colored.pngEPI512345A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 6 (NA)2544.00.000000e+001401/1413 (99%)
text_code_colored.pngEPI420189A/bufflehead/California/3118/2011 (A/H4N8) segment 6 (NA)2544.00.000000e+001401/1413 (99%)
text_code_colored.pngEPI450000A/lesser scaup/Louisiana/AI09-5204/2009 (A/H6N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)
text_code_colored.pngEPI334350A/bufflehead/Illinois/4016/2009 (A/H4N8) segment 6 (NA)2490.40.000000e+001390/1411 (98%)
text_code_colored.pngEPI154826A/bufflehead/California/HKWF205/2007 (A/H4N8) segment 6 (NA)2455.30.000000e+001385/1413 (98%)
text_code_colored.pngEPI418544A/mallard/Wisconsin/10OS3166/2010 (A/H0) segment 6 (NA)2447.90.000000e+001383/1412 (97%)
text_code_colored.pngEPI342994A/mallard/Alberta/507/2008 (A/H3N8) segment 6 (NA)2444.20.000000e+001383/1413 (97%)
text_code_colored.pngEPI513050A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 6 (NA)2431.30.000000e+001380/1412 (97%)
text_code_colored.pngEPI596199A/mallard/Maryland/13OS3020/2014 (A/H6N8) segment 6 (NA)2427.60.000000e+001380/1413 (97%)
text_code_colored.pngEPI234231A/blue-winged teal/North Dakota/Sg-00704/2008 (A/H3N8) segment 6 (NA)2423.90.000000e+001360/1384 (98%)
text_code_colored.pngEPI526433A/American green-winged teal/Ohio/13OS2094/2013 (A/H6N8) segment 6 (NA)2422.10.000000e+001379/1413 (97%)
text_code_colored.pngEPI615867A/willet/Peru-CH49/2010 (A/H6N8) segment 6 (NA)2420.20.000000e+001378/1412 (97%)
text_code_colored.pngEPI526391A/American green-winged teal/Ohio/13OS1781/2013 (A/H6N8) segment 6 (NA)2416.50.000000e+001378/1413 (97%)
text_code_colored.pngEPI526333A/American green-winged teal/Ohio/13OS2060/2013 (A/H6N8) segment 6 (NA)2416.50.000000e+001378/1413 (97%)
text_code_colored.pngEPI448654A/blue-winged teal/North Dakota/Sg-00719/2008 (A/H3N8) segment 6 (NA)2416.50.000000e+001378/1413 (97%)
text_code_colored.pngEPI234233A/blue-winged teal/North Dakota/Sg-00707/2008 (A/H4N8) segment 6 (NA)2414.70.000000e+001363/1391 (97%)
text_code_colored.pngEPI645418A/American green-winged teal/Ohio/13OS1840/2013 (A/H6N8) segment 6 (NA)2411.00.000000e+001377/1413 (97%)
text_code_colored.pngEPI343441A/mallard/Alberta/212/2006 (A/H3N8) segment 6 (NA)2411.00.000000e+001377/1413 (97%)
text_code_colored.pngEPI227374A/northern pintail/Alberta/11701/2005 (A/H3N8) segment 6 (NA)2405.50.000000e+001376/1413 (97%)
text_code_colored.pngEPI615874A/egret/Peru-CH50/2010 (A/H6N8) segment 6 (NA)2401.80.000000e+001368/1402 (97%)
text_code_colored.pngEPI343677A/mallard/Alberta/241/2004 (A/H3N8) segment 6 (NA)2399.90.000000e+001375/1413 (97%)
text_code_colored.pngEPI298668A/mallard/Interior Alaska/6MP0951/2006 (A/H3N8) segment 6 (NA)2399.90.000000e+001375/1413 (97%)
text_code_colored.pngEPI449527A/mallard/Minnesota/Sg-00860/2008 (A/H0) segment 6 (NA)2394.40.000000e+001375/1414 (97%)
text_code_colored.pngEPI343283A/mallard/Alberta/28/2007 (A/H3N8) segment 6 (NA)2394.40.000000e+001374/1413 (97%)
text_code_colored.pngEPI343275A/mallard/Alberta/34/2007 (A/H3N8) segment 6 (NA)2394.40.000000e+001374/1413 (97%)
text_code_colored.pngEPI343127A/mallard/Alberta/284/2007 (A/H0) segment 6 (NA)2394.40.000000e+001374/1413 (97%)
text_code_colored.pngEPI343043A/blue-winged teal/Alberta/387/2007 (A/H3N8) segment 6 (NA)2388.80.000000e+001373/1413 (97%)
text_code_colored.pngEPI298732A/mallard/Interior Alaska/6MP0972R1/2006 (A/H3N8) segment 6 (NA)2388.80.000000e+001373/1413 (97%)
text_code_colored.pngEPI298636A/mallard/Interior Alaska/6MP0272/2006 (A/H3N8) segment 6 (NA)2388.80.000000e+001373/1413 (97%)
text_code_colored.pngEPI298500A/green-winged teal/Interior Alaska/6MP0736/2006 (A/H3N8) segment 6 (NA)2388.80.000000e+001373/1413 (97%)
text_code_colored.pngEPI343452A/mallard/Alberta/190/2006 (A/H0) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI343291A/mallard/Alberta/27/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI221422A/American green-winged teal/Interior Alaska/4/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI699696A/American green-winged teal/Interior Alaska/11BM03897/2011 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI699630A/American green-winged teal/Interior Alaska/11BM03657/2011 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI299575A/northern pintail/Interior Alaska/7MP0509/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI299060A/northern pintail/Interior Alaska/7MP2228/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI296892A/northern shoveler/Interior Alaska/7MP1765/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263358A/mallard/Minnesota/Sg-00064/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263094A/blue-winged teal/Minnesota/Sg-00037/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI222187A/mallard/Interior Alaska/2/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI234236A/blue-winged teal/North Dakota/Sg-00719/2008 (A/H3N8) segment 6 (NA)2374.10.000000e+001355/1390 (97%)
text_code_colored.pngEPI449681A/ring-necked duck/Minnesota/Sg-01066/2008 (A/H12N8) segment 6 (NA)2372.20.000000e+001371/1414 (96%)
text_code_colored.pngEPI449478A/mallard/Minnesota/Sg-00824/2008 (A/H0) segment 6 (NA)2372.20.000000e+001371/1414 (96%)
text_code_colored.pngEPI343109A/mallard/Alberta/318/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI342942A/mallard/Alberta/551/2009 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI299044A/northern pintail/Interior Alaska/7MP1822/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001371/1414 (96%)
text_code_colored.pngEPI296957A/American widgeon/Interior Alaska/7MP1707/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI296900A/northern shoveler/Interior Alaska/7MP0944/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI283597A/surface water/Minnesota/W07-2241/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI263398A/ring-necked duck/Minnesota/Sg-00069/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI263334A/mallard/Minnesota/Sg-00061/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI263262A/mallard/Minnesota/Sg-00051/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI263238A/mallard/Minnesota/Sg-00048/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI263230A/mallard/Minnesota/Sg-00047/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI263206A/gadwall/Minnesota/Sg-00044/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI178641A/northern shoveler/Interior Alaska/3/2007 (A/H3N8) segment 6 (NA)2368.50.000000e+001368/1411 (96%)
text_code_colored.pngEPI595705A/mallard/Maryland/08OS3097/2008 (A/H10N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI442452A/greater white-fronted goose/Alaska/44299-055/2007 (A/H3N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI299204A/green-winged teal/Interior Alaska/8BM3706/2008 (A/H0) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI299196A/northern pintail/Interior Alaska/8BM3700/2008 (A/H3N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI225292A/mallard/Washington/20010-002/2006 (A/H3N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI442451A/greater white-fronted goose/Alaska/44299-054/2007 (A/H3N8) segment 6 (NA)2364.80.000000e+001368/1412 (96%)
text_code_colored.pngEPI699131A/mallard/Interior Alaska/12ML00098/2012 (A/H3N8) segment 6 (NA)2361.10.000000e+001368/1413 (96%)
text_code_colored.pngEPI450043A/mallard/Arkansas/AI09-5944/2009 (A/H4N8) segment 6 (NA)2361.10.000000e+001368/1413 (96%)
text_code_colored.pngEPI449987A/blue-winged teal/Texas/AI09-4463/2009 (A/H4N8) segment 6 (NA)2361.10.000000e+001368/1413 (96%)
text_code_colored.pngEPI418513A/ruddy duck/Wisconsin/10OS3191/2010 (A/H3N8) segment 6 (NA)2361.10.000000e+001368/1413 (96%)
text_code_colored.pngEPI343315A/mallard/Alberta/279/2006 (A/H3N8) segment 6 (NA)2361.10.000000e+001368/1413 (96%)
text_code_colored.pngEPI342923A/pintail/Alberta/207/1999 (A/H0) segment 6 (NA)2361.10.000000e+001369/1414 (96%)
text_code_colored.pngEPI328504A/bufflehead/California/8522/2008 (A/H4N8) segment 6 (NA)2361.10.000000e+001368/1413 (96%)
text_code_colored.pngEPI263318A/mallard/Minnesota/Sg-00059/2007 (A/H3N8) segment 6 (NA)2361.10.000000e+001368/1413 (96%)
text_code_colored.pngEPI87760A/pintail/Alberta/207/1999 (A/H4N8) segment 6 (NA)2361.10.000000e+001369/1414 (96%)
text_code_colored.pngEPI450037A/mallard/Arkansas/AI09-5900/2009 (A/H3N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI449786A/mallard/Minnesota/AI09-2571/2009 (A/H3N8) segment 6 (NA)2355.60.000000e+001368/1414 (96%)
text_code_colored.pngEPI402982A/mallard/Alberta/215/1999 (A/H0) segment 6 (NA)2355.60.000000e+001368/1414 (96%)
text_code_colored.pngEPI328645A/mallard/California/11032/2008 (A/H0N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI526445A/American green-winged teal/Ohio/13OS2108/2013 (A/H3N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI526376A/blue-winged teal/Ohio/13OS2018/2013 (A/H3N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI449809A/blue-winged Teal/Minnesota/AI09-2977/2009 (A/H4N8) segment 6 (NA)2350.10.000000e+001367/1414 (96%)
text_code_colored.pngEPI448667A/mallard/North Dakota/Sg-00737/2008 (A/H6N8) segment 6 (NA)2350.10.000000e+001367/1414 (96%)
text_code_colored.pngEPI437063A/northern pintail/Interior Alaska/9BM12153R0/2009 (A/H4N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI328590A/northern shoveler/California/9235/2008 (A/H10N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI290783A/teal/Oregon/44336-130/2007 (A/H3N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI290577A/northern pintail/Oregon/44249-559/2006 (A/H3N8) segment 6 (NA)2350.10.000000e+001367/1414 (96%)
text_code_colored.pngEPI290775A/American green-winged teal/Oregon/44336-124/2007 (A/H3N8) segment 6 (NA)2348.20.000000e+001356/1398 (96%)
text_code_colored.pngEPI526340A/American green-winged teal/Ohio/13OS2106/2013 (A/H3N8) segment 6 (NA)2344.50.000000e+001365/1413 (96%)
text_code_colored.pngEPI448479A/mallard/Minnesota/346256/2000 (A/H0) segment 6 (NA)2344.50.000000e+001367/1415 (96%)
text_code_colored.pngEPI387233A/mallard/California/3188/2010 (A/H6N8) segment 6 (NA)2344.50.000000e+001365/1413 (96%)
text_code_colored.pngEPI344280A/lesser scaup/Alberta/206/1995 (A/H3N8) segment 6 (NA)2344.50.000000e+001366/1414 (96%)
text_code_colored.pngEPI298956A/American wigeon/Interior Alaska/7MP1726/2007 (A/H3N8) segment 6 (NA)2344.50.000000e+001365/1413 (96%)
text_code_colored.pngEPI296973A/mallard/Interior Alaska/7MP1700/2007 (A/H3N8) segment 6 (NA)2344.50.000000e+001365/1413 (96%)
text_code_colored.pngEPI238106A/mallard/Minnesota/448/2000 (A/H3N8) segment 6 (NA)2344.50.000000e+001367/1415 (96%)
text_code_colored.pngEPI442450A/greater white-fronted goose/Alaska/44299-002/2007 (A/H3N8) segment 6 (NA)2340.80.000000e+001353/1396 (96%)
text_code_colored.pngEPI512948A/American green-winged teal/Illinois/11OS4814/2011 (A/H3N8) segment 6 (NA)2339.00.000000e+001364/1413 (96%)
text_code_colored.pngEPI238511A/mallard/Minnesota/190/1999 (A/H3N8) segment 6 (NA)2339.00.000000e+001366/1415 (96%)
text_code_colored.pngEPI222337A/northern pintail/Alaska/7MP0508/2007 (A/H3N8) segment 6 (NA)2339.00.000000e+001364/1413 (96%)
text_code_colored.pngEPI178610A/northern shoveler/Interior Alaska/2/2007 (A/H3N8) segment 6 (NA)2339.00.000000e+001364/1413 (96%)
text_code_colored.pngEPI22171A/mallard/Alberta/215/99 (A/H6N8) segment 6 (NA)2337.10.000000e+001362/1410 (96%)
text_code_colored.pngEPI298980A/northern pintail/Interior Alaska/7MP0408/2007 (A/H3N8) segment 6 (NA)2333.40.000000e+001363/1413 (96%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI616384A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI513049A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI512344A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI512875A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI420188A/bufflehead/California/3118/2011 (A/H4N8) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI689817A/mallard/Nebraska/A00709657/2009 (A/H7N3) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI689575A/American green winged teal/Texas/A00604814/2009 (A/H7N3) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI689568A/American green winged teal/Texas/A00604032/2009 (A/H7N3) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI689561A/American green winged teal/Texas/A00604029/2009 (A/H7N3) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI689548A/American green winged teal/Texas/A00604024/2009 (A/H7N3) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI449999A/lesser scaup/Louisiana/AI09-5204/2009 (A/H6N8) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI690043A/northern shoveler/Mississippi/A00682947/2008 (A/H7N7) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI419526A/American green-winged teal/Mississippi/11OS256/2011 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI689700A/blue winged teal/Texas/A00605473/2009 (A/H7N3) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI689645A/blue winged teal/Louisiana/A00557206/2009 (A/H7N7) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI376067A/mallard/California/1475/2010 (A/H3N8) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI327661A/mallard/California/1156/2010 (A/H4N6) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI689789A/mallard/Iowa/A00558620/2008 (A/H7N3) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI689689A/blue winged teal/Texas/A00676566/2009 (A/H7N3) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI616847A/blue-winged teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI449901A/blue-winged Teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI449736A/mallard/Minnesota/AI09-1867/2009 (A/H8N4) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI449729A/mallard/Minnesota/AI09-1854/2009 (A/H8N4) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI449722A/mallard/Minnesota/AI09-1833/2009 (A/H8N4) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI435155A/American black duck/New Brunswick/00867/2010 (A/H5N2) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI398693A/mallard/California/1154/2010 (A/H4N6) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI387273A/mallard/California/1297/2010 (A/H4N6) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI327669A/mallard/California/1154/2010 (A/H0) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI327653A/mallard/California/1210/2010 (A/H4N6) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI327637A/mallard/California/1188/2010 (A/H4N6) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI689833A/mallard/New York/A00723392/2009 (A/H7N3) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI689659A/blue winged teal/Minnesota/A00137660/2009 (A/H7N3) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI689487A/American black duck/Delaware/A00870108/2010 (A/H7N3) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI512964A/mallard/Illinois/11OS5582/2011 (A/H1N1) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI512947A/American green-winged teal/Illinois/11OS4814/2011 (A/H3N8) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI476339A/blue-winged teal/Canada/3240/2011 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI476272A/blue-winged teal/Canada/3241/2011 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI476265A/blue-winged teal/Canada/3239/2011 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI476258A/blue-winged teal/Canada/3237/2011 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI476213A/thick-billed murre/Canada/1871/2011 (A/H1N1) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI476150A/common eider/Maine/270/2011 (A/H1N1) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI476143A/mallard/Maine/202/2011 (A/H1N1) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI476123A/bufflehead/Maine/161/2011 (A/H1N1) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI449328A/mallard/Minnesota/Sg-00804/2008 (A/H3N8) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI419167A/mallard/Wisconsin/10OS3866/2010 (A/H3N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI418971A/mallard/Wisconsin/10OS3169/2010 (A/H4N9) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI331963A/blue-winged teal/Guatemala/CIP049-06/2010 (A/H8N4) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI331955A/blue-winged teal/Guatemala/CIP049-12/2010 (A/H5N4) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI331947A/blue-winged teal/Guatemala/CIP049-13/2010 (A/H5N4) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI331939A/blue-winged teal/Guatemala/CIP049-14/2010 (A/H8N4) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI331915A/blue-winged teal/Guatemala/CIP049-15/2010 (A/H8N4) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI616449A/blue-winged teal/Illinois/12OS4788/2012 (A/H1N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI463748A/mallard/Minnesota/AI09-1714/2009 (A/H7N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512992A/mallard/Wisconsin/11OS3092/2011 (A/H3N2) segment 7 (MP)1725.90.000000e+00966/982 (98%)
text_code_colored.pngEPI512985A/mallard/Wisconsin/11OS3079/2011 (A/H3N2) segment 7 (MP)1725.90.000000e+00966/982 (98%)
text_code_colored.pngEPI512919A/mallard/Wisconsin/11OS3106/2011 (A/H3N2) segment 7 (MP)1725.90.000000e+00966/982 (98%)
text_code_colored.pngEPI419062A/American green-winged teal/Wisconsin/10OS2955/2010 (A/H5N2) segment 7 (MP)1725.90.000000e+00966/982 (98%)
text_code_colored.pngEPI419055A/mallard/Wisconsin/10OS2945/2010 (A/H0) segment 7 (MP)1725.90.000000e+00966/982 (98%)
text_code_colored.pngEPI327629A/mallard/California/1289/2010 (A/H4N6) segment 7 (MP)1725.90.000000e+00966/982 (98%)
text_code_colored.pngEPI328420A/northern pintail/California/6495/2008 (A/H6N1) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI699389A/American green-winged teal/Interior Alaska/11BM00293/2011 (A/H10N5) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI699370A/American green-winged teal/Interior Alaska/11BM00304/2011 (A/H10N5) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI512209A/American green-winged teal/Mississippi/12OS405/2012 (A/H10N7) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI420253A/mallard/California/3569/2010 (A/H1N3) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI328317A/mallard/California/6420/2008 (A/H6N2) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI299195A/northern pintail/Interior Alaska/8BM3700/2008 (A/H3N8) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI220470A/env/California/7279/2008 (A/H2N3) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI159708A/turkey/CA/358533/2005 (A/H4N8) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI645489A/American green-winged teal/Wisconsin/13OS3465/2013 (A/H6N8) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI616170A/blue-winged teal/Ohio/12OS2138/2012 (A/H10N9) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI512233A/mallard/Arkansas/12OS184/2012 (A/H10N7) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI454938A/ruddy turnstone/New Jersey/AI06-582/2006 (A/H6N7) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI450079A/red-necked grebe/Minnesota/AI10-2530/2010 (A/H0) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI450071A/red-necked grebe/Minnesota/AI10-2529/2010 (A/H0) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI442481A/spectacled eider/Alaska/44173-055/2006 (A/H3N8) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI419704A/American wigeon/Missouri/10MO0530/2010 (A/H0) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI418727A/American green-winged teal/Wisconsin/10OS2767/2010 (A/H6N8) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI376081A/northern shoveler/California/3185/2010 (A/H0) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI369979A/mallard/Alberta/297/2007 (A/H2N9) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI334380A/mallard/Illinois/3048/2009 (A/H11N2) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI333743A/northern shovelerMissouri/141/2009 (A/H0) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI333607A/American green-winged teal/Mississippi/404/2010 (A/H0) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI300071A/northern pintail/Interior Alaska/8BM3696/2008 (A/H3N8) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI300064A/northern shoveler/Interior Alaska/8BM3671/2008 (A/H4N1) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI299727A/northern pintail/Interior Alaska/8BM3723/2008 (A/H4N1) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI299452A/northern shoveler/Mississippi/09OS643/2009 (A/H7N7) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI299203A/green-winged teal/Interior Alaska/8BM3706/2008 (A/H0) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI299027A/duck/Interior Alaska/7MP1582/2007 (A/H1N1) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI298340A/blue-winged teal/Louisiana/Sg-00189/2007 (A/H3N6) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI292834A/bufflehead/California/JN1016/2006 (A/H2N9) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI290758A/American green-winged teal/California/44287-395/2007 (A/H8N3) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI290696A/northern shoveler/Washington/44249-731/2006 (A/H10N7) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI280527A/mallard/Idaho/455398-2/2006 (A/H5N2) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI280519A/mallard/Washington/456277-7/2006 (A/H5N2) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI263207A/gadwall/Minnesota/Sg-00044/2007 (A/H3N8) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI225343A/pintail/Alberta/21/2006 (A/H1N1) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI220501A/env/California/7335/2008 (A/H2N3) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI220493A/env/California/7313/2008 (A/H2N3) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI220478A/env/California/7286/2008 (A/H2N3) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI183983A/ruddy turnstone/Delaware/752/2006 (A/H7N7) segment 7 (MP)1709.30.000000e+00963/982 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI616237A/blue-winged teal/Ohio/12OS2106/2012 (A/H4N6) segment 1 (PB2)4084.10.000000e+002257/2280 (98%)
text_code_colored.pngEPI418607A/northern shoveler/Arkansas/11OS333/2011 (A/H0) segment 1 (PB2)4050.80.000000e+002251/2280 (98%)
text_code_colored.pngEPI263193A/blue-winged teal/Texas/Sg-00081/2007 (A/H4N6) segment 1 (PB2)4050.80.000000e+002251/2280 (98%)
text_code_colored.pngEPI512780A/mallard/Wisconsin/11OS3407/2011 (A/H4N9) segment 1 (PB2)4039.70.000000e+002249/2280 (98%)
text_code_colored.pngEPI298321A/mallard/Minnesota/Sg-00220/2007 (A/H6N1) segment 1 (PB2)4039.70.000000e+002249/2280 (98%)
text_code_colored.pngEPI513061A/mallard/Wisconsin/11OS3577/2011 (A/H6N5) segment 1 (PB2)4034.20.000000e+002248/2280 (98%)
text_code_colored.pngEPI513029A/blue-winged teal/Iowa/44555-551/2011 (A/H3N2) segment 1 (PB2)4034.20.000000e+002248/2280 (98%)
text_code_colored.pngEPI403280A/northern pintail/Alberta/3/2009 (A/H0) segment 1 (PB2)4034.20.000000e+002248/2280 (98%)
text_code_colored.pngEPI449885A/blue-winged Teal/Minnesota/AI09-3575/2009 (A/H4N8) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI449783A/mallard/Minnesota/AI09-2519/2009 (A/H3N6) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI435864A/mallard/Alberta/91/2007 (A/H1N5) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI334157A/American green-winged teal/Illinois/3053/2009 (A/H0) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI327703A/mallard/California/5351/2009 (A/H1N1) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI298202A/mallard/Minnesota/Sg-00214/2007 (A/H6N1) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI298138A/mallard/Minnesota/Sg-00182/2007 (A/H6N1) segment 1 (PB2)4028.70.000000e+002248/2281 (98%)
text_code_colored.pngEPI284098A/green-winged teal/Minnesota/Sg-00197/2007 (A/H6N8) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI263185A/blue-winged teal/Texas/Sg-00080/2007 (A/H4N6) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI263145A/blue-winged teal/Texas/Sg-00075/2007 (A/H4N6) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI333581A/mallard/Mississippi/413/2010 (A/H1N1) segment 1 (PB2)4023.10.000000e+002246/2280 (98%)
text_code_colored.pngEPI298122A/mallard/Minnesota/Sg-00167/2007 (A/H6N1) segment 1 (PB2)4023.10.000000e+002240/2271 (98%)
text_code_colored.pngEPI154574A/northern shoveler/California/HKWF1370/2007 (A/H10N3) segment 1 (PB2)4023.10.000000e+002247/2281 (98%)
text_code_colored.pngEPI449997A/blue-winged teal/Louisiana/AI09-5159/2009 (A/H3N8) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI449964A/northern pintail/Minnesota/AI09-4322/2009 (A/H3N8) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI449432A/mallard/Minnesota/Sg-00692/2008 (A/H2N3) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI449285A/northern pintail/North Dakota/Sg-00749/2008 (A/H0) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI328351A/environment/California/7810/2008 (A/H4N6) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI290812A/mallard/Washington/44338-362/2007 (A/H11N9) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI449412A/mallard/Minnesota/Sg-00672/2008 (A/H3N8) segment 1 (PB2)4012.00.000000e+002244/2280 (98%)
text_code_colored.pngEPI449320A/blue-winged teal/Minnesota/Sg-00787/2008 (A/H3N8) segment 1 (PB2)4012.00.000000e+002244/2280 (98%)
text_code_colored.pngEPI448578A/mallard/Minnesota/Sg-00571/2008 (A/H0) segment 1 (PB2)4012.00.000000e+002244/2280 (98%)
text_code_colored.pngEPI418783A/American green-winged teal/Illinois/10OS3343/2010 (A/H2N3) segment 1 (PB2)4012.00.000000e+002244/2280 (98%)
text_code_colored.pngEPI512200A/northern shoveler/Mississippi/12OS362/2012 (A/H7N7) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI449418A/mallard/Minnesota/Sg-00674/2008 (A/H3N8) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI448671A/mallard/North Dakota/Sg-00737/2008 (A/H6N8) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI447990A/mallard/Arkansas/AI09-5944/2009 (A/H4N8) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI418970A/mallard/Wisconsin/10OS3144/2010 (A/H6N1) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI342961A/northern pintail/Alberta/8/2009 (A/H3N8) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI333769A/mallard/Illinois/4180/2009 (A/H6N1) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI616168A/American green-winged teal/Ohio/12OS2137/2012 (A/H4N6) segment 1 (PB2)4001.00.000000e+002243/2281 (98%)
text_code_colored.pngEPI614546A/blue winged-teal/Wisconsin/12OS4239/2012 (A/H3N2) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI512298A/mallard/Arkansas/12OS140/2012 (A/H11N3) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI512245A/American green-winged teal/Mississippi/12OS191/2012 (A/H5N3) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI451652A/mallard/Interior Alaska/10BM07575R0/2010 (A/H7N3) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI449292A/blue-winged teal/North Dakota/Sg-00750/2008 (A/H4N6) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI419659A/gadwall/Missouri/10MO0280/2010 (A/H5N2) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI342989A/mallard/Alberta/507/2008 (A/H3N8) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI333785A/mallard/Illinois/4162/2009 (A/H11N2) segment 1 (PB2)4001.00.000000e+002243/2281 (98%)
text_code_colored.pngEPI435836A/mallard/Alberta/128/2006 (A/H1N1) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI418864A/mallard/Wisconsin/10OS2667/2010 (A/H11N9) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI418826A/northern shoveler/Illinois/10OS3619/2010 (A/H11N9) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI296761A/mallard/Alberta/128/2006 (A/H1N1) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI166118A/mallard/Minnesota/Sg-00169/2007 (A/H3N8) segment 1 (PB2)3995.40.000000e+002219/2247 (98%)
text_code_colored.pngEPI616314A/northern shoveler/Illinois/12OS4951/2012 (A/H7N3) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI595926A/mallard/Maryland/09OS254/2009 (A/H1N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI512342A/mallard/Wisconsin/11OS4493/2011 (A/H1N3) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI468388A/mallard/Missouri/466554-14/2007 (A/H1N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI453954A/mallard/Interior Alaska/10BM11311R0/2010 (A/H3N8) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI449713A/mallard/Minnesota/AI09-1684/2009 (A/H1N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI449706A/mallard/Minnesota/AI09-1678/2009 (A/H1N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI449514A/green-winged teal/Minnesota/Sg-00841/2008 (A/H0) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI449362A/mallard/Minnesota/SG-00932/2008 (A/H6N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI420088A/mallard/California/2584V/2011 (A/H4N9) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI419815A/mallard/California/2532V/2011 (A/H4N6) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI419143A/northern shoveler/Mississippi/10OS4526/2010 (A/H6N2) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI419116A/gadwall/Mississippi/10OS4531/2010 (A/H6N2) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI333881A/blue-winged teal/Wisconsin/2649/2009 (A/H6N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI299482A/gadwall/Wisconsin/08OS2296/2008 (A/H6N2) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI188187A/mallard/Minnesota/Sg-00462/2008 (A/H6N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI298233A/mallard/Minnesota/Sg-00223/2007 (A/H6N1) segment 1 (PB2)3988.00.000000e+002222/2253 (98%)
text_code_colored.pngEPI188713A/mallard/Minnesota/Sg-00692/2008 (A/H2N3) segment 1 (PB2)3988.00.000000e+002227/2261 (98%)
text_code_colored.pngEPI154747A/mallard duck/Minnesota/Sg-00105/2007 (A/H6N1) segment 1 (PB2)3988.00.000000e+002217/2246 (98%)
text_code_colored.pngEPI154715A/blue-winged teal/Texas/Sg-00081/2007 (A/H4N6) segment 1 (PB2)3988.00.000000e+002217/2246 (98%)
text_code_colored.pngEPI689545A/American green winged teal/Texas/A00586649/2009 (A/H7N3) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI689521A/American green winged teal/Colorado/A00660616/2008 (A/H7N3) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI442129A/emperor goose/Alaska/44300-287/2007 (A/H1N2) segment 1 (PB2)3984.30.000000e+002226/2261 (98%)
text_code_colored.pngEPI420129A/mallard/California/2594V/2011 (A/H4N6) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI420122A/mallard/California/2594P/2011 (A/H4N6) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI420115A/mallard/California/2590V/2011 (A/H4N6) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI420081A/mallard/California/2584P/2011 (A/H4N9) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI419525A/American green-winged teal/Mississippi/11OS255/2011 (A/H7N7) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI418556A/northern pintail/Mississippi/10OS4521/2010 (A/H0) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI413395A/mallard/Ohio/10OS1470/2010 (A/H3N2) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI413388A/mallard/Ohio/10OS1469/2010 (A/H3N2) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI387293A/mallard/California/1335-1/2010 (A/H10) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI387286A/mallard/California/1335/2010 (A/H10) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI333825A/gadwall/Illinois/3860/2009 (A/H6N1) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI328528A/American wigeon/California/8547/2008 (A/H6N1) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI328231A/mallard/California/8293/2008 (A/H6N1) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI328191A/mallard/California/8432/2008 (A/H6N1) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI188155A/northern pintail/South Dakota/Sg-00454/2008 (A/H6N5) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI166244A/mallard/Minnesota/Sg-00223/2007 (A/H6N1) segment 1 (PB2)3984.30.000000e+002217/2247 (98%)
text_code_colored.pngEPI188677A/mallard/Minnesota/Sg-00683/2008 (A/H3N8) segment 1 (PB2)3982.50.000000e+002226/2261 (98%)
text_code_colored.pngEPI188662A/mallard/Minnesota/Sg-00679/2008 (A/H3N8) segment 1 (PB2)3982.50.000000e+002226/2261 (98%)
text_code_colored.pngEPI188634A/mallard/Minnesota/Sg-00672/2008 (A/H3N8) segment 1 (PB2)3982.50.000000e+002226/2261 (98%)
text_code_colored.pngEPI188194A/mallard/Minnesota/Sg-00464/2008 (A/H6N1) segment 1 (PB2)3980.70.000000e+002238/2280 (98%)
text_code_colored.pngEPI616057A/mallard/Ohio/12OS5582/2012 (A/H0) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI595723A/mallard/Maryland/08OS3111/2008 (A/H10N7) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI512430A/northern shoveler/Illinois/11OS5680/2011 (A/H11N9) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI419053A/mallard/Wisconsin/10OS2918/2010 (A/H4N6) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI419046A/mallard/Wisconsin/10OS2917/2010 (A/H4N6) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI616386A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 2 (PB1)4133.90.000000e+002262/2274 (99%)
text_code_colored.pngEPI512213A/American green-winged teal/Mississippi/12OS405/2012 (A/H10N7) segment 2 (PB1)4111.80.000000e+002258/2274 (99%)
text_code_colored.pngEPI512237A/mallard/Arkansas/12OS184/2012 (A/H10N7) segment 2 (PB1)4100.70.000000e+002256/2274 (99%)
text_code_colored.pngEPI616094A/northern shoveler/Ohio/12OS5647/2012 (A/H2N3) segment 2 (PB1)4089.60.000000e+002254/2274 (99%)
text_code_colored.pngEPI526269A/American green-winged teal/Ohio/13OS1777/2013 (A/H7N3) segment 2 (PB1)4078.50.000000e+002252/2274 (99%)
text_code_colored.pngEPI645359A/American green-winged teal/Ohio/13OS1769/2013 (A/H7N2) segment 2 (PB1)4073.00.000000e+002251/2274 (98%)
text_code_colored.pngEPI645352A/blue-winged teal/Ohio/13OS1770/2013 (A/H7N3) segment 2 (PB1)4073.00.000000e+002251/2274 (98%)
text_code_colored.pngEPI616348A/American green-winged teal/Mississippi/12OS5061/2012 (A/H5N2) segment 2 (PB1)4067.40.000000e+002250/2274 (98%)
text_code_colored.pngEPI526456A/blue-winged teal/Ohio/13OS1773/2013 (A/H7N3) segment 2 (PB1)4056.40.000000e+002249/2275 (98%)
text_code_colored.pngEPI542051A/mallard/Idaho/ND0002644/2013 (A/H3N8) segment 2 (PB1)4050.80.000000e+002247/2274 (98%)
text_code_colored.pngEPI419327A/mallard/Illinois/10OS4111/2010 (A/H10N7) segment 2 (PB1)4050.80.000000e+002247/2274 (98%)
text_code_colored.pngEPI451933A/mallard/Interior Alaska/10BM11434R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451912A/northern pintail/Interior Alaska/10BM10906R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451877A/mallard/Interior Alaska/10BM10811R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451870A/northern pintail/Interior Alaska/10BM10809R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451863A/northern pintail/Interior Alaska/10BM10807R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451856A/northern pintail/Interior Alaska/10BM10805R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451849A/northern pintail/Interior Alaska/10BM10801R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451826A/northern pintail/Interior Alaska/10BM10476R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451819A/mallard/Interior Alaska/10BM10324R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451812A/northern pintail/Interior Alaska/10BM10166R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451805A/northern pintail/Interior Alaska/10BM09832R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451798A/mallard/Interior Alaska/10BM09818R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451793A/northern pintail/Interior Alaska/10BM09481R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451751A/northern pintail/Interior Alaska/10BM09348R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451744A/northern pintail/Interior Alaska/10BM09347R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451709A/northern pintail/Interior Alaska/10BM08705R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451674A/mallard/Interior Alaska/10BM08099R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451658A/northern pintail/Interior Alaska/10BM07737R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451644A/mallard/Interior Alaska/10BM07501R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451637A/northern pintail/Interior Alaska/10BM07469R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451630A/northern pintail/Interior Alaska/10BM07458R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451623A/northern pintail/Interior Alaska/10BM07260R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451601A/northern pintail/Interior Alaska/10BM07114R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451594A/northern pintail/Interior Alaska/10BM07106R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451587A/mallard/Interior Alaska/10BM07092R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451580A/mallard/Interior Alaska/10BM07085R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451454A/mallard/Interior Alaska/10BM09141R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436829A/mallard/Interior Alaska/10BM06911R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436822A/mallard/Interior Alaska/10BM06909R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436811A/mallard/Interior Alaska/10BM06905R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436804A/northern pintail/Interior Alaska/10BM06899R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436796A/northern pintail/Interior Alaska/10BM06524R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436666A/mallard/Interior Alaska/10BM05860R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436575A/mallard/Interior Alaska/10BM05347R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI432814A/northern pintail/Interior Alaska/10BM06901R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451961A/mallard/Interior Alaska/10BM12534R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451779A/mallard/Interior Alaska/10BM09563R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451772A/mallard/Interior Alaska/10BM09548R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451765A/mallard/Interior Alaska/10BM09539R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451758A/mallard/Interior Alaska/10BM09528R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451737A/northern pintail/Interior Alaska/10BM09181R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451688A/mallard/Interior Alaska/10BM08120R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451681A/mallard/Interior Alaska/10BM08100R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451615A/northern pintail/Interior Alaska/10BM07121R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451608A/northern pintail/Interior Alaska/10BM07120R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451563A/mallard/Interior Alaska/10BM07072R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451556A/mallard/Interior Alaska/10BM07066R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451549A/northern pintail/Interior Alaska/10BM07029R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451441A/northern pintail/Interior Alaska/10BM07267R0/2010 (A/H0) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436867A/northern pintail/Interior Alaska/10BM06720R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436793A/northern pintail/Interior Alaska/10BM06895R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436773A/mallard/Interior Alaska/10BM06838R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436679A/northern pintail/Interior Alaska/10BM06306R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436665A/northern pintail/Interior Alaska/10BM06303R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI453953A/mallard/Interior Alaska/10BM11311R0/2010 (A/H3N8) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI453932A/mallard/Interior Alaska/10BM10829R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451919A/northern pintail/Interior Alaska/10BM11208R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451905A/mallard/Interior Alaska/10BM10876R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451898A/mallard/Interior Alaska/10BM10861R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451891A/mallard/Interior Alaska/10BM10859R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451884A/northern pintail/Interior Alaska/10BM10853R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451842A/northern pintail/Interior Alaska/10BM10790R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451833A/mallard/Interior Alaska/10BM10787R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451730A/mallard/Interior Alaska/10BM08884R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451723A/mallard/Interior Alaska/10BM08883R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451716A/mallard/Interior Alaska/10BM08874R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451702A/northern pintail/Interior Alaska/10BM08586R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451695A/northern pintail/Interior Alaska/10BM08400R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451666A/northern pintail/Interior Alaska/10BM07821R0/2010 (A/H0) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI616327A/northern shoveler/Missouri/12OS5755/2012 (A/H10N3) segment 2 (PB1)4028.70.000000e+002243/2274 (98%)
text_code_colored.pngEPI451940A/northern pintail/Interior Alaska/10BM11945R0/2010 (A/H7N3) segment 2 (PB1)4028.70.000000e+002243/2274 (98%)
text_code_colored.pngEPI699707A/mallard/Interior Alaska/11BM03859/2011 (A/H0) segment 2 (PB1)4017.60.000000e+002241/2274 (98%)
text_code_colored.pngEPI699570A/mallard/Interior Alaska/11BM03102/2011 (A/H4N6) segment 2 (PB1)4012.00.000000e+002240/2274 (98%)
text_code_colored.pngEPI512982A/American green-winged teal/Wisconsin/11OS3053/2011 (A/H6N1) segment 2 (PB1)4012.00.000000e+002240/2274 (98%)
text_code_colored.pngEPI419688A/mallard/Missouri/10MO0391/2010 (A/H10N7) segment 2 (PB1)4012.00.000000e+002240/2274 (98%)
text_code_colored.pngEPI614557A/blue winged-teal/Wisconsin/12OS2603/2012 (A/H3N2) segment 2 (PB1)4006.50.000000e+002239/2274 (98%)
text_code_colored.pngEPI542045A/mallard/Idaho/ND0002643/2013 (A/H4N8) segment 2 (PB1)4006.50.000000e+002239/2274 (98%)
text_code_colored.pngEPI699448A/mallard/Interior Alaska/11BM02089/2011 (A/H4N6) segment 2 (PB1)4001.00.000000e+002238/2274 (98%)
text_code_colored.pngEPI542057A/mallard/Idaho/ND0002645/2013 (A/H4N6) segment 2 (PB1)4001.00.000000e+002238/2274 (98%)
text_code_colored.pngEPI512733A/American green-winged teal/Wisconsin/11OS3431/2011 (A/H5N2) segment 2 (PB1)4001.00.000000e+002238/2274 (98%)
text_code_colored.pngEPI700085A/American wigeon/Interior Alaska/11CH00036/2011 (A/H4N6) segment 2 (PB1)3995.40.000000e+002237/2274 (98%)
text_code_colored.pngEPI699647A/mallard/Interior Alaska/11BM03599/2011 (A/H4N6) segment 2 (PB1)3995.40.000000e+002237/2274 (98%)
text_code_colored.pngEPI334243A/mallard/Missouri/350/2009 (A/H11N9) segment 2 (PB1)3995.40.000000e+002238/2275 (98%)
text_code_colored.pngEPI700078A/mallard/Interior Alaska/11CH00019/2011 (A/H4N6) segment 2 (PB1)3989.90.000000e+002237/2275 (98%)
text_code_colored.pngEPI699556A/mallard/Interior Alaska/11BM02987/2011 (A/H2N6) segment 2 (PB1)3989.90.000000e+002236/2274 (98%)
text_code_colored.pngEPI542063A/mallard/Idaho/ND0002646/2013 (A/H4N6) segment 2 (PB1)3989.90.000000e+002236/2274 (98%)
text_code_colored.pngEPI699728A/American green-winged teal/Interior Alaska/11BM03897/2011 (A/H3N8) segment 2 (PB1)3984.30.000000e+002235/2274 (98%)
text_code_colored.pngEPI419930A/mallard/California/2556V/2011 (A/H3N8) segment 2 (PB1)3984.30.000000e+002235/2274 (98%)
text_code_colored.pngEPI542121A/blue-winged teal/Kansas/ND0006685/2013 (A/H3N8) segment 2 (PB1)3973.30.000000e+002233/2274 (98%)
text_code_colored.pngEPI419923A/mallard/California/2556P/2011 (A/H3N8) segment 2 (PB1)3973.30.000000e+002233/2274 (98%)
text_code_colored.pngEPI542039A/mallard/Idaho/ND0002641/2013 (A/H4N6) segment 2 (PB1)3967.70.000000e+002232/2274 (98%)
text_code_colored.pngEPI542023A/mallard/Idaho/ND0002640/2013 (A/H4N6) segment 2 (PB1)3967.70.000000e+002232/2274 (98%)
text_code_colored.pngEPI526295A/American green-winged teal/Wisconsin/13OS3462/2013 (A/H3N8) segment 2 (PB1)3967.70.000000e+002232/2274 (98%)
text_code_colored.pngEPI526166A/blue-winged teal/Iowa/13OS2338/2013 (A/H4N6) segment 2 (PB1)3962.20.000000e+002231/2274 (98%)
text_code_colored.pngEPI387153A/mallard/California/1390/2010 (A/H7N5) segment 2 (PB1)3956.60.000000e+002230/2274 (98%)
text_code_colored.pngEPI560070A/quail/California/K1400794/2014 (A/H5N8) segment 2 (PB1)3951.10.000000e+002229/2274 (98%)
text_code_colored.pngEPI449684A/ring-necked duck/Minnesota/Sg-01066/2008 (A/H12N8) segment 2 (PB1)3940.00.000000e+002227/2274 (97%)
text_code_colored.pngEPI448643A/mallard/North Dakota/Sg-00703/2008 (A/H12N4) segment 2 (PB1)3940.00.000000e+002227/2274 (97%)
text_code_colored.pngEPI188754A/mallard/North Dakota/Sg-00703/2008 (A/H12N4) segment 2 (PB1)3940.00.000000e+002227/2274 (97%)
text_code_colored.pngEPI448650A/blue-winged teal/North Dakota/Sg-00706/2008 (A/H4N6) segment 2 (PB1)3928.90.000000e+002225/2274 (97%)
text_code_colored.pngEPI513053A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 2 (PB1)3923.40.000000e+002224/2274 (97%)
text_code_colored.pngEPI486890A/mallard/California/3460/2012 (A/H4N6) segment 2 (PB1)3923.40.000000e+002224/2274 (97%)
text_code_colored.pngEPI449635A/mallard/Minnesota/Sg-01034/2008 (A/H11N2) segment 2 (PB1)3923.40.000000e+002224/2274 (97%)
text_code_colored.pngEPI512879A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 2 (PB1)3917.90.000000e+002223/2274 (97%)
text_code_colored.pngEPI512261A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 2 (PB1)3917.90.000000e+002223/2274 (97%)
text_code_colored.pngEPI486776A/mallard/California/3166/2012 (A/H4N6) segment 2 (PB1)3917.90.000000e+002223/2274 (97%)
text_code_colored.pngEPI486904A/mallard/California/3474/2012 (A/H4N6) segment 2 (PB1)3906.80.000000e+002221/2274 (97%)
text_code_colored.pngEPI486712A/mallard/California/3100/2012 (A/H4N6) segment 2 (PB1)3906.80.000000e+002221/2274 (97%)
text_code_colored.pngEPI418932A/common goldeneye/Wisconsin/10OS4202/2010 (A/H7N6) segment 2 (PB1)3890.20.000000e+002218/2274 (97%)
text_code_colored.pngEPI689712A/blue winged teal/Texas/A00676566/2009 (A/H7N3) segment 2 (PB1)3884.60.000000e+002217/2274 (97%)
text_code_colored.pngEPI333682A/mallard/Ohio/1695/2009 (A/H4N6) segment 2 (PB1)3884.60.000000e+002217/2274 (97%)
text_code_colored.pngEPI188436A/mallard/Minnesota/Sg-00579/2008 (A/H1N1) segment 2 (PB1)3884.60.000000e+002218/2275 (97%)
text_code_colored.pngEPI699612A/American green-winged teal/Interior Alaska/11BM03479/2011 (A/H4N6) segment 2 (PB1)3879.10.000000e+002216/2274 (97%)
text_code_colored.pngEPI699542A/mallard/Interior Alaska/11BM02703/2011 (A/H4N6) segment 2 (PB1)3879.10.000000e+002216/2274 (97%)
text_code_colored.pngEPI699407A/mallard/Interior Alaska/11BM01009/2011 (A/H12N5) segment 2 (PB1)3879.10.000000e+002216/2274 (97%)
text_code_colored.pngEPI435694A/mallard/Alberta/65/2004 (A/H10N7) segment 2 (PB1)3879.10.000000e+002216/2274 (97%)
text_code_colored.pngEPI700070A/mallard/Interior Alaska/11CH00017/2011 (A/H0) segment 2 (PB1)3873.50.000000e+002215/2274 (97%)
text_code_colored.pngEPI700031A/American wigeon/Interior Alaska/11CH00010/2011 (A/H4N6) segment 2 (PB1)3873.50.000000e+002215/2274 (97%)
text_code_colored.pngEPI700024A/mallard/Interior Alaska/11CH00007/2011 (A/H4N6) segment 2 (PB1)3873.50.000000e+002215/2274 (97%)
text_code_colored.pngEPI438118A/mallard/Alberta/56/2004 (A/H10N7) segment 2 (PB1)3873.50.000000e+002215/2274 (97%)
text_code_colored.pngEPI435708A/mallard/Alberta/67/2004 (A/H10N7) segment 2 (PB1)3873.50.000000e+002215/2274 (97%)
text_code_colored.pngEPI435687A/mallard/Alberta/62/2004 (A/H10N7) segment 2 (PB1)3873.50.000000e+002215/2274 (97%)
text_code_colored.pngEPI419590A/blue-winged teal/Missouri/10MO0011/2010 (A/H3N6) segment 2 (PB1)3873.50.000000e+002215/2274 (97%)
text_code_colored.pngEPI419178A/mallard/Wisconsin/10OS3881/2010 (A/H0) segment 2 (PB1)3873.50.000000e+002215/2274 (97%)
text_code_colored.pngEPI333882A/blue-winged teal/Wisconsin/2649/2009 (A/H6N1) segment 2 (PB1)3873.50.000000e+002216/2275 (97%)
text_code_colored.pngEPI299489A/mallard/Illinois/08OS2315/2008 (A/H4N6) segment 2 (PB1)3873.50.000000e+002216/2275 (97%)
text_code_colored.pngEPI69001A/environment/Maryland/763/2006 (A/H11N9) segment 2 (PB1)3873.50.000000e+002215/2274 (97%)
text_code_colored.pngEPI595638A/mallard/Maryland/07OS90/2007 (A/H10N7) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI595631A/mallard/Maryland/07OS89/2007 (A/H10N7) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI595624A/mallard/Maryland/07OS73/2007 (A/H10N7) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI595617A/mallard/Maryland/07OS71/2007 (A/H10N7) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI595603A/mallard/Maryland/07OS56/2007 (A/H10N7) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI595596A/mallard/Maryland/07OS55/2007 (A/H10N7) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI594873A/environment/Maryland/05OS1173/2005 (A/H10N7) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI510522A/duck/SK/4628/2010 (A/H5N3) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI438125A/mallard/Alberta/57/2004 (A/H10N7) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI435717A/mallard/Alberta/68/2004 (A/H10N7) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI435701A/mallard/Alberta/66/2004 (A/H10N7) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI420193A/bufflehead/California/3118/2011 (A/H4N8) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI418616A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI227361A/mallard/Quebec/16566/2005 (A/H11N2) segment 2 (PB1)3868.00.000000e+002214/2274 (97%)
text_code_colored.pngEPI595645A/mallard/Maryland/07OS92/2007 (A/H10N7) segment 2 (PB1)3862.50.000000e+002213/2274 (97%)
text_code_colored.pngEPI595610A/mallard/Maryland/07OS66/2007 (A/H10N7) segment 2 (PB1)3862.50.000000e+002213/2274 (97%)
text_code_colored.pngEPI419081A/mallard/Wisconsin/10OS3066/2010 (A/H6N2) segment 2 (PB1)3862.50.000000e+002213/2274 (97%)
text_code_colored.pngEPI512474A/blue-winged teal/Missouri/11OS2563/2011 (A/H12N4) segment 2 (PB1)3856.90.000000e+002212/2274 (97%)
text_code_colored.pngEPI451651A/mallard/Interior Alaska/10BM07575R0/2010 (A/H7N3) segment 2 (PB1)3856.90.000000e+002212/2274 (97%)
text_code_colored.pngEPI436582A/American green-winged teal/Interior Alaska/10BM05376R0/2010 (A/H3N8) segment 2 (PB1)3856.90.000000e+002212/2274 (97%)
text_code_colored.pngEPI433197A/mallard/Interior Alaska/10BM04564R1/2010 (A/H7N3) segment 2 (PB1)3856.90.000000e+002212/2274 (97%)
text_code_colored.pngEPI699605A/American green-winged teal/Interior Alaska/11BM03443/2011 (A/H0) segment 2 (PB1)3851.40.000000e+002211/2274 (97%)
text_code_colored.pngEPI512401A/blue-winged teal/Missouri/11OS2585/2011 (A/H4N8) segment 2 (PB1)3851.40.000000e+002211/2274 (97%)
text_code_colored.pngEPI453910A/northern pintail/Interior Alaska/10BM10298R0/2010 (A/H3N8) segment 2 (PB1)3851.40.000000e+002211/2274 (97%)
text_code_colored.pngEPI436612A/northern shoveler/Interior Alaska/10BM05487R0/2010 (A/H3N8) segment 2 (PB1)3851.40.000000e+002211/2274 (97%)
text_code_colored.pngEPI436589A/northern shoveler/Interior Alaska/10BM05382R0/2010 (A/H3N8) segment 2 (PB1)3851.40.000000e+002211/2274 (97%)
text_code_colored.pngEPI418706A/American green-winged teal/Illinois/10OS1598/2010 (A/H4N8) segment 2 (PB1)3851.40.000000e+002211/2274 (97%)
text_code_colored.pngEPI387181A/mallard/California/2396/2010 (A/H5N2) segment 2 (PB1)3851.40.000000e+002211/2274 (97%)
text_code_colored.pngEPI225176A/mallard/Quebec/10969/2006 (A/H2N3) segment 2 (PB1)3851.40.000000e+002211/2274 (97%)
text_code_colored.pngEPI699668A/mallard/Interior Alaska/11BM03735/2011 (A/H4N6) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI549555A/blue-winged teal/TX/AI13-1009/2013 (A/H11N3) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI512676A/mallard/Wisconsin/11OS3468/2011 (A/H2N3) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI512660A/wood duck/Wisconsin/11OS3443/2011 (A/H11N9) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI512230A/mallard/Arkansas/12OS179/2012 (A/H1N1) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI436619A/northern shoveler/Interior Alaska/10BM05491R0/2010 (A/H3N8) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI420214A/green-winged teal/California/123/2012 (A/H1N1) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI420087A/mallard/California/2584V/2011 (A/H4N9) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI420080A/mallard/California/2584P/2011 (A/H4N9) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI418963A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI387271A/northern shoveler/California/3628/2011 (A/H10) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI225280A/mallard/Quebec/11247/2006 (A/H3N2) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI225272A/mallard/Quebec/11194/2006 (A/H3N2) segment 2 (PB1)3845.80.000000e+002210/2274 (97%)
text_code_colored.pngEPI699619A/mallard/Interior Alaska/11BM03577/2011 (A/H7N3) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI595561A/environment/Maryland/07OS1640/2007 (A/H3N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI595547A/environment/Maryland/07OS1637/2007 (A/H3N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI595533A/environment/Maryland/07OS1634/2007 (A/H3N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI595526A/environment/Maryland/07OS1633/2007 (A/H3N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI595519A/environment/Maryland/07OS1632/2007 (A/H3N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI595442A/environment/Maryland/07OS1613/2007 (A/H3N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI595428A/environment/Maryland/07OS1606/2007 (A/H3N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI595421A/environment/Maryland/07OS1605/2007 (A/H3N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI595414A/environment/Maryland/07OS1603/2007 (A/H3N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI595393A/environment/Maryland/07OS1592/2007 (A/H3N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI595358A/mallard/Maryland/06OS2334/2006 (A/H12N5) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI591029A/environment/Maryland/07OS1618/2007 (A/H3N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI531395A/blue-winged teal/Guatemala/CIP049H105-15/2011 (A/H14N3) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI527489A/blue-winged teal/TX/AI13-1028/2013 (A/H14N5) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI420073A/mallard/California/2578V/2011 (A/H0) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI419953A/mallard/California/2559P/2011 (A/H5N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI419909A/mallard/California/2552V/2011 (A/H4N8) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI419869A/mallard/California/2542V/2011 (A/H5N1) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI419842A/mallard/California/2536P/2011 (A/H5N1) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI419835A/mallard/California/2535V/2011 (A/H5N1) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI419828A/mallard/California/2535P/2011 (A/H5N1) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI418856A/mallard/Wisconsin/10OS4194/2010 (A/H11N9) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI398563A/chicken/Jalisco/12283/2012 (A/H7N3) segment 2 (PB1)3840.30.000000e+002209/2274 (97%)
text_code_colored.pngEPI616160A/American green-winged teal/Ohio/12OS2128/2012 (A/H6N5) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI616068A/northern shoveler/Ohio/12OS3173/2012 (A/H12N5) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI595554A/environment/Maryland/07OS1639/2007 (A/H3N8) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI595498A/environment/Maryland/07OS1623/2007 (A/H3N8) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI595463A/environment/Maryland/07OS1617/2007 (A/H3N8) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI595449A/environment/Maryland/07OS1614/2007 (A/H3N8) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI595435A/environment/Maryland/07OS1608/2007 (A/H3N8) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI595400A/environment/Maryland/07OS1597/2007 (A/H3N8) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI513088A/mallard/Wisconsin/11OS4104/2011 (A/H1N2) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI452523A/northern pintail/Interior Alaska/10BM12413R0/2010 (A/H8N4) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI420142A/mallard/California/2595V/2011 (A/H12N5) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI420135A/mallard/California/2595P/2011 (A/H12N5) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI420114A/mallard/California/2590V/2011 (A/H4N6) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI419939A/mallard/California/2555V/2011 (A/H11N9) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI419916A/mallard/California/2555P/2011 (A/H11N9) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI419807A/mallard/California/2531V/2011 (A/H5N1) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI419794A/mallard/California/2531P/2011 (A/H5N1) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI419786A/mallard/California/2527V/2011 (A/H5N1) segment 2 (PB1)3834.80.000000e+002208/2274 (97%)
text_code_colored.pngEPI616243A/blue-winged teal/Ohio/12OS2108/2012 (A/H0) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI614841A/mallard/Ohio/12OS5400/2013 (A/H0) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI595540A/environment/Maryland/07OS1635/2007 (A/H3N8) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI595512A/environment/Maryland/07OS1630/2007 (A/H3N8) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI595505A/environment/Maryland/07OS1626/2007 (A/H3N8) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI595491A/environment/Maryland/07OS1622/2007 (A/H3N8) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI595484A/environment/Maryland/07OS1621/2007 (A/H3N8) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI595477A/environment/Maryland/07OS1620/2007 (A/H3N8) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI595470A/environment/Maryland/07OS1619/2007 (A/H3N8) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI595456A/environment/Maryland/07OS1615/2007 (A/H3N8) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI595407A/environment/Maryland/07OS1598/2007 (A/H3N8) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI449877A/blue-winged Teal/Texas/AI09-3464/2009 (A/H4N8) segment 2 (PB1)3829.20.000000e+002209/2276 (97%)
text_code_colored.pngEPI420128A/mallard/California/2594V/2011 (A/H4N6) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI420121A/mallard/California/2594P/2011 (A/H4N6) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI420101A/mallard/California/2589V/2011 (A/H4N1) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI420094A/mallard/California/2589P/2011 (A/H4N1) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI419855A/mallard/California/2536V/2011 (A/H5N1) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI419821A/mallard/California/2533V/2011 (A/H4N6) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI419779A/mallard/California/2525P/2011 (A/H4N6) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI418440A/mallard/California/2525V/2011 (A/H0) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI280628A/waterfowl/Colorado/476466-2/2007 (A/H5N2) segment 2 (PB1)3829.20.000000e+002207/2274 (97%)
text_code_colored.pngEPI617004A/mallard/Alberta/192/2010 (A/H7N3) segment 2 (PB1)3823.70.000000e+002206/2274 (97%)
text_code_colored.pngEPI616992A/mallard/Alberta/167/2010 (A/H7N3) segment 2 (PB1)3823.70.000000e+002206/2274 (97%)
text_code_colored.pngEPI616341A/mallard/Missouri/12OS5759/2012 (A/H11N9) segment 2 (PB1)3823.70.000000e+002206/2274 (97%)
text_code_colored.pngEPI616276A/mallard/Ohio/12OS2351/2012 (A/H3N6) segment 2 (PB1)3823.70.000000e+002206/2274 (97%)
text_code_colored.pngEPI616122A/American green-winged teal/Ohio/12OS2161/2012 (A/H11N2) segment 2 (PB1)3823.70.000000e+002206/2274 (97%)
text_code_colored.pngEPI531387A/blue-winged teal/Guatemala/CIP049H106-62/2011 (A/H14N6) segment 2 (PB1)3823.70.000000e+002206/2274 (97%)
text_code_colored.pngEPI513151A/northern shoveler/Wisconsin/11OS4631/2011 (A/H0) segment 2 (PB1)3823.70.000000e+002206/2274 (97%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI486916A/northern pintail/California/2789/2011 (A/H9N2) segment 3 (PA)3818.10.000000e+002123/2151 (98%)
text_code_colored.pngEPI549237A/blue-winged teal/TX/AI12-802/2012 (A/H10N3) segment 3 (PA)3812.60.000000e+002122/2151 (98%)
text_code_colored.pngEPI511416A/mallard/Wisconsin/11OS4368/2011 (A/H11N9) segment 3 (PA)3801.50.000000e+002120/2151 (98%)
text_code_colored.pngEPI549236A/blue-winged teal/TX/AI12-801/2012 (A/H10N3) segment 3 (PA)3796.00.000000e+002111/2139 (98%)
text_code_colored.pngEPI584361A/redhead/Ohio/13OS0406/2013 (A/H7N3) segment 3 (PA)3790.40.000000e+002118/2151 (98%)
text_code_colored.pngEPI526250A/American green-winged teal/Wisconsin/13OS3468/2013 (A/H7N3) segment 3 (PA)3784.90.000000e+002117/2151 (98%)
text_code_colored.pngEPI614135A/American green-winged teal/Ohio/12OS2256/2012 (A/H6N5) segment 3 (PA)3779.40.000000e+002116/2151 (98%)
text_code_colored.pngEPI614026A/American green-winged teal/Wisconsin/12OS2997/2012 (A/H4N6) segment 3 (PA)3779.40.000000e+002116/2151 (98%)
text_code_colored.pngEPI343060A/blue-winged teal/Alberta/378/2007 (A/H0) segment 3 (PA)3779.40.000000e+002116/2151 (98%)
text_code_colored.pngEPI343049A/blue-winged teal/Alberta/380/2007 (A/H0) segment 3 (PA)3773.80.000000e+002115/2151 (98%)
text_code_colored.pngEPI526211A/blue-winged teal/Ohio/13OS2037/2013 (A/H7N1) segment 3 (PA)3768.30.000000e+002114/2151 (98%)
text_code_colored.pngEPI511468A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 3 (PA)3768.30.000000e+002114/2151 (98%)
text_code_colored.pngEPI345105A/bufflehead/Alberta/399/2007 (A/H0) segment 3 (PA)3768.30.000000e+002114/2151 (98%)
text_code_colored.pngEPI511376A/greater scaup/Wisconsin/11OS5760/2011 (A/H10N2) segment 3 (PA)3762.70.000000e+002113/2151 (98%)
text_code_colored.pngEPI511371A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 3 (PA)3762.70.000000e+002113/2151 (98%)
text_code_colored.pngEPI511430A/American green-winged teal/Mississippi/11OS5903/2011 (A/H4N6) segment 3 (PA)3751.70.000000e+002111/2151 (98%)
text_code_colored.pngEPI614117A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 3 (PA)3746.10.000000e+002110/2151 (98%)
text_code_colored.pngEPI511346A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 3 (PA)3740.60.000000e+002109/2151 (98%)
text_code_colored.pngEPI614088A/mallard/Missouri/12OS5759/2012 (A/H11N9) segment 3 (PA)3729.50.000000e+002107/2151 (97%)
text_code_colored.pngEPI614017A/blue winged-teal/Wisconsin/12OS3069/2012 (A/H11N9) segment 3 (PA)3690.70.000000e+002100/2151 (97%)
text_code_colored.pngEPI227246A/mallard/Alberta/11527/2005 (A/H3N8) segment 3 (PA)3679.60.000000e+002098/2151 (97%)
text_code_colored.pngEPI332987A/pintail/Alaska/99/2005 (A/H0) segment 3 (PA)3635.30.000000e+002090/2151 (97%)
text_code_colored.pngEPI298663A/mallard/Interior Alaska/6MP0891/2006 (A/H4N6) segment 3 (PA)3635.30.000000e+002090/2151 (97%)
text_code_colored.pngEPI614217A/mallard/Alberta/26/2001 (A/H0) segment 3 (PA)3629.80.000000e+002089/2151 (97%)
text_code_colored.pngEPI59866A/green-winged teal/Ohio/1844/2005 (A/H11N9) segment 3 (PA)3629.80.000000e+002089/2151 (97%)
text_code_colored.pngEPI49402A/pintail/Alaska/310/2005 (A/H4N6) segment 3 (PA)3629.80.000000e+002089/2151 (97%)
text_code_colored.pngEPI333931A/northern pintail/Wisconsin/4198/2009 (A/H11N9) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI328225A/mallard/California/8834/2008 (A/H5N9) segment 3 (PA)3624.20.000000e+002088/2151 (97%)
text_code_colored.pngEPI298535A/northern pintail/Interior Alaska/6MP0817/2006 (A/H0) segment 3 (PA)3624.20.000000e+002088/2151 (97%)
text_code_colored.pngEPI238090A/mallard/Minnesota/382/2000 (A/H5N3) segment 3 (PA)3624.20.000000e+002088/2151 (97%)
text_code_colored.pngEPI298607A/green-winged teal/Interior Alaska/6MP1077/2006 (A/H3N8) segment 3 (PA)3618.70.000000e+002087/2151 (97%)
text_code_colored.pngEPI159138A/mallard/MN/479/2000 (A/H5N3) segment 3 (PA)3618.70.000000e+002087/2151 (97%)
text_code_colored.pngEPI442231A/greater white-fronted goose/Alaska/44064-108/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI299803A/mallard/Interior Alaska/6MP0990R1/2006 (A/H0) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI298759A/mallard/Interior Alaska/6MP0038BR2/2006 (A/H2N3) segment 3 (PA)3613.20.000000e+002086/2151 (96%)
text_code_colored.pngEPI298687A/mallard/Interior Alaska/6MP0988/2006 (A/H0) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI298647A/northern pintail/Interior Alaska/6MP0792/2006 (A/H2N3) segment 3 (PA)3613.20.000000e+002086/2151 (96%)
text_code_colored.pngEPI298575A/mallard/Interior Alaska/6MP0992/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI298567A/mallard/Interior Alaska/6MP0991/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288891A/mallard/Alaska/44185-044/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288886A/mallard/Alaska/44187-131/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288885A/mallard/Alaska/44185-067/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288878A/mallard/Alaska/44187-129/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288866A/mallard/Alaska/44187-043/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288857A/mallard/Alaska/44185-078/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288884A/mallard/Alaska/44185-043/2006 (A/H3N2) segment 3 (PA)3605.80.000000e+002085/2152 (96%)
text_code_colored.pngEPI442279A/emperor goose/Alaska/44323-246/2007 (A/H3N8) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI442257A/emperor goose/Alaska/44063-066/2006 (A/H2N5) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI288890A/mallard/Alaska/44183-124/2006 (A/H2N3) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI229634A/mallard/Maryland/948/2004 (A/H11N9) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI442254A/emperor goose/Alaska/44063-075/2006 (A/H2N5) segment 3 (PA)3598.40.000000e+002083/2151 (96%)
text_code_colored.pngEPI614212A/pintail/Alberta/25/2001 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI442233A/emperor goose/Alaska/44064-075/2006 (A/H2N5) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI442230A/brant/Alaska/44063-007/2006 (A/H2N1) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI343802A/mallard/Alberta/22/2001 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI343794A/mallard/Alberta/27/2001 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI299763A/mallard/Interior Alaska/6MP0905/2006 (A/H10N9) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI298767A/mallard/Interior Alaska/6MP0163AR2/2006 (A/H3N8) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI298671A/mallard/Interior Alaska/6MP0951/2006 (A/H3N8) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI298639A/mallard/Interior Alaska/6MP0272/2006 (A/H3N8) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI229642A/mallard/Maryland/950/2004 (A/H11N9) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI229618A/mallard/Maryland/922/2004 (A/H11N9) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI229599A/blue-winged teal/Ohio/658/2004 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI229592A/green-winged teal/Ohio/648/2004 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI172224A/blue-winged teal/Manitoba/13436/2005 (A/H3N8) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI166788A/northern pintail/Alaska/44183-123/2006 (A/H2N3) segment 3 (PA)3596.50.000000e+002077/2142 (96%)
text_code_colored.pngEPI52155A/blue-winged teal/Ohio/658/2004 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI442260A/emperor goose/Alaska/44063-029/2006 (A/H2N1) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI298735A/mallard/Interior Alaska/6MP0972R1/2006 (A/H3N8) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI285899A/northern pintail/California/466371/2006 (A/H5N2) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI229650A/mallard/Maryland/954/2004 (A/H11N9) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI229626A/mallard/Maryland/926/2004 (A/H11N9) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI42054A/mallard/Alberta/34/2001 (A/H7N1) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI442237A/emperor goose/Alaska/44063-145/2006 (A/H2N1) segment 3 (PA)3587.30.000000e+002081/2151 (96%)
text_code_colored.pngEPI614244A/northern shoveler/North Carolina/1523546/2005 (A/H0) segment 3 (PA)3585.50.000000e+002081/2151 (96%)
text_code_colored.pngEPI298503A/green-winged teal/Interior Alaska/6MP0736/2006 (A/H3N8) segment 3 (PA)3585.50.000000e+002081/2151 (96%)
text_code_colored.pngEPI60208A/green-winged teal/Ohio/1324/2005 (A/H4N6) segment 3 (PA)3585.50.000000e+002081/2151 (96%)
text_code_colored.pngEPI59999A/green-winged teal/Ohio/1324/2005 (A/H4N6) segment 3 (PA)3585.50.000000e+002081/2151 (96%)
text_code_colored.pngEPI343337A/mallard/Alberta/256/2006 (A/H0) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI342991A/mallard/Alberta/507/2008 (A/H3N8) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI275169A/thick-billed murre/Alaska/44085-040/2006 (A/H10N3) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI80956A/mallard/Alberta/24/01 (A/H7N3) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI475436A/pintail/Alberta/68/2005 (A/H1N1) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI468612A/mallard/Alberta/201/1998 (A/H1N1) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI454182A/American black duck/North Carolina/1321373/2004 (A/H3N2) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI343304A/mallard/Alberta/297/2006 (A/H4N6) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI286504A/American widgeon/Washington/466769/2006 (A/H5N2) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI229506A/American black duck/North Carolina/675-075/2004 (A/H3N2) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI178029A/northern pintail/California/44221-789/2006 (A/H5N2) segment 3 (PA)3574.40.000000e+002073/2142 (96%)
text_code_colored.pngEPI159712A/turkey/CA/358533/2005 (A/H4N8) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI86732A/mallard/ALB/201/1998 (A/H1N1) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI227285A/mallard/California/GL30/2005 (A/H4N6) segment 3 (PA)3570.70.000000e+002079/2152 (96%)
text_code_colored.pngEPI468369A/pintail/Alberta/69/2005 (A/H1N1) segment 3 (PA)3568.80.000000e+002078/2151 (96%)
text_code_colored.pngEPI435728A/pintail/Alberta/69/2005 (A/H1N1) segment 3 (PA)3568.80.000000e+002078/2151 (96%)
text_code_colored.pngEPI343356A/mallard/Alberta/246/2006 (A/H4N6) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI343348A/mallard/Alberta/254/2006 (A/H4N6) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI343328A/mallard/Alberta/258/2006 (A/H4N6) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI229692A/chicken/British Columbia/04 (A/H7N3) segment 3 (PA)3568.80.000000e+002078/2151 (96%)
text_code_colored.pngEPI178030A/northern pintail/California/44221-794/2006 (A/H3N8) segment 3 (PA)3568.80.000000e+002072/2142 (96%)
text_code_colored.pngEPI80964A/mallard/Alberta/24/01 (A/H7N3) segment 3 (PA)3568.80.000000e+002078/2151 (96%)
text_code_colored.pngEPI43050A/Canada/rv504/2004 (A/H7N3) segment 3 (PA)3568.80.000000e+002078/2151 (96%)
text_code_colored.pngEPI450132A/mallard/Minnesota/182772/1998 (A/H4N2) segment 3 (PA)3563.30.000000e+002077/2151 (96%)
text_code_colored.pngEPI442258A/emperor goose/Alaska/44045-125/2006 (A/H4N6) segment 3 (PA)3563.30.000000e+002077/2151 (96%)
text_code_colored.pngEPI238952A/mallard/Minnesota/371/1998 (A/H4N2) segment 3 (PA)3563.30.000000e+002077/2151 (96%)
text_code_colored.pngEPI228472A/environment/Canada/av41/2004 (A/H7N3) segment 3 (PA)3563.30.000000e+002077/2151 (96%)
text_code_colored.pngEPI226939A/chicken/Canada/314514-2/2005 (A/H7N3) segment 3 (PA)3563.30.000000e+002077/2151 (96%)
text_code_colored.pngEPI178031A/northern pintail/California/44221-797/2006 (A/H5N2) segment 3 (PA)3563.30.000000e+002072/2143 (96%)
text_code_colored.pngEPI549741A/chicken/BC/CN-006/2004 (A/H7N3) segment 3 (PA)3557.80.000000e+002076/2151 (96%)
text_code_colored.pngEPI442264A/emperor goose/Alaska/44063-049/2006 (A/H4N6) segment 3 (PA)3557.80.000000e+002076/2151 (96%)
text_code_colored.pngEPI298303A/blue-winged teal/Minnesota/Sg-00201/2007 (A/H4N6) segment 3 (PA)3557.80.000000e+002078/2153 (96%)
text_code_colored.pngEPI241715A/mallard/Alberta/11513/2005 (A/H0) segment 3 (PA)3557.80.000000e+002076/2151 (96%)
text_code_colored.pngEPI228389A/chicken/British Columbia/GSC_human_B/04 (A/H7N3) segment 3 (PA)3557.80.000000e+002076/2151 (96%)
text_code_colored.pngEPI226932A/chicken/Canada/314514-1/2005 (A/H7N3) segment 3 (PA)3557.80.000000e+002076/2151 (96%)
text_code_colored.pngEPI131799A/muscovy duck/New York/21211-5/2005 (A/H1N1) segment 3 (PA)3557.80.000000e+002077/2152 (96%)
text_code_colored.pngEPI59258A/common scoter/Maryland/297/2005 (A/H10N8) segment 3 (PA)3557.80.000000e+002076/2151 (96%)
text_code_colored.pngEPI343023A/redhead/Alberta/458/2007 (A/H3N8) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI332976A/common scoter/Maryland/299/2005 (A/H0) segment 3 (PA)3552.20.000000e+002075/2151 (96%)
text_code_colored.pngEPI280499A/green winged teal/Delaware/458672-5/2006 (A/H5N2) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI228413A/GSC_chicken_B/British Columbia/04 (A/H7N3) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI173560A/mallard/Maryland/319/2003 (A/H2N3) segment 3 (PA)3552.20.000000e+002076/2152 (96%)
text_code_colored.pngEPI52193A/snow goose/Maryland/364/2005 (A/H6N1) segment 3 (PA)3552.20.000000e+002075/2151 (96%)
text_code_colored.pngEPI442283A/emperor goose/Alaska/44297-260/2007 (A/H2N2) segment 3 (PA)3546.70.000000e+002074/2151 (96%)
text_code_colored.pngEPI288879A/mallard/Alaska/44243-016/2006 (A/H4N6) segment 3 (PA)3546.70.000000e+002074/2151 (96%)
text_code_colored.pngEPI227221A/green-winged teal/California/K218/2005 (A/H4N6) segment 3 (PA)3546.70.000000e+002075/2152 (96%)
text_code_colored.pngEPI183880A/mallard/Maryland/320/2003 (A/H2N3) segment 3 (PA)3546.70.000000e+002075/2152 (96%)
text_code_colored.pngEPI183872A/mallard/Maryland/333/2003 (A/H2N3) segment 3 (PA)3546.70.000000e+002075/2152 (96%)
text_code_colored.pngEPI173464A/mallard/Maryland/314/2003 (A/H2N3) segment 3 (PA)3546.70.000000e+002075/2152 (96%)
text_code_colored.pngEPI173456A/mallard/Maryland/316/2003 (A/H2N3) segment 3 (PA)3546.70.000000e+002075/2152 (96%)
text_code_colored.pngEPI280555A/mallard/Nevada/449567-3/2006 (A/H5N2) segment 3 (PA)3541.10.000000e+002074/2152 (96%)
text_code_colored.pngEPI188441A/mallard/Minnesota/Sg-00580/2008 (A/H3N8) segment 3 (PA)3541.10.000000e+002074/2152 (96%)
text_code_colored.pngEPI183864A/mallard/Maryland/338/2003 (A/H2N3) segment 3 (PA)3541.10.000000e+002074/2152 (96%)
text_code_colored.pngEPI173568A/mallard/Maryland/301/2003 (A/H2N3) segment 3 (PA)3541.10.000000e+002074/2152 (96%)
text_code_colored.pngEPI173472A/mallard/Maryland/296/2003 (A/H2N3) segment 3 (PA)3541.10.000000e+002074/2152 (96%)
text_code_colored.pngEPI327398A/ring-necked duck/Ontario/15530/2005 (A/H3N2) segment 3 (PA)3539.30.000000e+002072/2150 (96%)
text_code_colored.pngEPI287387A/chicken/British Columbia/NS-01827-4/2004 (A/H7N3) segment 3 (PA)3537.50.000000e+002072/2152 (96%)
text_code_colored.pngEPI228421A/GSC_chicken/British Columbia/04 (A/H7N3) segment 3 (PA)3537.50.000000e+002074/2152 (96%)
text_code_colored.pngEPI468292A/mallard/Alberta/119/1998 (A/H1N1) segment 3 (PA)3535.60.000000e+002072/2151 (96%)
text_code_colored.pngEPI436427A/mallard/Alberta/119/1998 (A/H1N1) segment 3 (PA)3535.60.000000e+002072/2151 (96%)
text_code_colored.pngEPI292411A/cinnamon teal/California/44287-234/2007 (A/H11N9) segment 3 (PA)3535.60.000000e+002072/2151 (96%)
text_code_colored.pngEPI290647A/northern shoveler/California/44287-088/2007 (A/H10N7) segment 3 (PA)3535.60.000000e+002072/2151 (96%)
text_code_colored.pngEPI280819A/green winged teal/Iowa/463990-3/2006 (A/H5N2) segment 3 (PA)3535.60.000000e+002072/2151 (96%)
text_code_colored.pngEPI280739A/snow goose/Montana/466771-4/2006 (A/H5N2) segment 3 (PA)3535.60.000000e+002072/2151 (96%)
text_code_colored.pngEPI188153A/blue-winged teal/Minnesota/Sg-00453/2008 (A/H3N8) segment 3 (PA)3535.60.000000e+002072/2151 (96%)
text_code_colored.pngEPI451073A/northern pintail/Interior Alaska/10BM08514R0/2010 (A/H4N6) segment 3 (PA)3530.10.000000e+002073/2153 (96%)
text_code_colored.pngEPI451035A/mallard/Interior Alaska/9BM12567R0/2009 (A/H3N8) segment 3 (PA)3530.10.000000e+002072/2152 (96%)
text_code_colored.pngEPI447853A/blue-winged Teal/North Dakota/AI09-3131/2009 (A/H4N6) segment 3 (PA)3530.10.000000e+002072/2152 (96%)
text_code_colored.pngEPI447524A/mallard/Minnesota/Sg-00831/2008 (A/H3N8) segment 3 (PA)3530.10.000000e+002071/2151 (96%)
text_code_colored.pngEPI292861A/green-winged teal/California/JN1323/2007 (A/H10N7) segment 3 (PA)3530.10.000000e+002071/2151 (96%)
text_code_colored.pngEPI285893A/northern pintail/Wisconsin/462764/2006 (A/H5N2) segment 3 (PA)3530.10.000000e+002072/2152 (96%)
text_code_colored.pngEPI280763A/mallard/Michigan/466372-3/2006 (A/H5N2) segment 3 (PA)3530.10.000000e+002072/2152 (96%)
text_code_colored.pngEPI220715A/ring-necked duck/Minnesota/Sg-00449/2008 (A/H4N8) segment 3 (PA)3530.10.000000e+002071/2151 (96%)
text_code_colored.pngEPI188145A/blue-winged teal/Minnesota/Sg-00451/2008 (A/H4N8) segment 3 (PA)3530.10.000000e+002071/2151 (96%)
text_code_colored.pngEPI188141A/blue-winged teal/Minnesota/Sg-00450/2008 (A/H4N8) segment 3 (PA)3530.10.000000e+002071/2151 (96%)
text_code_colored.pngEPI689593A/American green winged teal/Utah/A00461136/2009 (A/H7N1) segment 3 (PA)3524.50.000000e+002072/2153 (96%)
text_code_colored.pngEPI451105A/mallard/Interior Alaska/10BM10864R0/2010 (A/H4N6) segment 3 (PA)3524.50.000000e+002072/2153 (96%)
text_code_colored.pngEPI451102A/mallard/Interior Alaska/10BM10176R0/2010 (A/H4N6) segment 3 (PA)3524.50.000000e+002072/2153 (96%)
text_code_colored.pngEPI451087A/mallard/Interior Alaska/10BM09562R0/2010 (A/H4N6) segment 3 (PA)3524.50.000000e+002072/2153 (96%)
text_code_colored.pngEPI451036A/northern pintail/Interior Alaska/9BM12647R0/2009 (A/H3N8) segment 3 (PA)3524.50.000000e+002071/2152 (96%)
text_code_colored.pngEPI451005A/northern shoveler/Interior Alaska/9BM12298R0/2009 (A/H3N8) segment 3 (PA)3524.50.000000e+002071/2152 (96%)
text_code_colored.pngEPI450989A/northern pintail/Interior Alaska/9BM10819R0/2009 (A/H3N8) segment 3 (PA)3524.50.000000e+002071/2152 (96%)
text_code_colored.pngEPI450951A/northern pintail/Interior Alaska/9BM7836R0/2009 (A/H3N8) segment 3 (PA)3524.50.000000e+002071/2152 (96%)
text_code_colored.pngEPI447516A/mallard/Minnesota/Sg-00692/2008 (A/H2N3) segment 3 (PA)3524.50.000000e+002071/2152 (96%)
text_code_colored.pngEPI438302A/cinnamon teal/Mexico/2817/2006 (A/H7N3) segment 3 (PA)3524.50.000000e+002072/2153 (96%)
text_code_colored.pngEPI436180A/northern pintail/Interior Alaska/10BM04704R0/2010 (A/H4N6) segment 3 (PA)3524.50.000000e+002072/2153 (96%)
text_code_colored.pngEPI418748A/wood duck/Wisconsin/10OS2778/2010 (A/H3N8) segment 3 (PA)3524.50.000000e+002071/2152 (96%)
text_code_colored.pngEPI418739A/mallard/Wisconsin/10OS2773/2010 (A/H3N8) segment 3 (PA)3524.50.000000e+002071/2152 (96%)
text_code_colored.pngEPI331833A/wood duck/Ohio/623/2004 (A/H5N1) segment 3 (PA)3524.50.000000e+002070/2151 (96%)
text_code_colored.pngEPI315068A/blue-winged teal/Ohio/1850/2006 (A/H4N6) segment 3 (PA)3524.50.000000e+002071/2152 (96%)
text_code_colored.pngEPI292459A/gadwall/California/44287-543/2007 (A/H10N7) segment 3 (PA)3524.50.000000e+002070/2151 (96%)
text_code_colored.pngEPI292451A/gadwall/California/29595/2007 (A/H10N7) segment 3 (PA)3524.50.000000e+002070/2151 (96%)
text_code_colored.pngEPI229684A/wild duck/Ohio/623/2004 (A/H5N1) segment 3 (PA)3524.50.000000e+002070/2151 (96%)
text_code_colored.pngEPI225347A/pintail/Alberta/21/2006 (A/H1N1) segment 3 (PA)3524.50.000000e+002072/2153 (96%)
text_code_colored.pngEPI225215A/mallard/Quebec/11082/2006 (A/H3N8) segment 3 (PA)3524.50.000000e+002070/2151 (96%)
text_code_colored.pngEPI224496A/wood duck/Ohio/423/2004 (A/H5N1) segment 3 (PA)3524.50.000000e+002070/2151 (96%)
text_code_colored.pngEPI188715A/mallard/Minnesota/Sg-00692/2008 (A/H2N3) segment 3 (PA)3524.50.000000e+002071/2152 (96%)
text_code_colored.pngEPI225780A/tundra swan/North Carolina/671-058/2006 (A/H7) segment 3 (PA)3522.70.000000e+002069/2150 (96%)
text_code_colored.pngEPI225313A/mute swan/MI/451072-2/2006 (A/H5N1) segment 3 (PA)3522.70.000000e+002069/2150 (96%)
text_code_colored.pngEPI451097A/mallard/Interior Alaska/10BM10173R0/2010 (A/H4N6) segment 3 (PA)3519.00.000000e+002071/2153 (96%)
text_code_colored.pngEPI451088A/mallard/Interior Alaska/10BM09570R0/2010 (A/H4N6) segment 3 (PA)3519.00.000000e+002071/2153 (96%)
text_code_colored.pngEPI451084A/northern pintail/Interior Alaska/10BM08612R0/2010 (A/H4N6) segment 3 (PA)3519.00.000000e+002071/2153 (96%)
text_code_colored.pngEPI451037A/mallard/Interior Alaska/9BM12694R1/2009 (A/H0) segment 3 (PA)3519.00.000000e+002070/2152 (96%)
text_code_colored.pngEPI451006A/mallard/Interior Alaska/9BM12285R0/2009 (A/H3N8) segment 3 (PA)3519.00.000000e+002070/2152 (96%)
text_code_colored.pngEPI450960A/northern pintail/Interior Alaska/9BM11487R0/2009 (A/H3N8) segment 3 (PA)3519.00.000000e+002070/2152 (96%)
text_code_colored.pngEPI450913A/American green-winged teal/Interior Alaska/9BM6410R0/2009 (A/H3N8) segment 3 (PA)3519.00.000000e+002070/2152 (96%)
text_code_colored.pngEPI447923A/blue-winged teal/Louisiana/AI09-5159/2009 (A/H3N8) segment 3 (PA)3519.00.000000e+002070/2152 (96%)
text_code_colored.pngEPI436309A/northern pintail/Interior Alaska/9BM8583R0/2009 (A/H0) segment 3 (PA)3519.00.000000e+002070/2152 (96%)
text_code_colored.pngEPI436182A/mallard/Interior Alaska/10BM04626R0/2010 (A/H4N6) segment 3 (PA)3519.00.000000e+002071/2153 (96%)
text_code_colored.pngEPI334287A/blue-winged teal/Wisconsin/2753/2009 (A/H4N6) segment 3 (PA)3519.00.000000e+002071/2153 (96%)
text_code_colored.pngEPI327375A/ring-necked duck/Quebec/10513/2006 (A/H10N7) segment 3 (PA)3519.00.000000e+002069/2151 (96%)
text_code_colored.pngEPI299627A/mallard/Interior Alaska/7MP1643/2007 (A/H0) segment 3 (PA)3519.00.000000e+002070/2152 (96%)
text_code_colored.pngEPI290858A/California gull/Washington/20371-003/2007 (A/H10N7) segment 3 (PA)3519.00.000000e+002069/2151 (96%)
text_code_colored.pngEPI290842A/common murre/Oregon/20361-001/2007 (A/H10N7) segment 3 (PA)3519.00.000000e+002069/2151 (96%)
text_code_colored.pngEPI285925A/mallard/NV/453350-8/2006 (A/H5N2) segment 3 (PA)3519.00.000000e+002069/2151 (96%)
text_code_colored.pngEPI224520A/American black duck/New Brunswick/19347/2006 (A/H4N6) segment 3 (PA)3519.00.000000e+002069/2151 (96%)
text_code_colored.pngEPI188504A/mallard/Minnesota/Sg-00637/2008 (A/H3N8) segment 3 (PA)3519.00.000000e+002069/2151 (96%)
text_code_colored.pngEPI178016A/northern pintail/California/44242-758/2006 (A/H5N2) segment 3 (PA)3519.00.000000e+002064/2143 (96%)
text_code_colored.pngEPI700077A/mallard/Interior Alaska/11CH00019/2011 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI700069A/mallard/Interior Alaska/11CH00017/2011 (A/H0) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI689586A/American green winged teal/Utah/A00461135/2009 (A/H7N1) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI594632A/mallard/Maryland/06OS2409/2006 (A/H10N4) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI451316A/northern pintail/Interior Alaska/10BM12146R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI451113A/mallard/Interior Alaska/10BM11497R0/2010 (A/H3N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI451106A/mallard/Interior Alaska/10BM11311R0/2010 (A/H3N8) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI451086A/mallard/Interior Alaska/10BM09561R0/2010 (A/H3N8) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI451078A/mallard/Interior Alaska/10BM08828R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI451063A/northern pintail/Interior Alaska/10BM07993R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI451059A/mallard/Interior Alaska/10BM07777R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI451055A/northern pintail/Interior Alaska/10BM07476R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI447507A/mallard/Minnesota/SG-00929/2008 (A/H3N8) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI436221A/mallard/Interior Alaska/10BM06461R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436220A/mallard/Interior Alaska/10BM06460R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436219A/mallard/Interior Alaska/10BM06459R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436218A/mallard/Interior Alaska/10BM06456R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436217A/mallard/Interior Alaska/10BM06455R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436216A/mallard/Interior Alaska/10BM06454R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436215A/mallard/Interior Alaska/10BM06452R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436214A/mallard/Interior Alaska/10BM06450R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436213A/mallard/Interior Alaska/10BM06448R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436198A/northern shoveler/Interior Alaska/10BM05408R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436195A/mallard/Interior Alaska/10BM04988R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436194A/American wigeon/Interior Alaska/10BM05310R0/2010 (A/H0) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI436135A/American green-winged teal/Interior Alaska/10BM05434R0/2010 (A/H0) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI435779A/American green-winged teal/Interior Alaska/10BM05439R0/2010 (A/H0) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI432785A/mallard/Interior Alaska/10BM06397R0/2010 (A/H0) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI432750A/American green-winged teal/Interior Alaska/10BM05438R0/2010 (A/H0) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI414497A/American green-winged teal/Interior Alaska/10BM04207R0/2010 (A/H3N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI414473A/northern pintail/Interior Alaska/10BM02791R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI414465A/mallard/Interior Alaska/10BM02644R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI414449A/northern shoveler/Interior Alaska/10BM02593R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI414420A/northern shoveler/Interior Alaska/10BM02892R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI414397A/mallard/Interior Alaska/10BM02530R0/2010 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI413836A/environment/Ohio/08OS1302/2008 (A/H4N3) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI299578A/northern pintail/Interior Alaska/7MP0509/2007 (A/H3N8) segment 3 (PA)3513.40.000000e+002069/2152 (96%)
text_code_colored.pngEPI299063A/northern pintail/Interior Alaska/7MP2228/2007 (A/H3N8) segment 3 (PA)3513.40.000000e+002069/2152 (96%)
text_code_colored.pngEPI298080A/blue-winged teal/Texas/Sg-00157/2007 (A/H4N6) segment 3 (PA)3513.40.000000e+002070/2153 (96%)
text_code_colored.pngEPI296960A/American widgeon/Interior Alaska/7MP1707/2007 (A/H3N8) segment 3 (PA)3513.40.000000e+002069/2152 (96%)
text_code_colored.pngEPI296895A/northern shoveler/Interior Alaska/7MP1765/2007 (A/H3N8) segment 3 (PA)3513.40.000000e+002069/2152 (96%)
text_code_colored.pngEPI225247A/mallard/Quebec/11111/2006 (A/H11N9) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI225166A/mallard/Pennsylvania/454069-12/2006 (A/H5N4) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI222184A/mallard/Interior Alaska/2/2007 (A/H3N8) segment 3 (PA)3513.40.000000e+002069/2152 (96%)
text_code_colored.pngEPI188731A/mallard/Minnesota/Sg-00696/2008 (A/H3N8) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI188624A/northern shoveler/Minnesota/Sg-00669/2008 (A/H3N8) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI188607A/northern shoveler/Minnesota/Sg-00663/2008 (A/H3N8) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI188589A/northern shoveler/Minnesota/Sg-00658/2008 (A/H3N8) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI188535A/mallard/Minnesota/Sg-00644/2008 (A/H3N8) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI188527A/mallard/Minnesota/Sg-00642/2008 (A/H3N8) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI188489A/mallard/Minnesota/Sg-00634/2008 (A/H3N8) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI178638A/northern shoveler/Interior Alaska/3/2007 (A/H3N8) segment 3 (PA)3513.40.000000e+002069/2152 (96%)
text_code_colored.pngEPI159458A/northern shoveler/California/HKWF1128/2007 (A/H2N7) segment 3 (PA)3513.40.000000e+002068/2151 (96%)
text_code_colored.pngEPI188519A/mallard/Minnesota/Sg-00640/2008 (A/H3N8) segment 3 (PA)3511.60.000000e+002067/2151 (96%)
 

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI334349A/bufflehead/Illinois/4016/2009 (A/H4N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)
text_code_colored.pngEPI419535A/American green-winged teal/Mississippi/11OS257/2011 (A/H11N9) segment 5 (NP)2654.80.000000e+001477/1497 (98%)
text_code_colored.pngEPI418545A/mallard/Wisconsin/10OS3166/2010 (A/H0) segment 5 (NP)2654.80.000000e+001477/1497 (98%)
text_code_colored.pngEPI512266A/blue-winged teal/Wisconsin/11OS2873/2011 (A/H3N2) segment 5 (NP)2649.20.000000e+001476/1497 (98%)
text_code_colored.pngEPI616325A/northern shoveler/Missouri/12OS5755/2012 (A/H10N3) segment 5 (NP)2632.60.000000e+001473/1497 (98%)
text_code_colored.pngEPI328267A/mallard/California/6957/2008 (A/H10N7) segment 5 (NP)2632.60.000000e+001473/1497 (98%)
text_code_colored.pngEPI616165A/American green-winged teal/Ohio/12OS2137/2012 (A/H4N6) segment 5 (NP)2627.10.000000e+001472/1497 (98%)
text_code_colored.pngEPI512884A/mallard/Wisconsin/11OS4204/2011 (A/H0) segment 5 (NP)2627.10.000000e+001472/1497 (98%)
text_code_colored.pngEPI689534A/American green winged teal/Mississippi/A00630203/2009 (A/H7N6) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI328574A/northern shoveler/California/9710/2008 (A/H10N7) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI299358A/northern shoveler/Mississippi/09OS589/2009 (A/H4N6) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI333661A/American green-winged teal/Mississippi/300/2010 (A/H11N9) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI690051A/northern shoveler/Nevada/A00505416/2008 (A/H7N6) segment 5 (NP)2604.90.000000e+001469/1498 (98%)
text_code_colored.pngEPI328481A/green-winged teal/California/10197/2008 (A/H10N7) segment 5 (NP)2604.90.000000e+001469/1498 (98%)
text_code_colored.pngEPI645515A/blue-winged teal/Ohio/13OS2104/2013 (A/H2N3) segment 5 (NP)2588.30.000000e+001465/1497 (97%)
text_code_colored.pngEPI178799A/northern shoveler/California/HKWF392sm/2007 (A/H10N7) segment 5 (NP)2588.30.000000e+001465/1497 (97%)
text_code_colored.pngEPI435840A/mallard/Alberta/152/2006 (A/H1N3) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI328644A/mallard/California/11032/2008 (A/H0N8) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI328589A/northern shoveler/California/9235/2008 (A/H10N8) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI328075A/northern shoveler/California/9781/2008 (A/H1N3) segment 5 (NP)2582.70.000000e+001465/1498 (97%)
text_code_colored.pngEPI290714A/northern shoveler/Washington/44249-752/2006 (A/H7N3) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI290706A/northern shoveler/Washington/44249-749/2006 (A/H7N3) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI442357A/greater white-fronted goose/Alaska/44049-046/2006 (A/H5N2) segment 5 (NP)2577.20.000000e+001463/1497 (97%)
text_code_colored.pngEPI286140A/white front goose/Alaska//445210/2006 (A/H5N2) segment 5 (NP)2577.20.000000e+001463/1497 (97%)
text_code_colored.pngEPI280601A/white front goose/Alaska/477003/2007 (A/H5N2) segment 5 (NP)2571.70.000000e+001462/1497 (97%)
text_code_colored.pngEPI280585A/tundra swan/Alaska/442960/2006 (A/H5N2) segment 5 (NP)2571.70.000000e+001462/1497 (97%)
text_code_colored.pngEPI292417A/American green-winged teal/California/44287-305/2007 (A/H7N6) segment 5 (NP)2566.10.000000e+001461/1497 (97%)
text_code_colored.pngEPI290661A/American green-winged teal/California/28228/2007 (A/H7N6) segment 5 (NP)2566.10.000000e+001461/1497 (97%)
text_code_colored.pngEPI292804A/northern shoveler/California/JN770/2006 (A/H10N3) segment 5 (NP)2564.30.000000e+001454/1487 (97%)
text_code_colored.pngEPI442383A/tundra swan/Alaska/44049-168/2006 (A/H5N2) segment 5 (NP)2562.40.000000e+001457/1492 (97%)
text_code_colored.pngEPI343451A/mallard/Alberta/190/2006 (A/H0) segment 5 (NP)2560.60.000000e+001460/1497 (97%)
text_code_colored.pngEPI241717A/mallard/Alberta/11513/2005 (A/H0) segment 5 (NP)2560.60.000000e+001460/1497 (97%)
text_code_colored.pngEPI689675A/blue winged teal/Missouri/A00624484/2008 (A/H7N3) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI689668A/blue winged teal/Missouri/A00624483/2008 (A/H7N3) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI475399A/pintail/Alberta/68/2005 (A/H1N1) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI437289A/blue-winged teal/Alberta/405/2008 (A/H10N7) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI435791A/pintail/Alberta/69/2005 (A/H1N1) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI468371A/pintail/Alberta/69/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI455875A/mallard/Minnesota/Sg-00630/2008 (A/H10N7) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI449918A/mallard/Minnesota/AI09-3819/2009 (A/H0) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI435805A/mallard/Alberta/257/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI435798A/mallard/Alberta/240/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI334118A/mallard/Illinois/3747/2009 (A/H6N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI327273A/mallard/Alberta/11393/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI280481A/waterfowl/Colorado/443593/2006 (A/H5N2) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI503530A/wild bird/Chile/1805/2008 (A/H5N9) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI450032A/mallard/Arkansas/AI09-5761/2009 (A/H2N3) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI449854A/northern pintail/Minnesota/AI09-3254/2009 (A/H6N2) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI333933A/northern pintail/Wisconsin/4198/2009 (A/H11N9) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI298301A/blue-winged teal/Minnesota/Sg-00201/2007 (A/H4N6) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI222304A/mallard/Manitoba/23912/2007 (A/H4N7) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI131965A/mallard/Missouri/209/2006 (A/H11N9) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI442354A/greater white-fronted goose/Alaska/44065-031/2006 (A/H5N2) segment 5 (NP)2542.10.000000e+001446/1481 (97%)
text_code_colored.pngEPI689730A/domestic duck/West Virginia/A00140913/2008 (A/H7N3) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI452222A/northern pintail/Interior Alaska/9BM7882R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI452145A/northern pintail/Interior Alaska/9BM11643R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI452004A/northern pintail/Interior Alaska/9BM6510R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI436946A/northern pintail/Interior Alaska/9BM8109R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI407675A/northern shoveler/Interior Alaska/9BM1447R2/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI403274A/northern pintail/Alberta/3/2009 (A/H0) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI334203A/northern shoveler/Mississippi/236/2010 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI333733A/northern shovelerMissouri/196/2009 (A/H10N3) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI299510A/American green-winged teal/Illinois/08OS2713/2008 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI299502A/mallard/Illinois/08OS2711/2008 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI299398A/mallard/Illinois/08OS2710/2008 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI290800A/mallard/Washington/44338-195/2007 (A/H12N5) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI227450A/redhead/Alberta/11817/2005 (A/H4N6) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI220550A/green winged teal/California/AKS1305/2008 (A/H11N9) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI699583A/mallard/Interior Alaska/11BM03577/2011 (A/H7N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI689742A/domestic duck/West Virginia/A00140915/2008 (A/H7N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI689723A/domestic duck/West Virginia/A00140912/2008 (A/H7N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI455976A/mallard/Minnesota/Sg-01005/2008 (A/H0) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI452124A/northern pintail/Interior Alaska/9BM11409R0/2009 (A/H12N5) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI450045A/northern shoveler/Arkansas/AI09-6012/2009 (A/H10N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI448675A/blue-winged teal/North Dakota/Sg-00740/2008 (A/H3N8) segment 5 (NP)2532.90.000000e+001456/1498 (97%)
text_code_colored.pngEPI436979A/northern pintail/Interior Alaska/9BM8967R0/2009 (A/H8N4) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI433101A/American green-winged teal/Interior Alaska/9BM5045R0/2009 (A/H8N4) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI415985A/northern pintail/Interior Alaska/10BM02549R0 (A/H0) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI413412A/mallard/Ohio/10OS1319/2010 (A/H4N6) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI327859A/mallard/California/6768/2009 (A/H1N1) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI299558A/environment/Indiana/08OS3524/2008 (A/H1N2) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI299486A/mallard/Illinois/08OS2315/2008 (A/H4N6) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI292689A/American green-winged teal/California/44363-067/2007 (A/H11N9) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI280841A/mallard/Oregon/461067-2/2006 (A/H5N2) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI230699A/mallard/California/K752/2006 (A/H10N7) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI690027A/northern pintail/Texas/A00466052/2009 (A/H7N3) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI616825A/mallard/Minnesota/AI07-3433/2007 (A/H7N3) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI513040A/mallard/Illinois/11OS5570/2011 (A/H3N8) segment 5 (NP)2527.30.000000e+001455/1498 (97%)
text_code_colored.pngEPI512339A/mallard/Wisconsin/11OS4493/2011 (A/H1N3) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI455983A/mallard/Minnesota/Sg-01030/2008 (A/H10N7) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI452082A/mallard/Interior Alaska/9BM11053R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI452018A/northern pintail/Interior Alaska/9BM7152R2/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI436884A/mallard/Interior Alaska/9BM10537R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI432856A/northern shoveler/Interior Alaska/9BM2925R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI414327A/mallard/Interior Alaska/9BM2705R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI414305A/mallard/Interior Alaska/9BM2351R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI414290A/mallard/Interior Alaska/9BM2388R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI387268A/northern shoveler/California/3628/2011 (A/H10) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI333821A/lesser scaup/Illinois/4115/2009 (A/H10N7) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI328716A/mallard/California/8118/2008 (A/H11N9) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI328171A/mallard/California/10064/2008 (A/H1N6) segment 5 (NP)2527.30.000000e+001455/1498 (97%)
text_code_colored.pngEPI327739A/mallard/California/5192/2009 (A/H4N2) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI327731A/mallard/California/5205/2009 (A/H0) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI299534A/environment/Indiana/08OS2857/2008 (A/H2N3) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI286133A/Canada goose/Wisconsin/474847-4/2006 (A/H5N2) segment 5 (NP)2527.30.000000e+001455/1498 (97%)
text_code_colored.pngEPI286120A/mallard/Wisconsin/464979/2006 (A/H5N2) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI280809A/American wigeon/Iowa/463993/2006 (A/H5N2) segment 5 (NP)2527.30.000000e+001455/1498 (97%)
text_code_colored.pngEPI280801A/American wigeon/Iowa/463998/2006 (A/H5N2) segment 5 (NP)2527.30.000000e+001455/1498 (97%)
text_code_colored.pngEPI689527A/American green winged teal/Mississippi/A00468514/2009 (A/H7N7) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI452332A/mallard/Interior Alaska/9BM9335R0/2009 (A/H10N7) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI452053A/northern pintail/Interior Alaska/9BM7240R0/2009 (A/H8N4) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI452025A/mallard/Interior Alaska/9BM7162R0/2009 (A/H8N4) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI449546A/mallard/Minnesota/Sg-00902/2008 (A/H0) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI449337A/mallard/Minnesota/SG-00927/2008 (A/H6N1) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI449303A/mallard/Minnesota/Sg-00768/2008 (A/H6N2) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI449280A/northern pintail/North Dakota/Sg-00749/2008 (A/H0) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI448634A/mallard/Minnesota/Sg-00686/2008 (A/H8N4) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI448620A/mallard/Minnesota/SG-00680/2008 (A/H0) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI448573A/mallard/Minnesota/Sg-00571/2008 (A/H0) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI435385A/mallard/New Brunswick/00992/2010 (A/H0) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI435376A/American black duck/New Brunswick/00991/2010 (A/H4N6) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI435368A/American black duck/New Brunswick/00988/2010 (A/H0) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI435360A/American black duck/New Brunswick/00987/2010 (A/H0) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI435353A/American black duck/New Brunswick/00986/2010 (A/H4N6) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI433688A/American black duck/New Brunswick/00989/2010 (A/H0) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI433053A/northern shoveler/Interior Alaska/9BM4787R0/2009 (A/H8N4) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI333997A/mallard/Wisconsin/2576/2009 (A/H5N1) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI328655A/mallard/California/10126/2008 (A/H10N7) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI328488A/green-winged teal/California/7972/2008 (A/H6N2) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI327771A/mallard/California/5495/2009 (A/H4N2) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI286118A/northern pintail/Iowa/463992/2006 (A/H5N2) segment 5 (NP)2521.80.000000e+001454/1498 (97%)
text_code_colored.pngEPI286116A/northern pintail/Wisconsin/462764/2006 (A/H5N2) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI225778A/tundra swan/North Carolina/671-058/2006 (A/H7) segment 5 (NP)2521.80.000000e+001453/1497 (97%)
text_code_colored.pngEPI442407A/northern pintail/Alaska/44500-090/2009 (A/H4N6) segment 5 (NP)2518.10.000000e+001449/1492 (97%)
text_code_colored.pngEPI689819A/mallard/Nebraska/A00709657/2009 (A/H7N3) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI689682A/blue winged teal/South Dakota/A00772794/2009 (A/H7N7) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI689390A/mallard/Southcentral Alaska/12ML01469/2014 (A/H0) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI512823A/northern shoveler/Wisconsin/11OS3008/2011 (A/H3N8) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI452367A/mallard/Interior Alaska/9BM11382R0/2009 (A/H3N8) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI452229A/northern pintail/Interior Alaska/9BM8237R0/2009 (A/H8N4) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI452166A/northern pintail/Interior Alaska/9BM11917R0/2009 (A/H8N4) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI452138A/northern pintail/Interior Alaska/9BM11564R0/2009 (A/H10N4) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI452131A/northern pintail/Interior Alaska/9BM11556R0/2009 (A/H8N4) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI452046A/mallard/Interior Alaska/9BM7218R0/2009 (A/H10N7) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI452039A/mallard/Interior Alaska/9BM7216R0/2009 (A/H8N4) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI451468A/northern pintail/Interior Alaska/9BM9955R0/2009 (A/H8N4) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI449443A/mallard/Minnesota/Sg-00701/2008 (A/H8N4) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI442356A/American green-winged teal/Alaska/44160-020/2006 (A/H10N7) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI435151A/mallard/New Brunswick/00854/2010 (A/H4N6) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI399366A/turkey/MB/FAV11/2010 (A/H5N2) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI399358A/turkey/MB/FAV10/2010 (A/H5N2) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI334364A/northern shoveler/Illinois/3767/2009 (A/H0) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI333740A/northern shovelerMissouri/141/2009 (A/H0) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI333613A/northern shoveler/Mississippi/397/2010 (A/H1N3) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI328283A/mallard/California/6634/2008 (A/H11N9) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI328115A/northern shoveler/California/8675/2008 (A/H11N9) segment 5 (NP)2516.30.000000e+001453/1498 (96%)
text_code_colored.pngEPI327803A/mallard/California/5271/2009 (A/H4N6) segment 5 (NP)2516.30.000000e+001453/1498 (96%)
text_code_colored.pngEPI327723A/mallard/California/5255/2009 (A/H3N8) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI300105A/mallard/Interior Alaska/8MP0814R2/2008 (A/H8N4) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI300034A/mallard/Interior Alaska/8BM3499/2008 (A/H8N4) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI299981A/northern pintail/Interior Alaska/8BM2011R1/2008 (A/H8N4) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI299093A/northern pintail/Interior Alaska/8MP0689/2008 (A/H8N4) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI298110A/mallard/Minnesota/Sg-00164/2007 (A/H3N8) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI298102A/blue-winged teal/Louisiana/Sg-00163/2007 (A/H0) segment 5 (NP)2516.30.000000e+001453/1498 (96%)
text_code_colored.pngEPI292553A/mallard/Washington/44338-019/2007 (A/H6N1) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI292537A/mallard/Washington/44338-017/2007 (A/H4N6) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI292529A/mallard/Washington/44338-016/2007 (A/H4N6) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI292521A/mallard/Washington/44338-015/2007 (A/H4N6) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI292513A/mallard/Washington/44338-014/2007 (A/H4N6) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI292497A/mallard/Washington/44338-011/2007 (A/H4N6) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI290792A/mallard/Washington/44338-013/2007 (A/H4N6) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI286131A/mallard/Arkansas/473507-13/2006 (A/H5N2) segment 5 (NP)2516.30.000000e+001453/1498 (96%)
text_code_colored.pngEPI280497A/green winged teal/Delaware/458672-5/2006 (A/H5N2) segment 5 (NP)2516.30.000000e+001452/1497 (96%)
text_code_colored.pngEPI699397A/American green-winged teal/Interior Alaska/11BM00304/2011 (A/H10N5) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI699369A/American green-winged teal/Interior Alaska/11BM00293/2011 (A/H10N5) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI689812A/mallard/Montana/A00750842/2009 (A/H7N3) segment 5 (NP)2510.70.000000e+001452/1498 (96%)
text_code_colored.pngEPI512592A/northern shoveler/Mississippi/11OS5875/2011 (A/H5N2) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI486112A/lesser scaup/California/3087/2010 (A/H0) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI452773A/northern pintail/Interior Alaska/9BM11911R0/2009 (A/H3N8) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI452283A/mallard/Interior Alaska/9BM8389R0/2009 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI452067A/mallard/Interior Alaska/9BM11023R0/2009 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI450008A/blue-winged teal/Louisiana/AI09-5234/2009 (A/H11N2) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI449422A/mallard/Minnesota/Sg-00682/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI448627A/mallard/Minnesota/SG-00684/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI448565A/mallard/Minnesota/Sg-00570/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI435325A/mallard/New Brunswick/00960/2010 (A/H0) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI435314A/American black duck/New Brunswick/00954/2010 (A/H0) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI435268A/American black duck/New Brunswick/00946/2010 (A/H0) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI435202A/American black duck/New Brunswick/00886/2010 (A/H4N9) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI435195A/American black duck/New Brunswick/00880/2010 (A/H0) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI435187A/mallard/New Brunswick/00879/2010 (A/H4N9) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI435172A/American black duck/New Brunswick/00878/2010 (A/H4N9) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI435165A/American black duck/New Brunswick/00876/2010 (A/H0) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI433683A/American black duck/New Brunswick/00955/2010 (A/H4N8) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI433677A/American black duck/New Brunswick/00949/2010 (A/H4N6) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI420196A/green-winged teal/California/96/2012 (A/H1N1) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI419477A/northern shoveler/Arkansas/11OS386/2011 (A/H9N2) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI419311A/northern shoveler/Illinois/10OS4360/2010 (A/H0) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI419211A/northern shoveler/Missouri/10OS4673/2010 (A/H14N6) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI419205A/mallard/Missouri/10OS4670/2010 (A/H9N2) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI419105A/American black duck/Wisconsin/10OS3949/2010 (A/H7N8) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI418960A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI414344A/mallard/Interior Alaska/9BM1814R1/2009 (A/H0) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI405295A/mallard-black duck hybrid/New Brunswick/02657/2007 (A/H3N8) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI405224A/American black duck/New Brunswick/02496/2007 (A/H3N8) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI405202A/American black duck/New Brunswick/02502/2007 (A/H3N8) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI405166A/American black duck/New Brunswick/02497/2007 (A/H3N8) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI405099A/American black duck/New Brunswick/02507/2007 (A/H3N8) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI404839A/American black duck/New Brunswick/02491/2007 (A/H3N8) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI404370A/American black duck/New Brunswick/02549/2007 (A/H3N8) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI328275A/mallard/California/6772/2008 (A/H4N6) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI300300A/northern pintail/Interior Alaska/8BM3284R1/2008 (A/H0N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI300293A/mallard/Interior Alaska/8BM2273/2008 (A/H0N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI300258A/northern pintail/Interior Alaska/8BM3359/2008 (A/H0N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI300229A/mallard/Interior Alaska/9BM2081/2009 (A/H0N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI300129A/northern pintail/Interior Alaska/8BM3739R1/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI300027A/mallard/Interior Alaska/8BM3327/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI300019A/northern pintail/Interior Alaska/8BM3177/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI299989A/northern pintail/Interior Alaska/8BM2454R1/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI299957A/northern pintail/Interior Alaska/8MP0209R1/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001452/1498 (96%)
text_code_colored.pngEPI299949A/mallard/Interior Alaska/8BM2841/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI299941A/mallard/Interior Alaska/8BM2714/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI299823A/mallard/Interior Alaska/9BM1327/2009 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI299737A/mallard/Interior Alaska/8BM3584R1/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI299705A/northern pintail/Interior Alaska/8BM3137/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI299697A/northern pintail/Interior Alaska/8BM3091/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI299689A/northern pintail/Interior Alaska/8BM2621R1/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI299133A/northern pintail/Interior Alaska/8BM3041/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI299125A/northern pintail/Interior Alaska/8BM2987/2008 (A/H8N4) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI296877A/mallard/Interior Alaska/7MP2230/2007 (A/H1N6) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI292545A/mallard/Washington/44338-018/2007 (A/H4N6) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI292505A/mallard/Washington/44338-012/2007 (A/H4N6) segment 5 (NP)2510.70.000000e+001451/1497 (96%)
text_code_colored.pngEPI286143A/mallard/NV/449567-4/2006 (A/H5N2) segment 5 (NP)2510.70.000000e+001452/1498 (96%)
text_code_colored.pngEPI286142A/mallard/NV/449567-2/2006 (A/H5N2) segment 5 (NP)2510.70.000000e+001452/1498 (96%)
text_code_colored.pngEPI286141A/mallard/NV/449567-1/2006 (A/H5N2) segment 5 (NP)2510.70.000000e+001452/1498 (96%)
text_code_colored.pngEPI280553A/mallard/Nevada/449567-3/2006 (A/H5N2) segment 5 (NP)2510.70.000000e+001452/1498 (96%)
text_code_colored.pngEPI280545A/mallard/Nevada/450206-4/2006 (A/H5N2) segment 5 (NP)2510.70.000000e+001452/1498 (96%)
text_code_colored.pngEPI442381A/brant/Alaska/44332-536/2007 (A/H11N9) segment 5 (NP)2508.90.000000e+001442/1484 (97%)
text_code_colored.pngEPI616860A/blue-winged teal/Louisiana/AI11-2911/2011 (A/H7N3) segment 5 (NP)2505.20.000000e+001450/1497 (96%)
text_code_colored.pngEPI595629A/mallard/Maryland/07OS89/2007 (A/H10N7) segment 5 (NP)2505.20.000000e+001451/1498 (96%)
text_code_colored.pngEPI594878A/environment/Maryland/05OS1177/2005 (A/H3N6) segment 5 (NP)2505.20.000000e+001450/1497 (96%)
text_code_colored.pngEPI526297A/American green-winged teal/Wisconsin/13OS3462/2013 (A/H3N8) segment 5 (NP)2505.20.000000e+001450/1497 (96%)
text_code_colored.pngEPI510509A/swan/BC/2045/2008 (A/H5N2) segment 5 (NP)2505.20.000000e+001450/1497 (96%)
text_code_colored.pngEPI449351A/mallard/Minnesota/SG-00929/2008 (A/H3N8) segment 5 (NP)2505.20.000000e+001451/1498 (96%)
text_code_colored.pngEPI419296A/mallard/Iowa/10OS2752/2010 (A/H11N9) segment 5 (NP)2505.20.000000e+001450/1497 (96%)
text_code_colored.pngEPI419250A/northern shoveler/Missouri/10OS4750/2010 (A/H7N3) segment 5 (NP)2505.20.000000e+001450/1497 (96%)
text_code_colored.pngEPI419191A/American green-winged teal/Missouri/10OS4622/2010 (A/H12N4) segment 5 (NP)2505.20.000000e+001450/1497 (96%)
text_code_colored.pngEPI414403A/northern pintail/Interior Alaska/10BM02539R0/2010 (A/H7N3) segment 5 (NP)2505.20.000000e+001450/1497 (96%)
text_code_colored.pngEPI413334A/mallard/Ohio/11OS2237/2011 (A/H0) segment 5 (NP)2505.20.000000e+001451/1498 (96%)
text_code_colored.pngEPI334385A/American green-winged teal/Illinois/2975/2009 (A/H0) segment 5 (NP)2505.20.000000e+001450/1497 (96%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI616385A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 8 (NS)1515.40.000000e+00832/838 (99%)
text_code_colored.pngEPI418930A/common goldeneye/Wisconsin/10OS4202/2010 (A/H7N6) segment 8 (NS)1504.30.000000e+00830/838 (99%)
text_code_colored.pngEPI513052A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 8 (NS)1493.20.000000e+00828/838 (98%)
text_code_colored.pngEPI512957A/greater scaup/Wisconsin/11OS5760/2011 (A/H10N2) segment 8 (NS)1493.20.000000e+00828/838 (98%)
text_code_colored.pngEPI512878A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 8 (NS)1493.20.000000e+00828/838 (98%)
text_code_colored.pngEPI420191A/bufflehead/California/3118/2011 (A/H4N8) segment 8 (NS)1493.20.000000e+00828/838 (98%)
text_code_colored.pngEPI512347A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 8 (NS)1487.70.000000e+00827/838 (98%)
text_code_colored.pngEPI454969A/bufflehead/North Carolina/NC6412-125/2005 (A/H4N8) segment 8 (NS)1402.70.000000e+00811/837 (96%)
text_code_colored.pngEPI87529A/mallard duck/ALB/25/1985 (A/H4N6) segment 8 (NS)1347.30.000000e+00803/839 (95%)
text_code_colored.pngEPI342913A/mallard/Alberta/254/2003 (A/H3N3) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI85990A/mallard duck/ALB/76/1985 (A/H6N3) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI468275A/blue winged teal/Louisiana/B228/1986 (A/H1N1) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI453660A/American green-winged teal/Interior Alaska/10BM08222R0/2010 (A/H3N8) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI453232A/northern pintail/Interior Alaska/9BM7972R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452866A/American green-winged teal/Interior Alaska/9BM8129R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452859A/northern pintail/Interior Alaska/9BM8119R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452760A/northern pintail/Interior Alaska/9BM11789R0/2009 (A/H3N8) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452040A/mallard/Interior Alaska/9BM7216R0/2009 (A/H8N4) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI448339A/blue-winged teal/Louisiana/42B/1987 (A/H2N3) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI345173A/mallard/Alberta/127/2000 (A/H0) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI333780A/mallard/Illinois/4179/2009 (A/H11N9) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI120383A/duck/NJ/7717-70/1995 (A/H1N1) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI88577A/mallard duck/ALB/763/1983 (A/H11N8) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI87180A/mallard/ALB/118/1995 (A/H3N5) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI59768A/mallard/Ohio/399/1987 (A/H11N9) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI486838A/mallard/California/3310/2012 (A/H2N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI486826A/mallard/California/3223/2012 (A/H2N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI486803A/mallard/California/3174/2012 (A/H2N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI486796A/mallard/California/3172/2012 (A/H2N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI486789A/mallard/California/3171/2012 (A/H2N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI486366A/mallard/California/2997/2012 (A/H2N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI486320A/mallard/California/2885/2012 (A/H2N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI486100A/mallard/California/3435/2012 (A/H2N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI486093A/mallard/California/3113/2012 (A/H3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI485048A/mallard/California/3078/2012 (A/H2N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI453324A/northern pintail/Interior Alaska/9BM6095R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI453317A/northern pintail/Interior Alaska/9BM6094R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI453310A/northern pintail/Interior Alaska/9BM6039R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI453239A/mallard/Interior Alaska/9BM10375R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI453211A/northern pintail/Interior Alaska/9BM6145R0/2009 (A/H3N8) segment 8 (NS)1325.20.000000e+00800/840 (95%)
text_code_colored.pngEPI453204A/northern pintail/Interior Alaska/9BM6040R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI453097A/mallard/Interior Alaska/9BM12523R0/2009 (A/H3N8) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452957A/northern pintail/Interior Alaska/9BM10835R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452943A/northern pintail/Interior Alaska/9BM10813R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452908A/mallard/Interior Alaska/9BM8829R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452901A/northern pintail/Interior Alaska/9BM8815R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452894A/northern pintail/Interior Alaska/9BM8803R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452880A/mallard/Interior Alaska/9BM8471R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00800/840 (95%)
text_code_colored.pngEPI452830A/northern pintail/Interior Alaska/9BM7632R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452823A/northern pintail/Interior Alaska/9BM7620R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452795A/northern pintail/Interior Alaska/9BM12066R1/2009 (A/H3N8) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452739A/northern pintail/Interior Alaska/9BM11572R0/2009 (A/H3N8) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452704A/mallard/Interior Alaska/9BM11015R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452683A/northern pintail/Interior Alaska/9BM10877R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452669A/mallard/Interior Alaska/9BM10095R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452627A/northern pintail/Interior Alaska/9BM7254R0/2009 (A/H3N8) segment 8 (NS)1325.20.000000e+00800/840 (95%)
text_code_colored.pngEPI452620A/northern pintail/Interior Alaska/9BM7252R0/2009 (A/H3N8) segment 8 (NS)1325.20.000000e+00800/840 (95%)
text_code_colored.pngEPI452578A/mallard/Interior Alaska/9BM6886R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452571A/northern pintail/Interior Alaska/9BM6494R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452536A/northern pintail/Interior Alaska/9BM6146R0/2009 (A/H3N8) segment 8 (NS)1325.20.000000e+00800/840 (95%)
text_code_colored.pngEPI452529A/northern pintail/Interior Alaska/9BM6144R0/2009 (A/H3N8) segment 8 (NS)1325.20.000000e+00800/840 (95%)
text_code_colored.pngEPI452284A/mallard/Interior Alaska/9BM8389R0/2009 (A/H8N4) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452026A/mallard/Interior Alaska/9BM7162R0/2009 (A/H8N4) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI451991A/northern pintail/Interior Alaska/9BM6226R0/2009 (A/H0) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI449996A/blue-winged teal/Louisiana/AI09-5159/2009 (A/H3N8) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI449975A/American green-winged teal/Texas/AI09-4396/2009 (A/H3N9) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI442305A/American green-winged teal/Alaska/44419-241/2008 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI437609A/pintail/Alberta/140/1996 (A/H1N1) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI437079A/mallard/Interior Alaska/9BM8470R0/2009 (A/H0) segment 8 (NS)1325.20.000000e+00800/840 (95%)
text_code_colored.pngEPI437016A/northern pintail/Interior Alaska/9BM9419R0/2009 (A/H0) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI436916A/northern pintail/Interior Alaska/9BM11661R0/2009 (A/H0) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI432991A/northern pintail/Interior Alaska/9BM4660R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI432977A/northern pintail/Interior Alaska/9BM4641R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI432963A/northern pintail/Interior Alaska/9BM4583R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI432916A/northern pintail/Interior Alaska/9BM4347R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI432843A/mallard/Interior Alaska/9BM8468R0/2009 (A/H0) segment 8 (NS)1325.20.000000e+00800/840 (95%)
text_code_colored.pngEPI432820A/mallard/Interior Alaska/9BM8469R0/2009 (A/H0) segment 8 (NS)1325.20.000000e+00800/840 (95%)
text_code_colored.pngEPI401891A/knot/Delaware Bay/526/1988 (A/H6N8) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI370946A/mallard/Alberta/529/1980 (A/H2N3) segment 8 (NS)1325.20.000000e+00800/840 (95%)
text_code_colored.pngEPI344318A/mallard/Alberta/85/1994 (A/H3N8) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI343715A/pintail/Alberta/166/2003 (A/H3N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI158627A/mallard/MN/259/1999 (A/H3N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI86234A/pintail/Alberta/166/2003 (A/H3N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI85718A/knot/DE/526/1988 (A/H6N8) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI34151A/wigeon/Ohio/379/1988 (A/H5N2) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI22415A/pintail/Alberta/156/97 (A/H3N8) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI616925A/ruddy turnstone/New Jersey/65/1985 (A/H7N3) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI614523A/American green-winged teal/Wisconsin/12OS2994/2012 (A/H1N1) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI486910A/mallard/California/3418/2012 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI486782A/mallard/California/3167/2012 (A/H2N3) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI486732A/mallard/California/3148/2012 (A/H2N3) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI453153A/northern pintail/Interior Alaska/9BM9989R0/2009 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI453104A/northern pintail/Interior Alaska/9BM9447R0/2009 (A/H3N8) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI453090A/northern shoveler/Interior Alaska/9BM12519R0/2009 (A/H4N8) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI452816A/northern pintail/Interior Alaska/9BM7496R0/2009 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI452781A/northern pintail/Interior Alaska/9BM11915R0/2009 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI452613A/northern pintail/Interior Alaska/9BM7232R0/2009 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI452550A/American green-winged teal/Interior Alaska/9BM6258R0/2009 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI452494A/mallard/Interior Alaska/9BM10370R0/2009 (A/H10N7) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI452487A/mallard/Interior Alaska/9BM10369R0/2009 (A/H10N7) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI452277A/mallard/Interior Alaska/9BM8287R0/2009 (A/H10N7) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI452061A/mallard/Interior Alaska/9BM10043R0/2009 (A/H10N7) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI451998A/American green-winged teal/Interior Alaska/9BM6428R0/2009 (A/H10N7) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI451974A/northern pintail/Interior Alaska/9BM6205R0/2009 (A/H10N7) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI450019A/blue-winged teal/Louisiana/AI09-5291/2009 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI449290A/blue-winged teal/North Dakota/Sg-00750/2008 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI448327A/blue-winged teal/Louisiana/3B/1986 (A/H4N8) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI442312A/American green-winged teal/Alaska/44419-256/2008 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI437319A/blue-winged teal/Alberta/69/1987 (A/H1N1) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI436861A/mallard/Interior Alaska/9BM6888R0/2009 (A/H10N7) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI433955A/blue-winged teal/New Brunswick/00288/2010 (A/H5N2) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI433095A/American green-winged teal/Interior Alaska/9BM5041R0/2009 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI433074A/northern shoveler/Interior Alaska/9BM4905R0/2009 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI404214A/shorebird/Delaware Bay/196/1999 (A/H0) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI402947A/shorebird/Delaware Bay/288/1999 (A/H0) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI402880A/shorebird/Delaware Bay/181/1999 (A/H11N2) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI401853A/shorebird/Delaware Bay/173/1999 (A/H0) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI370938A/mallard/Alberta/501/1980 (A/H2N3) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI370538A/guinea fowl/New Jersey/30701/1991 (A/H2N2) segment 8 (NS)1319.60.000000e+00797/838 (95%)
text_code_colored.pngEPI370514A/guinea fowl/New Jersey/26146/1990 (A/H2N2) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI370506A/avian/Massachusetts/25756/1990 (A/H2N2) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI345305A/mallard/Alberta/107/1991 (A/H0) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI345035A/blue-winged teal/Alberta/130/1987 (A/H3N8) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI344734A/mallard/Alberta/109/1991 (A/H3N8) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI344718A/pintail/Alberta/118/1991 (A/H3N8) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI344254A/pintail/Alberta/275/1996 (A/H4N6) segment 8 (NS)1319.60.000000e+00797/838 (95%)
text_code_colored.pngEPI344142A/mallard/Alberta/167/1998 (A/H3N8) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI344134A/mallard/Alberta/169/1998 (A/H3N8) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI343993A/shorebird/Delaware Bay/204/1999 (A/H0) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI343867A/shorebird/Delaware Bay/287/1999 (A/H6N2) segment 8 (NS)1319.60.000000e+00799/840 (95%)
text_code_colored.pngEPI343125A/mallard/Alberta/284/2007 (A/H0) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI334288A/blue-winged teal/Wisconsin/2753/2009 (A/H4N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI328816A/Stellers eider/Alaska/44354-376/2007 (A/H3N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI328815A/Stellers eider/Alaska/44354-356/2007 (A/H3N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI328814A/Stellers eider/Alaska/44354-355/2007 (A/H3N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI328813A/Stellers eider/Alaska/44354-353/2007 (A/H3N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI328812A/Stellers eider/Alaska/44354-352/2007 (A/H3N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI328811A/Stellers eider/Alaska/44354-138/2007 (A/H3N6) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI327384A/snow goose/Quebec/17416/2006 (A/H9N2) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI280738A/snow goose/Montana/466771-4/2006 (A/H5N2) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI162365A/turkey/TX/10-49-89/1989 (A/H9N2) segment 8 (NS)1319.60.000000e+00796/837 (95%)
text_code_colored.pngEPI158903A/turkey/SD/7034/1986 (A/H1N1) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI87728A/pintail/ALB/275/1996 (A/H4N6) segment 8 (NS)1319.60.000000e+00797/838 (95%)
text_code_colored.pngEPI87514A/mallard duck/ALB/630/1984 (A/H4N2) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI86485A/ruddy turnstone/NJ/65/1985 (A/H7N3) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI85214A/mallard duck/ALB/376/1985 (A/H2N3) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI59407A/mallard/Ohio/115/1989 (A/H6N8) segment 8 (NS)1319.60.000000e+00798/839 (95%)
text_code_colored.pngEPI227245A/mallard/Alberta/11527/2005 (A/H3N8) segment 8 (NS)1315.90.000000e+00797/839 (94%)
text_code_colored.pngEPI616976A/mallard/Alberta/243/2006 (A/H7N3) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI594915A/American green-winged teal/Maryland/06MD700/2006 (A/H6N8) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI453338A/mallard/Interior Alaska/9BM9984R0/2009 (A/H4N6) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI453146A/mallard/Interior Alaska/9BM9985R0/2009 (A/H4N6) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI453139A/mallard/Interior Alaska/9BM9983R0/2009 (A/H4N6) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI450083A/red-necked grebe/Minnesota/AI10-2530/2010 (A/H0) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI450074A/red-necked grebe/Minnesota/AI10-2529/2010 (A/H0) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI448419A/mallard/Minnesota/355785/2000 (A/H11N2) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI448356A/mallard/Minnesota/182722/1998 (A/H11N9) segment 8 (NS)1314.10.000000e+00798/840 (95%)
text_code_colored.pngEPI437706A/pintail/Alberta/207/2000 (A/H1N1) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI437158A/mallard/Alberta/110/1990 (A/H0) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI437030A/northern pintail/Interior Alaska/9BM9663R0/2009 (A/H4N6) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI420219A/northern shoveler/California/138/2012 (A/H1N1) segment 8 (NS)1314.10.000000e+00798/840 (95%)
text_code_colored.pngEPI419304A/gadwall/Iowa/10OS2753/2010 (A/H3N8) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI418682A/American green-winged teal/Illinois/10OS1551/2010 (A/H4N6) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI405296A/mallard-black duck hybrid/New Brunswick/02657/2007 (A/H3N8) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI405100A/American black duck/New Brunswick/02507/2007 (A/H3N8) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI404840A/American black duck/New Brunswick/02491/2007 (A/H3N8) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI404371A/American black duck/New Brunswick/02549/2007 (A/H3N8) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI404347A/American black duck/New Brunswick/02658/2007 (A/H0) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI404312A/American black duck/New Brunswick/02566/2007 (A/H0) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI402904A/shorebird/Delaware Bay/191/1999 (A/H11N2) segment 8 (NS)1314.10.000000e+00798/840 (95%)
text_code_colored.pngEPI402764A/mallard/Alberta/279/1996 (A/H11N9) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI402321A/mallard/Alberta/126/1991 (A/H11N9) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI402314A/mallard/Alberta/122/1991 (A/H11N9) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI370498A/chicken/Connecticut/13657/1990 (A/H2N2) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI345027A/mallard/Alberta/140/1987 (A/H3N8) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI345017A/mallard/Alberta/144/1987 (A/H0) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI343365A/mallard/Alberta/243/2006 (A/H7N3) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI328026A/American wigeon/California/8352/2008 (A/H12N5) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI298630A/mallard/Interior Alaska/6MP0050R1/2006 (A/H3N8) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI280626A/waterfowl/Colorado/476466-2/2007 (A/H5N2) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI238966A/mallard/Minnesota/66/1998 (A/H6N5) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI238943A/mallard/Minnesota/34/1998 (A/H2N9) segment 8 (NS)1314.10.000000e+00798/840 (95%)
text_code_colored.pngEPI177227A/mallard/Alberta/243/2006 (A/H7N3) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI88682A/mallard/ALB/126/1991 (A/H11N9) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI88667A/mallard/ALB/124/1991 (A/H11N2) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI87745A/mallard/ALB/47/1998 (A/H4N1) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI86670A/pintail duck/ALB/238/1979 (A/H1N1) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI81154A/mallard/MN/403/99 (A/H11N9) segment 8 (NS)1314.10.000000e+00798/840 (95%)
text_code_colored.pngEPI60975A/black duck/Ohio/161/1999 (A/H11N9) segment 8 (NS)1314.10.000000e+00798/840 (95%)
text_code_colored.pngEPI59312A/northern shoveler/Ohio/35/1986 (A/H3N8) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI55227A/pintail/Ohio/339/1987 (A/H3N8) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI47817A/bufflehead/Ohio/246/1986 (A/H11N2) segment 8 (NS)1314.10.000000e+00797/839 (94%)
text_code_colored.pngEPI616292A/blue-winged teal/Ohio/12OS4593/2012 (A/H4N6) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI512960A/mallard/Illinois/11OS5576/2011 (A/H5N3) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI512305A/northern pintail/Illinois/11OS4796/2011 (A/H5N3) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI468363A/mallard/Alberta/267/1996 (A/H1N1) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI453183A/mallard/Interior Alaska/9BM12694R1/2009 (A/H0) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI452844A/northern pintail/Interior Alaska/9BM7934R0/2009 (A/H4N6) segment 8 (NS)1308.50.000000e+00797/840 (94%)
text_code_colored.pngEPI451508A/mallard/Interior Alaska/9BM10563R2/2009 (A/H4N6) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI442287A/emperor goose/Alaska/44063-061/2006 (A/H7N9) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI439808A/white-fronted goose/Korea/20-36/2007 (A/H9N2) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI437565A/mallard/Alberta/267/1996 (A/H0) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI433969A/blue-winged teal/New Brunswick/00291/2010 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI433962A/blue-winged teal/New Brunswick/00289/2010 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI433948A/blue-winged teal/New Brunswick/00285/2010 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI433941A/blue-winged teal/New Brunswick/00283/2010 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI420560A/American black duck/St. John's/GR256/2011 (A/H3N2) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI419127A/mallard/Mississippi/10OS4494/2010 (A/H1N1) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI418912A/bufflehead/Wisconsin/10OS3204/2010 (A/H12N5) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI418746A/wood duck/Wisconsin/10OS2778/2010 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI418738A/mallard/Wisconsin/10OS2773/2010 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI405225A/American black duck/New Brunswick/02496/2007 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI405203A/American black duck/New Brunswick/02502/2007 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI405167A/American black duck/New Brunswick/02497/2007 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI402457A/mallard/Alberta/19/1994 (A/H6N8) segment 8 (NS)1308.50.000000e+00797/840 (94%)
text_code_colored.pngEPI387221A/American wigeon/California/3180/2010 (A/H5N2) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI344878A/mallard/Alberta/20/1989 (A/H3N8) segment 8 (NS)1308.50.000000e+00797/840 (94%)
text_code_colored.pngEPI344798A/mallard/Alberta/32/1991 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI344790A/mallard/Alberta/54/1991 (A/H3N8) segment 8 (NS)1308.50.000000e+00795/838 (94%)
text_code_colored.pngEPI344782A/mallard/Alberta/60/1991 (A/H3N8) segment 8 (NS)1308.50.000000e+00795/838 (94%)
text_code_colored.pngEPI344691A/mallard/Alberta/196/1992 (A/H0) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI343691A/mallard/Alberta/192/2004 (A/H3N1) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI343675A/mallard/Alberta/241/2004 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI343357A/mallard/Alberta/246/2006 (A/H4N6) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI343349A/mallard/Alberta/254/2006 (A/H4N6) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI343329A/mallard/Alberta/258/2006 (A/H4N6) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI343305A/mallard/Alberta/297/2006 (A/H4N6) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI334355A/American green-winged teal/Illinois/3443/2009 (A/H0) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI334281A/American black duck/Illinois/3854/2009 (A/H11N9) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI333748A/mallard/Missouri/132/2009 (A/H2N3) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI332561A/mallard/British Columbia/07594/2005 (A/H5N2) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI327410A/northern pintail/British Columbia/07813/2005 (A/H5N2) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI299070A/northern shoveler/Interior Alaska/7MP1800/2007 (A/H0) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI286007A/duck/Oregon/459674-3/2006 (A/H5N2) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI280866A/Guinea fowl/Oregon/459674-5/2006 (A/H5N2) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI238559A/mallard/Minnesota/271/1999 (A/H4N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI227384A/northern pintail/British Columbia/07847/2005 (A/H5N2) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI227269A/mallard/British Columbia/07826/2005 (A/H5N2) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI169629A/mallard/MN/327/1999 (A/H4N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI159078A/turkey/TX/1-40-82/1982 (A/H5N2) segment 8 (NS)1308.50.000000e+00797/840 (94%)
text_code_colored.pngEPI131175A/mallard/Wisconsin/428/1975 (A/H5N1) segment 8 (NS)1308.50.000000e+00797/840 (94%)
text_code_colored.pngEPI107158A/mallard/BC/373/2005 (A/H5N2) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI87283A/redhead duck/ALB/74/1977 (A/H4N6) segment 8 (NS)1308.50.000000e+00797/840 (94%)
text_code_colored.pngEPI87091A/mallard duck/Alberta/438/1985 (A/H3N4) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI81180A/mallard/MN/218/99 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI81176A/mallard/MN/190/99 (A/H3N8) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI81130A/green-winged teal/OH/196/99 (A/H6N2) segment 8 (NS)1308.50.000000e+00797/840 (94%)
text_code_colored.pngEPI48292A/mallard/Ohio/265/1987 (A/H1N9) segment 8 (NS)1308.50.000000e+00796/839 (94%)
text_code_colored.pngEPI4738A/Chicken/New York/19542-5/95 (A/H7N2) segment 8 (NS)1308.50.000000e+00795/838 (94%)
text_code_colored.pngEPI4729A/Turkey/New York/4450-5/94 (A/H7N2) segment 8 (NS)1308.50.000000e+00795/838 (94%)

Share this post


Link to post
Share on other sites
LOCUS       KU558906                1705 bp    cRNA    linear   VRL 10-FEB-2016
DEFINITION  Influenza A virus (A/turkey/Indiana/16-001403-1/2016(H7N8)) segment
            4 hemagglutinin (HA) gene, complete cds.
ACCESSION   KU558906
VERSION     KU558906.1  GI:985701747
KEYWORDS    .
SOURCE      Influenza A virus (A/turkey/Indiana/16-001403-1/2016(H7N8))
  ORGANISM  Influenza A virus (A/turkey/Indiana/16-001403-1/2016(H7N8))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1705)
  AUTHORS   Killian,M.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2016) Diagnostic Virology Laboratory, National
            Veterinary Services Laboratories (NVSL), USDA APHIS VS, 1920 Dayton
            Avenue, Ames, IA 50010, USA
COMMENT     GenBank Accession Numbers KU558903-KU558910 represent sequences
            from the 8 segments of Influenza A virus
            (A/turkey/Indiana/16-001403-1/2016(H7N8)).
            
            ##Assembly-Data-START##
            Assembly Method       :: SeqMan NGen v. v4
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1705
                     /organism="Influenza A virus
                     (A/turkey/Indiana/16-001403-1/2016(H7N8))"
                     /mol_type="viral cRNA"
                     /strain="A/turkey/Indiana/16-001403-1/2016"
                     /serotype="H7N8"
                     /isolation_source="OP swab; pooled sample"
                     /host="turkey; commercial; 19 week old tom"
                     /db_xref="taxon:1783443"
                     /segment="4"
                     /country="USA: Dubois County, Indiana"
                     /collection_date="14-Jan-2016"
                     /note="NVSL 16-001403-1; EP1; HPAI"
     gene            7..1698
                     /gene="HA"
     CDS             7..1698
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="AMD38700.1"
                     /db_xref="GI:985701748"
                     /translation="MNTQILALIACMLIGAKGDKICLGHHAVANGTKVNTLTERGIEV
                     VNATETVETANIKKICTQGKRPTDLGQCGLLGTLIGPPQCDQFLEFDADLIIERREGT
                     DVCYPGKFTNKESLRQILRGSGGIDKESMGFTYSGIRTNGATSACRRSGSSFYAEMKW
                     LLSNSDNAAFPQMTKSYRNPRSKPALIIWGVHHSGSVTEQTKLYGSGNKLITVGSSKY
                     QQSFTPSPGARPQVNGQSGRIDFHWLLLDPNDTVTFTFNGAFIAPDRASFLRGESLGV
                     QSDVPLDSSCKGDCFHNGGTIVSSLPFQNINPRTVGKCPRYVKQTSLLLATGMRNVPE
                     NPKKRKTRGLFGAIAGFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITG
                     KLNRLIDKTNQQFELIDNEFSEIEQQIGNVINWTRDSMTEVWSYNAELLVAMENQHTI
                     DLADSEMNKLYERVRKQLRENAEEDGTGCFEIFHKCDDQCMESIRNNTYDHTQYRAES
                     LQNRIQIDPVKLSSGYKDIILWFSFGASCFLLLAIAMGLVFICIKNGNMRCTICI"
     sig_peptide     7..60
                     /gene="HA"
     mat_peptide     61..1032
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1033..1695
                     /gene="HA"
                     /product="HA2"
ORIGIN      
        1 tacaaaatga acactcaaat tttggcactc attgcttgta tgctgatcgg agctaaagga
       61 gacaaaatat gtcttgggca ccatgctgtg gcaaatggaa caaaagtgaa cacactaaca
      121 gagagaggaa tcgaagtggt aaatgccaca gaaacggtgg agactgcaaa tattaagaaa
      181 atatgcactc aggggaaaag accaacagat ctgggacaat gcggacttct aggaacccta
      241 ataggacctc cccaatgcga tcaattcctg gagtttgacg ctgatttaat aattgaacgg
      301 agagaaggaa cggatgtgtg ttatcctggg aagttcacaa ataaagaatc actgaggcag
      361 atcctccgag ggtcaggagg aattgataag gaatcaatgg gtttcactta tagtggaata
      421 agaaccaatg gggcaacgag tgcttgcaga agatcaggtt cttccttcta tgcggagatg
      481 aagtggttat tgtcgaattc agacaatgcg gcttttcccc aaatgactaa gtcgtacaga
      541 aatcccagga gcaaaccagc tctaataatt tggggagtgc atcactctgg atcggttact
      601 gaacagacca aactctatgg gagtggaaac aagttgataa cagtaggaag ctcgaaatac
      661 cagcagtcat tcaccccaag cccgggggca cgaccacagg tgaatgggca atcaggaagg
      721 attgattttc attggctact ccttgacccc aacgacacag tgactttcac tttcaatggg
      781 gcattcatag ctcctgacag agcaagtttc cttagagggg agtcactagg agttcaaagt
      841 gacgttcctt tggattctag ttgcaagggg gattgcttcc acaatggagg tacgatagtg
      901 agctcactgc cattccagaa catcaaccct agaacagtgg gaaaatgccc tcgatatgtc
      961 aaacagacaa gcctcctctt ggctacaggg atgaggaacg tcccagagaa ccccaaaaaa
     1021 agaaagacca gaggtctttt tggagcgatt gctggattca tagagaatgg gtgggaaggc
     1081 ctcattgatg gatggtacgg tttcaggcat caaaatgcac aaggagaagg tactgcagct
     1141 gattacaaaa gcactcaatc tgcaatagat cagatcacag gcaaattgaa tcgtctaatt
     1201 gacaaaacaa atcagcagtt tgaactgata gacaacgaat tcagtgaaat agaacaacag
     1261 attgggaatg tcattaattg gacacgagat tcaatgactg aagtatggtc gtataatgct
     1321 gaactgctgg tagctatgga aaatcagcac acaatagatc ttgcagactc agaaatgaac
     1381 aaactttacg agcgtgtaag gaaacaactg agggagaatg ctgaagagga tgggactgga
     1441 tgctttgaga tattccataa gtgtgatgat caatgcatgg agagcataag gaacaacacc
     1501 tacgaccata cccaatacag agcagagtca ttgcagaata gaatacagat agacccagtg
     1561 aaactgagta gtggatacaa agacataatc ttatggttta gcttcggggc atcatgtttt
     1621 cttcttctag ccattgcaat gggattggtc ttcatttgca taaagaatgg aaacatgcgg
     1681 tgcactattt gtatatagtt tgaga

Share this post


Link to post
Share on other sites
LOCUS       KU585908                1696 bp    cRNA    linear   VRL 10-FEB-2016
DEFINITION  Influenza A virus (A/turkey/Indiana/16-001573-2/2016(H7N8)) segment
            4 hemagglutinin (HA) gene, complete cds.
ACCESSION   KU585908
VERSION     KU585908.1  GI:985701787
KEYWORDS    .
SOURCE      Influenza A virus (A/turkey/Indiana/16-001573-2/2016(H7N8))
  ORGANISM  Influenza A virus (A/turkey/Indiana/16-001573-2/2016(H7N8))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1696)
  AUTHORS   Killian,M.L., Hines,N.L. and Torchetti,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2016) Diagnostic Virology Laboratory, National
            Veterinary Services Laboratories (NVSL), USDA APHIS VS, 1920 Dayton
            Avenue, Ames, IA 50010, USA
COMMENT     GenBank Accession Numbers KU585905-KU585912 represent sequences
            from the 8 segments of Influenza A virus
            (A/turkey/Indiana/16-001573-2/2016(H7N8)).
            
            ##Assembly-Data-START##
            Assembly Method       :: SeqMan NGen v. v4
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1696
                     /organism="Influenza A virus
                     (A/turkey/Indiana/16-001573-2/2016(H7N8))"
                     /mol_type="viral cRNA"
                     /strain="A/turkey/Indiana/16-001573-2/2016"
                     /serotype="H7N8"
                     /isolation_source="OP swab; pooled sample"
                     /host="turkey; commercial"
                     /db_xref="taxon:1785958"
                     /segment="4"
                     /country="USA: Daviess County, Indiana"
                     /collection_date="15-Jan-2016"
                     /note="NVSL 16-001573-2; EP1; LPAI"
     gene            7..1689
                     /gene="HA"
     CDS             7..1689
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="AMD38724.1"
                     /db_xref="GI:985701788"
                     /translation="MNTQILALIACMLIGAKGDKICLGHHAVANGTKVNTLTERGIEV
                     VNATETVETANIKKICTQGKRPTDLGQCGLLGTLIGPPQCDQFLEFDADLIIERREGT
                     DVCYPGKFTNKESLRQILRGSGGIDKESMGFTYSGIRTNGATSACRRSGSSFYAEMKW
                     LLSNSDNAAFPQMTKSYRNPRSKPALIIWGVHHSGSVTEQTKLYGSGNKLITVGSSKY
                     QQSFTPSPGARPQVNGQSGRIDFHWLLLDPNDTVTFTFNGAFIAPDRASFLRGESLGV
                     QSDVPLDSSCKGDCFHNGGTIVSSLPFQNINPRTVGKCPRYVKQTSLLLATGMRNVPE
                     NPKTRGLFGAIAGFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLN
                     RLIDKTNQQFELIDNEFSEIEQQIGNVINWTRDSMTEVWSYNAELLVAMENQHTIDLA
                     DSEMNKLYERVRKQMRENAEEDGTGCFEIFHKCDDQCMESIRNNTYDHTQYRAESLQK
                     RIQIDPVKLSSGYKDIILWFSFGASCFLLLAIAMGLVFICIKNGNMRCTICI"
     sig_peptide     7..60
                     /gene="HA"
     mat_peptide     61..1023
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1024..1686
                     /gene="HA"
                     /product="HA2"
ORIGIN      
        1 tacaaaatga acactcaaat tttggcactc attgcttgta tgctgatcgg agctaaagga
       61 gacaaaatat gtcttgggca ccatgctgtg gcaaatggaa caaaagtgaa cacactaaca
      121 gagagaggaa tcgaagtagt aaatgccaca gaaacggtgg agactgcaaa tattaagaaa
      181 atatgcactc aggggaaaag accaacagat ctgggacaat gcggacttct aggaacccta
      241 ataggacctc cccaatgcga tcaattcctg gagtttgacg ctgatttaat aattgaacgg
      301 agagaaggaa cggatgtgtg ttatcctggg aagttcacaa ataaagaatc actgaggcag
      361 atcctccgag ggtcaggagg aattgataag gaatcaatgg gtttcactta tagtggaata
      421 agaaccaatg gggcaacgag tgcttgcaga agatcaggtt cttccttcta tgcggagatg
      481 aagtggttat tgtcgaattc agacaatgcg gcttttcccc aaatgactaa gtcgtacaga
      541 aatcccagga gcaaaccagc tctaataatt tggggagtgc atcactctgg atcggttact
      601 gaacagacca aactctatgg gagtggaaac aagttgataa cagtaggaag ctcgaaatac
      661 cagcagtcat tcaccccaag cccgggggca cgaccacagg tgaatgggca atcaggaagg
      721 attgattttc attggctact ccttgacccc aacgacacag tgactttcac tttcaatggg
      781 gcattcatag ctcctgacag agcaagtttc cttagagggg agtcactagg agttcaaagt
      841 gacgttcctt tggattctag ttgcaagggg gattgcttcc acaatggagg tacgatagtg
      901 agctcactgc cattccagaa catcaaccct agaacagtgg gaaaatgccc tcgatatgtc
      961 aaacagacaa gcctcctctt ggctacaggg atgaggaacg tcccagagaa ccccaagacc
     1021 agaggtcttt ttggagcgat tgctggattc atagagaatg ggtgggaagg cctcattgat
     1081 ggatggtacg gtttcaggca tcaaaatgca caaggagaag gtactgcagc tgattacaaa
     1141 agcactcaat ctgcaataga tcagatcaca ggcaaattga atcgtctaat tgacaaaaca
     1201 aatcagcagt ttgaactgat agacaacgaa ttcagtgaaa tagaacaaca gattgggaat
     1261 gtcattaatt ggacacgaga ttcaatgact gaagtatggt cgtataatgc tgaactgctg
     1321 gtagctatgg aaaatcagca cacaatagat cttgcagact cagaaatgaa caaactttac
     1381 gagcgtgtaa ggaaacaaat gagggagaat gctgaagagg atgggactgg atgctttgag
     1441 atattccata agtgtgatga tcaatgcatg gagagcataa ggaacaacac ctacgaccat
     1501 acccaataca gagcagagtc attgcagaag agaatacaga tagacccagt gaaactgagt
     1561 agtggataca aagacataat cttatggttt agcttcgggg catcatgttt tcttcttcta
     1621 gccattgcaa tgggattggt cttcatttgc ataaagaatg gaaacatgcg gtgcactatt
     1681 tgtatatagt ttgaga

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI645556A/blue-winged teal/Iowa/13OS2316/2013 (A/H7N3) segment 4 (HA)2937.30.000000e+001652/1683 (98%)
text_code_colored.pngEPI594839A/mallard/Maryland/13OS3019/2014 (A/H0) segment 4 (HA)2909.60.000000e+001647/1683 (97%)
text_code_colored.pngEPI526172A/blue-winged teal/Ohio/13OS2037/2013 (A/H7N1) segment 4 (HA)2904.10.000000e+001646/1683 (97%)
text_code_colored.pngEPI419496A/American green-winged teal/Mississippi/11OS247/2011 (A/H0) segment 4 (HA)2821.00.000000e+001631/1683 (96%)
text_code_colored.pngEPI413380A/mallard/Missouri/10MO0551/2010 (A/H7N7) segment 4 (HA)2798.80.000000e+001627/1683 (96%)
text_code_colored.pngEPI689616A/blue winged teal/Minnesota/A00137660/2009 (A/H7N3) segment 4 (HA)2793.30.000000e+001626/1683 (96%)
text_code_colored.pngEPI419540A/American green-winged teal/Mississippi/11OS259/2011 (A/H0) segment 4 (HA)2793.30.000000e+001626/1683 (96%)
text_code_colored.pngEPI419497A/American green-winged teal/Mississippi/11OS250/2011 (A/H7N3) segment 4 (HA)2793.30.000000e+001626/1683 (96%)
text_code_colored.pngEPI419085A/American black duck/Wisconsin/10OS3949/2010 (A/H7N8) segment 4 (HA)2793.30.000000e+001626/1683 (96%)
text_code_colored.pngEPI418762A/American green-winged teal/Illinois/10OS3368/2010 (A/H7N7) segment 4 (HA)2793.30.000000e+001626/1683 (96%)
text_code_colored.pngEPI418759A/American green-winged teal/Illinois/10OS3329/2010 (A/H7N7) segment 4 (HA)2793.30.000000e+001626/1683 (96%)
text_code_colored.pngEPI616891A/mallard/Alberta/590/2010 (A/H7N8) segment 4 (HA)2787.70.000000e+001625/1683 (96%)
text_code_colored.pngEPI418597A/northern shoveler/Arkansas/11OS333/2011 (A/H0) segment 4 (HA)2787.70.000000e+001625/1683 (96%)
text_code_colored.pngEPI419446A/northern shoverl/Mississippi/11OS145/2011 (A/H7N9) segment 4 (HA)2782.20.000000e+001624/1683 (96%)
text_code_colored.pngEPI419234A/northern shoveler/Missouri/10OS4750/2010 (A/H7N3) segment 4 (HA)2782.20.000000e+001624/1683 (96%)
text_code_colored.pngEPI419498A/American green-winged teal/Mississippi/11OS255/2011 (A/H7N7) segment 4 (HA)2776.60.000000e+001623/1683 (96%)
text_code_colored.pngEPI418570A/northern shoveler/Arkansas/11OS171/2011 (A/H0) segment 4 (HA)2776.60.000000e+001623/1683 (96%)
text_code_colored.pngEPI419184A/northern shoveler/Missouri/10OS4700/2010 (A/H0) segment 4 (HA)2771.10.000000e+001622/1683 (96%)
text_code_colored.pngEPI419181A/northern shoveler/Missouri/10OS4632/2010 (A/H7N7) segment 4 (HA)2771.10.000000e+001622/1683 (96%)
text_code_colored.pngEPI616787A/blue-winged teal/Texas/AI12-909/2012 (A/H7N1) segment 4 (HA)2765.60.000000e+001621/1683 (96%)
text_code_colored.pngEPI419703A/American wigeon/Missouri/10MO0530/2010 (A/H0) segment 4 (HA)2765.60.000000e+001621/1683 (96%)
text_code_colored.pngEPI419542A/northern shoveler/Mississippi/11OS202/2011 (A/H7N7) segment 4 (HA)2765.60.000000e+001622/1684 (96%)
text_code_colored.pngEPI419233A/gadwall/Missouri/10OS4731/2010 (A/H7N3) segment 4 (HA)2765.60.000000e+001621/1683 (96%)
text_code_colored.pngEPI689523A/American green winged teal/Mississippi/A00630203/2009 (A/H7N6) segment 4 (HA)2760.00.000000e+001620/1683 (96%)
text_code_colored.pngEPI419543A/northern shoveler/Mississippi/11OS289/2011 (A/H7N3) segment 4 (HA)2760.00.000000e+001620/1683 (96%)
text_code_colored.pngEPI299451A/northern shoveler/Mississippi/09OS643/2009 (A/H7N7) segment 4 (HA)2760.00.000000e+001620/1683 (96%)
text_code_colored.pngEPI690006A/northern shoveler/Mississippi/A00602284/2009 (A/H0) segment 4 (HA)2754.50.000000e+001619/1683 (96%)
text_code_colored.pngEPI690005A/northern shoveler/Louisiana/A00557321/2009 (A/H7N3) segment 4 (HA)2754.50.000000e+001619/1683 (96%)
text_code_colored.pngEPI689614A/blue winged teal/Louisiana/A00557206/2009 (A/H7N7) segment 4 (HA)2754.50.000000e+001619/1683 (96%)
text_code_colored.pngEPI512246A/northern shoveler/Mississippi/12OS231/2012 (A/H0) segment 4 (HA)2754.50.000000e+001619/1683 (96%)
text_code_colored.pngEPI487352A/guinea fowl/Nebraska/17096/2011 (A/H7N9) segment 4 (HA)2754.50.000000e+001620/1684 (96%)
text_code_colored.pngEPI487328A/goose/Nebraska/17097/2011 (A/H7N9) segment 4 (HA)2754.50.000000e+001620/1684 (96%)
text_code_colored.pngEPI399915A/goose/Nebraska/17097-4/2011 (A/H7N9) segment 4 (HA)2754.50.000000e+001620/1684 (96%)
text_code_colored.pngEPI299347A/American green-winged teal/Mississippi/09OS046/2009 (A/H7N7) segment 4 (HA)2754.50.000000e+001619/1683 (96%)
text_code_colored.pngEPI690008A/northern shoveler/Mississippi/A00682947/2008 (A/H7N7) segment 4 (HA)2748.90.000000e+001618/1683 (96%)
text_code_colored.pngEPI689690A/bufflehead/Virginia/A00120022/2008 (A/H7N2) segment 4 (HA)2748.90.000000e+001618/1683 (96%)
text_code_colored.pngEPI399917A/guinea fowl/Nebraska/17096-1/2011 (A/H7N9) segment 4 (HA)2748.90.000000e+001619/1684 (96%)
text_code_colored.pngEPI689774A/mallard/New Jersey/A00122457/2008 (A/H7N8) segment 4 (HA)2743.40.000000e+001617/1683 (96%)
text_code_colored.pngEPI616857A/blue-winged teal/Louisiana/AI11-2911/2011 (A/H7N3) segment 4 (HA)2743.40.000000e+001617/1683 (96%)
text_code_colored.pngEPI616845A/blue-winged teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 4 (HA)2743.40.000000e+001617/1683 (96%)
text_code_colored.pngEPI512215A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 4 (HA)2743.40.000000e+001617/1683 (96%)
text_code_colored.pngEPI512201A/American green-winged teal/Mississippi/12OS397/2012 (A/H7N7) segment 4 (HA)2743.40.000000e+001617/1683 (96%)
text_code_colored.pngEPI449900A/blue-winged Teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 4 (HA)2743.40.000000e+001617/1683 (96%)
text_code_colored.pngEPI418798A/American green-winged teal/Illinois/10OS4014/2010 (A/H7N3) segment 4 (HA)2743.40.000000e+001617/1683 (96%)
text_code_colored.pngEPI585179A/redhead/Ohio/13OS0406/2013 (A/H7N3) segment 4 (HA)2737.90.000000e+001616/1683 (96%)
text_code_colored.pngEPI512431A/northern shoveler/Illinois/11OS4404/2011 (A/H7N3) segment 4 (HA)2737.90.000000e+001617/1684 (96%)
text_code_colored.pngEPI512194A/northern shoveler/Mississippi/12OS362/2012 (A/H7N7) segment 4 (HA)2737.90.000000e+001616/1683 (96%)
text_code_colored.pngEPI512180A/northern shoveler/Mississippi/12OS347/2012 (A/H7N7) segment 4 (HA)2737.90.000000e+001616/1683 (96%)
text_code_colored.pngEPI487317A/turkey/Minnesota/32710/2011 (A/H7N9) segment 4 (HA)2737.90.000000e+001617/1684 (96%)
text_code_colored.pngEPI487309A/turkey/Minnesota/31900/2011 (A/H7N9) segment 4 (HA)2737.90.000000e+001617/1684 (96%)
text_code_colored.pngEPI689773A/mallard/Nebraska/A00709657/2009 (A/H7N3) segment 4 (HA)2732.30.000000e+001616/1684 (95%)
text_code_colored.pngEPI689619A/blue winged teal/South Dakota/A00772794/2009 (A/H7N7) segment 4 (HA)2732.30.000000e+001615/1683 (95%)
text_code_colored.pngEPI512299A/northern shoveler/Arkansas/12OS158/2012 (A/H7N1) segment 4 (HA)2732.30.000000e+001615/1683 (95%)
text_code_colored.pngEPI569396A/blue-winged teal/LA/AI11-2911/2011 (A/H7N3) segment 4 (HA)2730.50.000000e+001609/1675 (96%)
text_code_colored.pngEPI689831A/mallard/New Jersey/A00926089/2010 (A/H7N3) segment 4 (HA)2726.80.000000e+001614/1683 (95%)
text_code_colored.pngEPI616382A/northern shoveler/Illinois/12OS4951/2012 (A/H7N3) segment 4 (HA)2726.80.000000e+001614/1683 (95%)
text_code_colored.pngEPI463745A/mallard/Minnesota/AI09-1714/2009 (A/H7N1) segment 4 (HA)2723.10.000000e+001613/1683 (95%)
text_code_colored.pngEPI689769A/mallard/Iowa/A00558620/2008 (A/H7N3) segment 4 (HA)2721.20.000000e+001614/1684 (95%)
text_code_colored.pngEPI689688A/blue winged teal/Texas/A00605473/2009 (A/H7N3) segment 4 (HA)2721.20.000000e+001613/1683 (95%)
text_code_colored.pngEPI689550A/American green winged teal/Texas/A00604814/2009 (A/H7N3) segment 4 (HA)2721.20.000000e+001613/1683 (95%)
text_code_colored.pngEPI689549A/American green winged teal/Texas/A00604032/2009 (A/H7N3) segment 4 (HA)2721.20.000000e+001613/1683 (95%)
text_code_colored.pngEPI689546A/American green winged teal/Texas/A00604024/2009 (A/H7N3) segment 4 (HA)2721.20.000000e+001613/1683 (95%)
text_code_colored.pngEPI418896A/common goldeneye/Wisconsin/10OS4202/2010 (A/H7N6) segment 4 (HA)2721.20.000000e+001613/1683 (95%)
text_code_colored.pngEPI689707A/blue winged teal/Texas/A00676566/2009 (A/H7N3) segment 4 (HA)2715.70.000000e+001612/1683 (95%)
text_code_colored.pngEPI689522A/American green winged teal/Mississippi/A00468514/2009 (A/H7N7) segment 4 (HA)2715.70.000000e+001612/1683 (95%)
text_code_colored.pngEPI526461A/American green-winged teal/Wisconsin/13OS3468/2013 (A/H7N3) segment 4 (HA)2715.70.000000e+001612/1683 (95%)
text_code_colored.pngEPI689547A/American green winged teal/Texas/A00604029/2009 (A/H7N3) segment 4 (HA)2710.20.000000e+001611/1683 (95%)
text_code_colored.pngEPI434477A/mallard/Nova Scotia/00372/2010 (A/H7N7) segment 4 (HA)2710.20.000000e+001611/1683 (95%)
text_code_colored.pngEPI434430A/American black duck/New Brunswick/00344/2010 (A/H7N7) segment 4 (HA)2710.20.000000e+001611/1683 (95%)
text_code_colored.pngEPI434481A/green-winged teal/New Brunswick/00392/2010 (A/H7N7) segment 4 (HA)2704.60.000000e+001610/1683 (95%)
text_code_colored.pngEPI616037A/northern shoveler/Ohio/12OS5539/2012 (A/H7N3) segment 4 (HA)2699.10.000000e+001609/1683 (95%)
text_code_colored.pngEPI616030A/American green-winged teal/Ohio/12OS5538/2012 (A/H7N3) segment 4 (HA)2693.50.000000e+001608/1683 (95%)
text_code_colored.pngEPI645360A/American green-winged teal/Ohio/13OS1769/2013 (A/H7N2) segment 4 (HA)2682.50.000000e+001607/1684 (95%)
text_code_colored.pngEPI645353A/blue-winged teal/Ohio/13OS1770/2013 (A/H7N3) segment 4 (HA)2682.50.000000e+001607/1684 (95%)
text_code_colored.pngEPI526457A/blue-winged teal/Ohio/13OS1773/2013 (A/H7N3) segment 4 (HA)2682.50.000000e+001607/1684 (95%)
text_code_colored.pngEPI526270A/American green-winged teal/Ohio/13OS1777/2013 (A/H7N3) segment 4 (HA)2682.50.000000e+001607/1684 (95%)
text_code_colored.pngEPI487934A/turkey/Minnesota/20400/2009 (A/H7N9) segment 4 (HA)2682.50.000000e+001607/1684 (95%)
text_code_colored.pngEPI487926A/turkey/Minnesota/18421/2009 (A/H7N9) segment 4 (HA)2682.50.000000e+001607/1684 (95%)
text_code_colored.pngEPI487918A/turkey/Minnesota/15591/2009 (A/H7N9) segment 4 (HA)2682.50.000000e+001607/1684 (95%)
text_code_colored.pngEPI487295A/turkey/Minnesota/14135-2/2009 (A/H7N9) segment 4 (HA)2682.50.000000e+001607/1684 (95%)
text_code_colored.pngEPI333728A/mallard/Missouri/220/2009 (A/H7N3) segment 4 (HA)2682.50.000000e+001606/1683 (95%)
text_code_colored.pngEPI690004A/northern pintail/Texas/A00466052/2009 (A/H7N3) segment 4 (HA)2676.90.000000e+001606/1684 (95%)
text_code_colored.pngEPI689871A/mallard/Oklahoma/A00744383/2009 (A/H7N3) segment 4 (HA)2676.90.000000e+001605/1683 (95%)
text_code_colored.pngEPI689771A/mallard/Michigan/A00869519/2009 (A/H7N3) segment 4 (HA)2676.90.000000e+001605/1683 (95%)
text_code_colored.pngEPI689739A/mallard/Illinois/A00325439/2009 (A/H7N3) segment 4 (HA)2676.90.000000e+001605/1683 (95%)
text_code_colored.pngEPI616996A/mallard/Alberta/192/2010 (A/H7N3) segment 4 (HA)2676.90.000000e+001606/1684 (95%)
text_code_colored.pngEPI616983A/mallard/Alberta/167/2010 (A/H7N3) segment 4 (HA)2676.90.000000e+001606/1684 (95%)
text_code_colored.pngEPI414400A/northern pintail/Interior Alaska/10BM02539R0/2010 (A/H7N3) segment 4 (HA)2676.90.000000e+001606/1684 (95%)
text_code_colored.pngEPI690010A/northern shoveler/Oklahoma/A00744384/2009 (A/H7N3) segment 4 (HA)2671.40.000000e+001604/1683 (95%)
text_code_colored.pngEPI689838A/mallard/Oklahoma/A00749161/2009 (A/H7N3) segment 4 (HA)2671.40.000000e+001604/1683 (95%)
text_code_colored.pngEPI689767A/mallard/Illinois/A00755320/2009 (A/H7N3) segment 4 (HA)2671.40.000000e+001604/1683 (95%)
text_code_colored.pngEPI487910A/turkey/Minnesota/14659/2009 (A/H7N9) segment 4 (HA)2671.40.000000e+001605/1684 (95%)
text_code_colored.pngEPI487303A/turkey/Minnesota/31676/2009 (A/H7N9) segment 4 (HA)2671.40.000000e+001606/1685 (95%)
text_code_colored.pngEPI451949A/northern pintail/Interior Alaska/10BM11038R0/2010 (A/H7N3) segment 4 (HA)2671.40.000000e+001604/1683 (95%)
text_code_colored.pngEPI451921A/northern pintail/Interior Alaska/10BM11366R0/2010 (A/H7N3) segment 4 (HA)2671.40.000000e+001604/1683 (95%)
text_code_colored.pngEPI451788A/northern pintail/Interior Alaska/10BM09481R0/2010 (A/H7N3) segment 4 (HA)2671.40.000000e+001604/1683 (95%)
text_code_colored.pngEPI451760A/mallard/Interior Alaska/10BM09539R0/2010 (A/H7N3) segment 4 (HA)2671.40.000000e+001604/1683 (95%)
text_code_colored.pngEPI451753A/mallard/Interior Alaska/10BM09528R0/2010 (A/H7N3) segment 4 (HA)2671.40.000000e+001604/1683 (95%)
text_code_colored.pngEPI451746A/northern pintail/Interior Alaska/10BM09348R0/2010 (A/H7N3) segment 4 (HA)2671.40.000000e+001604/1683 (95%)
text_code_colored.pngEPI451739A/northern pintail/Interior Alaska/10BM09347R0/2010 (A/H7N3) segment 4 (HA)2671.40.000000e+001604/1683 (95%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI512876A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 6 (NA)2549.50.000000e+001402/1413 (99%)
text_code_colored.pngEPI512345A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 6 (NA)2549.50.000000e+001402/1413 (99%)
text_code_colored.pngEPI420189A/bufflehead/California/3118/2011 (A/H4N8) segment 6 (NA)2549.50.000000e+001402/1413 (99%)
text_code_colored.pngEPI450000A/lesser scaup/Louisiana/AI09-5204/2009 (A/H6N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI334350A/bufflehead/Illinois/4016/2009 (A/H4N8) segment 6 (NA)2495.90.000000e+001391/1411 (98%)
text_code_colored.pngEPI154826A/bufflehead/California/HKWF205/2007 (A/H4N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)
text_code_colored.pngEPI418544A/mallard/Wisconsin/10OS3166/2010 (A/H0) segment 6 (NA)2453.50.000000e+001384/1412 (98%)
text_code_colored.pngEPI342994A/mallard/Alberta/507/2008 (A/H3N8) segment 6 (NA)2449.80.000000e+001384/1413 (97%)
text_code_colored.pngEPI513050A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 6 (NA)2436.90.000000e+001381/1412 (97%)
text_code_colored.pngEPI596199A/mallard/Maryland/13OS3020/2014 (A/H6N8) segment 6 (NA)2433.20.000000e+001381/1413 (97%)
text_code_colored.pngEPI234231A/blue-winged teal/North Dakota/Sg-00704/2008 (A/H3N8) segment 6 (NA)2429.50.000000e+001361/1384 (98%)
text_code_colored.pngEPI526433A/American green-winged teal/Ohio/13OS2094/2013 (A/H6N8) segment 6 (NA)2427.60.000000e+001380/1413 (97%)
text_code_colored.pngEPI615867A/willet/Peru-CH49/2010 (A/H6N8) segment 6 (NA)2425.80.000000e+001379/1412 (97%)
text_code_colored.pngEPI526391A/American green-winged teal/Ohio/13OS1781/2013 (A/H6N8) segment 6 (NA)2422.10.000000e+001379/1413 (97%)
text_code_colored.pngEPI526333A/American green-winged teal/Ohio/13OS2060/2013 (A/H6N8) segment 6 (NA)2422.10.000000e+001379/1413 (97%)
text_code_colored.pngEPI448654A/blue-winged teal/North Dakota/Sg-00719/2008 (A/H3N8) segment 6 (NA)2422.10.000000e+001379/1413 (97%)
text_code_colored.pngEPI234233A/blue-winged teal/North Dakota/Sg-00707/2008 (A/H4N8) segment 6 (NA)2420.20.000000e+001364/1391 (98%)
text_code_colored.pngEPI645418A/American green-winged teal/Ohio/13OS1840/2013 (A/H6N8) segment 6 (NA)2416.50.000000e+001378/1413 (97%)
text_code_colored.pngEPI343441A/mallard/Alberta/212/2006 (A/H3N8) segment 6 (NA)2416.50.000000e+001378/1413 (97%)
text_code_colored.pngEPI227374A/northern pintail/Alberta/11701/2005 (A/H3N8) segment 6 (NA)2411.00.000000e+001377/1413 (97%)
text_code_colored.pngEPI615874A/egret/Peru-CH50/2010 (A/H6N8) segment 6 (NA)2407.30.000000e+001369/1402 (97%)
text_code_colored.pngEPI343677A/mallard/Alberta/241/2004 (A/H3N8) segment 6 (NA)2405.50.000000e+001376/1413 (97%)
text_code_colored.pngEPI298668A/mallard/Interior Alaska/6MP0951/2006 (A/H3N8) segment 6 (NA)2405.50.000000e+001376/1413 (97%)
text_code_colored.pngEPI449527A/mallard/Minnesota/Sg-00860/2008 (A/H0) segment 6 (NA)2399.90.000000e+001376/1414 (97%)
text_code_colored.pngEPI343283A/mallard/Alberta/28/2007 (A/H3N8) segment 6 (NA)2399.90.000000e+001375/1413 (97%)
text_code_colored.pngEPI343275A/mallard/Alberta/34/2007 (A/H3N8) segment 6 (NA)2399.90.000000e+001375/1413 (97%)
text_code_colored.pngEPI343127A/mallard/Alberta/284/2007 (A/H0) segment 6 (NA)2399.90.000000e+001375/1413 (97%)
text_code_colored.pngEPI343043A/blue-winged teal/Alberta/387/2007 (A/H3N8) segment 6 (NA)2394.40.000000e+001374/1413 (97%)
text_code_colored.pngEPI298732A/mallard/Interior Alaska/6MP0972R1/2006 (A/H3N8) segment 6 (NA)2394.40.000000e+001374/1413 (97%)
text_code_colored.pngEPI298636A/mallard/Interior Alaska/6MP0272/2006 (A/H3N8) segment 6 (NA)2394.40.000000e+001374/1413 (97%)
text_code_colored.pngEPI298500A/green-winged teal/Interior Alaska/6MP0736/2006 (A/H3N8) segment 6 (NA)2394.40.000000e+001374/1413 (97%)
text_code_colored.pngEPI343452A/mallard/Alberta/190/2006 (A/H0) segment 6 (NA)2388.80.000000e+001373/1413 (97%)
text_code_colored.pngEPI343291A/mallard/Alberta/27/2007 (A/H3N8) segment 6 (NA)2388.80.000000e+001373/1413 (97%)
text_code_colored.pngEPI221422A/American green-winged teal/Interior Alaska/4/2007 (A/H3N8) segment 6 (NA)2388.80.000000e+001373/1413 (97%)
text_code_colored.pngEPI699696A/American green-winged teal/Interior Alaska/11BM03897/2011 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI699630A/American green-winged teal/Interior Alaska/11BM03657/2011 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI299575A/northern pintail/Interior Alaska/7MP0509/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI299060A/northern pintail/Interior Alaska/7MP2228/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI296892A/northern shoveler/Interior Alaska/7MP1765/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI263358A/mallard/Minnesota/Sg-00064/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI263094A/blue-winged teal/Minnesota/Sg-00037/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI222187A/mallard/Interior Alaska/2/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI234236A/blue-winged teal/North Dakota/Sg-00719/2008 (A/H3N8) segment 6 (NA)2379.60.000000e+001356/1390 (97%)
text_code_colored.pngEPI449681A/ring-necked duck/Minnesota/Sg-01066/2008 (A/H12N8) segment 6 (NA)2377.80.000000e+001372/1414 (97%)
text_code_colored.pngEPI449478A/mallard/Minnesota/Sg-00824/2008 (A/H0) segment 6 (NA)2377.80.000000e+001372/1414 (97%)
text_code_colored.pngEPI343109A/mallard/Alberta/318/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI342942A/mallard/Alberta/551/2009 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI299044A/northern pintail/Interior Alaska/7MP1822/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001372/1414 (97%)
text_code_colored.pngEPI296957A/American widgeon/Interior Alaska/7MP1707/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI296900A/northern shoveler/Interior Alaska/7MP0944/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI283597A/surface water/Minnesota/W07-2241/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263398A/ring-necked duck/Minnesota/Sg-00069/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263334A/mallard/Minnesota/Sg-00061/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263262A/mallard/Minnesota/Sg-00051/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263238A/mallard/Minnesota/Sg-00048/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263230A/mallard/Minnesota/Sg-00047/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263206A/gadwall/Minnesota/Sg-00044/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI178641A/northern shoveler/Interior Alaska/3/2007 (A/H3N8) segment 6 (NA)2374.10.000000e+001369/1411 (97%)
text_code_colored.pngEPI595705A/mallard/Maryland/08OS3097/2008 (A/H10N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI442452A/greater white-fronted goose/Alaska/44299-055/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI299204A/green-winged teal/Interior Alaska/8BM3706/2008 (A/H0) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI299196A/northern pintail/Interior Alaska/8BM3700/2008 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI225292A/mallard/Washington/20010-002/2006 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI442451A/greater white-fronted goose/Alaska/44299-054/2007 (A/H3N8) segment 6 (NA)2370.40.000000e+001369/1412 (96%)
text_code_colored.pngEPI699131A/mallard/Interior Alaska/12ML00098/2012 (A/H3N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI450043A/mallard/Arkansas/AI09-5944/2009 (A/H4N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI449987A/blue-winged teal/Texas/AI09-4463/2009 (A/H4N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI418513A/ruddy duck/Wisconsin/10OS3191/2010 (A/H3N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI343315A/mallard/Alberta/279/2006 (A/H3N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI342923A/pintail/Alberta/207/1999 (A/H0) segment 6 (NA)2366.70.000000e+001370/1414 (96%)
text_code_colored.pngEPI328504A/bufflehead/California/8522/2008 (A/H4N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI263318A/mallard/Minnesota/Sg-00059/2007 (A/H3N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI87760A/pintail/Alberta/207/1999 (A/H4N8) segment 6 (NA)2366.70.000000e+001370/1414 (96%)
text_code_colored.pngEPI450037A/mallard/Arkansas/AI09-5900/2009 (A/H3N8) segment 6 (NA)2361.10.000000e+001368/1413 (96%)
text_code_colored.pngEPI449786A/mallard/Minnesota/AI09-2571/2009 (A/H3N8) segment 6 (NA)2361.10.000000e+001369/1414 (96%)
text_code_colored.pngEPI402982A/mallard/Alberta/215/1999 (A/H0) segment 6 (NA)2361.10.000000e+001369/1414 (96%)
text_code_colored.pngEPI328645A/mallard/California/11032/2008 (A/H0N8) segment 6 (NA)2361.10.000000e+001368/1413 (96%)
text_code_colored.pngEPI526445A/American green-winged teal/Ohio/13OS2108/2013 (A/H3N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI526376A/blue-winged teal/Ohio/13OS2018/2013 (A/H3N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI449809A/blue-winged Teal/Minnesota/AI09-2977/2009 (A/H4N8) segment 6 (NA)2355.60.000000e+001368/1414 (96%)
text_code_colored.pngEPI448667A/mallard/North Dakota/Sg-00737/2008 (A/H6N8) segment 6 (NA)2355.60.000000e+001368/1414 (96%)
text_code_colored.pngEPI437063A/northern pintail/Interior Alaska/9BM12153R0/2009 (A/H4N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI328590A/northern shoveler/California/9235/2008 (A/H10N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI290783A/teal/Oregon/44336-130/2007 (A/H3N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI290577A/northern pintail/Oregon/44249-559/2006 (A/H3N8) segment 6 (NA)2355.60.000000e+001368/1414 (96%)
text_code_colored.pngEPI290775A/American green-winged teal/Oregon/44336-124/2007 (A/H3N8) segment 6 (NA)2353.80.000000e+001357/1398 (97%)
text_code_colored.pngEPI526340A/American green-winged teal/Ohio/13OS2106/2013 (A/H3N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI448479A/mallard/Minnesota/346256/2000 (A/H0) segment 6 (NA)2350.10.000000e+001368/1415 (96%)
text_code_colored.pngEPI387233A/mallard/California/3188/2010 (A/H6N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI344280A/lesser scaup/Alberta/206/1995 (A/H3N8) segment 6 (NA)2350.10.000000e+001367/1414 (96%)
text_code_colored.pngEPI298956A/American wigeon/Interior Alaska/7MP1726/2007 (A/H3N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI296973A/mallard/Interior Alaska/7MP1700/2007 (A/H3N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI238106A/mallard/Minnesota/448/2000 (A/H3N8) segment 6 (NA)2350.10.000000e+001368/1415 (96%)
text_code_colored.pngEPI442450A/greater white-fronted goose/Alaska/44299-002/2007 (A/H3N8) segment 6 (NA)2346.40.000000e+001354/1396 (96%)
text_code_colored.pngEPI512948A/American green-winged teal/Illinois/11OS4814/2011 (A/H3N8) segment 6 (NA)2344.50.000000e+001365/1413 (96%)
text_code_colored.pngEPI238511A/mallard/Minnesota/190/1999 (A/H3N8) segment 6 (NA)2344.50.000000e+001367/1415 (96%)
text_code_colored.pngEPI222337A/northern pintail/Alaska/7MP0508/2007 (A/H3N8) segment 6 (NA)2344.50.000000e+001365/1413 (96%)
text_code_colored.pngEPI178610A/northern shoveler/Interior Alaska/2/2007 (A/H3N8) segment 6 (NA)2344.50.000000e+001365/1413 (96%)
text_code_colored.pngEPI22171A/mallard/Alberta/215/99 (A/H6N8) segment 6 (NA)2342.70.000000e+001363/1410 (96%)
text_code_colored.pngEPI298980A/northern pintail/Interior Alaska/7MP0408/2007 (A/H3N8) segment 6 (NA)2339.00.000000e+001364/1413 (96%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI616384A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI513049A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI512344A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI512875A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI420188A/bufflehead/California/3118/2011 (A/H4N8) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI689817A/mallard/Nebraska/A00709657/2009 (A/H7N3) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI689575A/American green winged teal/Texas/A00604814/2009 (A/H7N3) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI689568A/American green winged teal/Texas/A00604032/2009 (A/H7N3) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI689561A/American green winged teal/Texas/A00604029/2009 (A/H7N3) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI689548A/American green winged teal/Texas/A00604024/2009 (A/H7N3) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI449999A/lesser scaup/Louisiana/AI09-5204/2009 (A/H6N8) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI690043A/northern shoveler/Mississippi/A00682947/2008 (A/H7N7) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI419526A/American green-winged teal/Mississippi/11OS256/2011 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI689700A/blue winged teal/Texas/A00605473/2009 (A/H7N3) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI689645A/blue winged teal/Louisiana/A00557206/2009 (A/H7N7) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI376067A/mallard/California/1475/2010 (A/H3N8) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI327661A/mallard/California/1156/2010 (A/H4N6) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI689789A/mallard/Iowa/A00558620/2008 (A/H7N3) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI689689A/blue winged teal/Texas/A00676566/2009 (A/H7N3) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI616847A/blue-winged teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI449901A/blue-winged Teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI449736A/mallard/Minnesota/AI09-1867/2009 (A/H8N4) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI449729A/mallard/Minnesota/AI09-1854/2009 (A/H8N4) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI449722A/mallard/Minnesota/AI09-1833/2009 (A/H8N4) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI435155A/American black duck/New Brunswick/00867/2010 (A/H5N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI398693A/mallard/California/1154/2010 (A/H4N6) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI387273A/mallard/California/1297/2010 (A/H4N6) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI327669A/mallard/California/1154/2010 (A/H0) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI327653A/mallard/California/1210/2010 (A/H4N6) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI327637A/mallard/California/1188/2010 (A/H4N6) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI689833A/mallard/New York/A00723392/2009 (A/H7N3) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI689659A/blue winged teal/Minnesota/A00137660/2009 (A/H7N3) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI689487A/American black duck/Delaware/A00870108/2010 (A/H7N3) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI512964A/mallard/Illinois/11OS5582/2011 (A/H1N1) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI512947A/American green-winged teal/Illinois/11OS4814/2011 (A/H3N8) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI476339A/blue-winged teal/Canada/3240/2011 (A/H4N6) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI476272A/blue-winged teal/Canada/3241/2011 (A/H4N6) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI476265A/blue-winged teal/Canada/3239/2011 (A/H4N6) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI476258A/blue-winged teal/Canada/3237/2011 (A/H4N6) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI476213A/thick-billed murre/Canada/1871/2011 (A/H1N1) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI476150A/common eider/Maine/270/2011 (A/H1N1) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI476143A/mallard/Maine/202/2011 (A/H1N1) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI476123A/bufflehead/Maine/161/2011 (A/H1N1) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI449328A/mallard/Minnesota/Sg-00804/2008 (A/H3N8) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI419167A/mallard/Wisconsin/10OS3866/2010 (A/H3N6) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI418971A/mallard/Wisconsin/10OS3169/2010 (A/H4N9) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI331963A/blue-winged teal/Guatemala/CIP049-06/2010 (A/H8N4) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI331955A/blue-winged teal/Guatemala/CIP049-12/2010 (A/H5N4) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI331947A/blue-winged teal/Guatemala/CIP049-13/2010 (A/H5N4) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI331939A/blue-winged teal/Guatemala/CIP049-14/2010 (A/H8N4) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI331915A/blue-winged teal/Guatemala/CIP049-15/2010 (A/H8N4) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI616449A/blue-winged teal/Illinois/12OS4788/2012 (A/H1N1) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI463748A/mallard/Minnesota/AI09-1714/2009 (A/H7N1) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI512992A/mallard/Wisconsin/11OS3092/2011 (A/H3N2) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512985A/mallard/Wisconsin/11OS3079/2011 (A/H3N2) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512919A/mallard/Wisconsin/11OS3106/2011 (A/H3N2) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI419062A/American green-winged teal/Wisconsin/10OS2955/2010 (A/H5N2) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI419055A/mallard/Wisconsin/10OS2945/2010 (A/H0) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI327629A/mallard/California/1289/2010 (A/H4N6) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI328420A/northern pintail/California/6495/2008 (A/H6N1) segment 7 (MP)1725.90.000000e+00966/982 (98%)
text_code_colored.pngEPI699389A/American green-winged teal/Interior Alaska/11BM00293/2011 (A/H10N5) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI699370A/American green-winged teal/Interior Alaska/11BM00304/2011 (A/H10N5) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI512209A/American green-winged teal/Mississippi/12OS405/2012 (A/H10N7) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI420253A/mallard/California/3569/2010 (A/H1N3) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI328317A/mallard/California/6420/2008 (A/H6N2) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI299195A/northern pintail/Interior Alaska/8BM3700/2008 (A/H3N8) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI220470A/env/California/7279/2008 (A/H2N3) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI159708A/turkey/CA/358533/2005 (A/H4N8) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI645489A/American green-winged teal/Wisconsin/13OS3465/2013 (A/H6N8) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI616170A/blue-winged teal/Ohio/12OS2138/2012 (A/H10N9) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI512233A/mallard/Arkansas/12OS184/2012 (A/H10N7) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI454938A/ruddy turnstone/New Jersey/AI06-582/2006 (A/H6N7) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI450079A/red-necked grebe/Minnesota/AI10-2530/2010 (A/H0) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI450071A/red-necked grebe/Minnesota/AI10-2529/2010 (A/H0) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI442481A/spectacled eider/Alaska/44173-055/2006 (A/H3N8) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI419704A/American wigeon/Missouri/10MO0530/2010 (A/H0) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI418727A/American green-winged teal/Wisconsin/10OS2767/2010 (A/H6N8) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI376081A/northern shoveler/California/3185/2010 (A/H0) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI369979A/mallard/Alberta/297/2007 (A/H2N9) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI334380A/mallard/Illinois/3048/2009 (A/H11N2) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI333743A/northern shovelerMissouri/141/2009 (A/H0) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI333607A/American green-winged teal/Mississippi/404/2010 (A/H0) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI300071A/northern pintail/Interior Alaska/8BM3696/2008 (A/H3N8) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI300064A/northern shoveler/Interior Alaska/8BM3671/2008 (A/H4N1) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI299727A/northern pintail/Interior Alaska/8BM3723/2008 (A/H4N1) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI299452A/northern shoveler/Mississippi/09OS643/2009 (A/H7N7) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI299203A/green-winged teal/Interior Alaska/8BM3706/2008 (A/H0) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI299027A/duck/Interior Alaska/7MP1582/2007 (A/H1N1) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI298340A/blue-winged teal/Louisiana/Sg-00189/2007 (A/H3N6) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI292834A/bufflehead/California/JN1016/2006 (A/H2N9) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI290758A/American green-winged teal/California/44287-395/2007 (A/H8N3) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI290696A/northern shoveler/Washington/44249-731/2006 (A/H10N7) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI280527A/mallard/Idaho/455398-2/2006 (A/H5N2) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI280519A/mallard/Washington/456277-7/2006 (A/H5N2) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI263207A/gadwall/Minnesota/Sg-00044/2007 (A/H3N8) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI225343A/pintail/Alberta/21/2006 (A/H1N1) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI220501A/env/California/7335/2008 (A/H2N3) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI220493A/env/California/7313/2008 (A/H2N3) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI220478A/env/California/7286/2008 (A/H2N3) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI183983A/ruddy turnstone/Delaware/752/2006 (A/H7N7) segment 7 (MP)1714.80.000000e+00964/982 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI616237A/blue-winged teal/Ohio/12OS2106/2012 (A/H4N6) segment 1 (PB2)4084.10.000000e+002257/2280 (98%)
text_code_colored.pngEPI418607A/northern shoveler/Arkansas/11OS333/2011 (A/H0) segment 1 (PB2)4050.80.000000e+002251/2280 (98%)
text_code_colored.pngEPI263193A/blue-winged teal/Texas/Sg-00081/2007 (A/H4N6) segment 1 (PB2)4050.80.000000e+002251/2280 (98%)
text_code_colored.pngEPI512780A/mallard/Wisconsin/11OS3407/2011 (A/H4N9) segment 1 (PB2)4039.70.000000e+002249/2280 (98%)
text_code_colored.pngEPI298321A/mallard/Minnesota/Sg-00220/2007 (A/H6N1) segment 1 (PB2)4039.70.000000e+002249/2280 (98%)
text_code_colored.pngEPI513061A/mallard/Wisconsin/11OS3577/2011 (A/H6N5) segment 1 (PB2)4034.20.000000e+002248/2280 (98%)
text_code_colored.pngEPI513029A/blue-winged teal/Iowa/44555-551/2011 (A/H3N2) segment 1 (PB2)4034.20.000000e+002248/2280 (98%)
text_code_colored.pngEPI403280A/northern pintail/Alberta/3/2009 (A/H0) segment 1 (PB2)4034.20.000000e+002248/2280 (98%)
text_code_colored.pngEPI449885A/blue-winged Teal/Minnesota/AI09-3575/2009 (A/H4N8) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI449783A/mallard/Minnesota/AI09-2519/2009 (A/H3N6) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI435864A/mallard/Alberta/91/2007 (A/H1N5) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI334157A/American green-winged teal/Illinois/3053/2009 (A/H0) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI327703A/mallard/California/5351/2009 (A/H1N1) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI298202A/mallard/Minnesota/Sg-00214/2007 (A/H6N1) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI298138A/mallard/Minnesota/Sg-00182/2007 (A/H6N1) segment 1 (PB2)4028.70.000000e+002248/2281 (98%)
text_code_colored.pngEPI284098A/green-winged teal/Minnesota/Sg-00197/2007 (A/H6N8) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI263185A/blue-winged teal/Texas/Sg-00080/2007 (A/H4N6) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI263145A/blue-winged teal/Texas/Sg-00075/2007 (A/H4N6) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI333581A/mallard/Mississippi/413/2010 (A/H1N1) segment 1 (PB2)4023.10.000000e+002246/2280 (98%)
text_code_colored.pngEPI298122A/mallard/Minnesota/Sg-00167/2007 (A/H6N1) segment 1 (PB2)4023.10.000000e+002240/2271 (98%)
text_code_colored.pngEPI154574A/northern shoveler/California/HKWF1370/2007 (A/H10N3) segment 1 (PB2)4023.10.000000e+002247/2281 (98%)
text_code_colored.pngEPI449997A/blue-winged teal/Louisiana/AI09-5159/2009 (A/H3N8) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI449964A/northern pintail/Minnesota/AI09-4322/2009 (A/H3N8) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI449432A/mallard/Minnesota/Sg-00692/2008 (A/H2N3) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI449285A/northern pintail/North Dakota/Sg-00749/2008 (A/H0) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI328351A/environment/California/7810/2008 (A/H4N6) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI290812A/mallard/Washington/44338-362/2007 (A/H11N9) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI449412A/mallard/Minnesota/Sg-00672/2008 (A/H3N8) segment 1 (PB2)4012.00.000000e+002244/2280 (98%)
text_code_colored.pngEPI449320A/blue-winged teal/Minnesota/Sg-00787/2008 (A/H3N8) segment 1 (PB2)4012.00.000000e+002244/2280 (98%)
text_code_colored.pngEPI448578A/mallard/Minnesota/Sg-00571/2008 (A/H0) segment 1 (PB2)4012.00.000000e+002244/2280 (98%)
text_code_colored.pngEPI418783A/American green-winged teal/Illinois/10OS3343/2010 (A/H2N3) segment 1 (PB2)4012.00.000000e+002244/2280 (98%)
text_code_colored.pngEPI512200A/northern shoveler/Mississippi/12OS362/2012 (A/H7N7) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI449418A/mallard/Minnesota/Sg-00674/2008 (A/H3N8) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI448671A/mallard/North Dakota/Sg-00737/2008 (A/H6N8) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI447990A/mallard/Arkansas/AI09-5944/2009 (A/H4N8) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI418970A/mallard/Wisconsin/10OS3144/2010 (A/H6N1) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI342961A/northern pintail/Alberta/8/2009 (A/H3N8) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI333769A/mallard/Illinois/4180/2009 (A/H6N1) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI616168A/American green-winged teal/Ohio/12OS2137/2012 (A/H4N6) segment 1 (PB2)4001.00.000000e+002243/2281 (98%)
text_code_colored.pngEPI614546A/blue winged-teal/Wisconsin/12OS4239/2012 (A/H3N2) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI512298A/mallard/Arkansas/12OS140/2012 (A/H11N3) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI512245A/American green-winged teal/Mississippi/12OS191/2012 (A/H5N3) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI451652A/mallard/Interior Alaska/10BM07575R0/2010 (A/H7N3) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI449292A/blue-winged teal/North Dakota/Sg-00750/2008 (A/H4N6) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI419659A/gadwall/Missouri/10MO0280/2010 (A/H5N2) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI342989A/mallard/Alberta/507/2008 (A/H3N8) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI333785A/mallard/Illinois/4162/2009 (A/H11N2) segment 1 (PB2)4001.00.000000e+002243/2281 (98%)
text_code_colored.pngEPI435836A/mallard/Alberta/128/2006 (A/H1N1) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI418864A/mallard/Wisconsin/10OS2667/2010 (A/H11N9) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI418826A/northern shoveler/Illinois/10OS3619/2010 (A/H11N9) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI296761A/mallard/Alberta/128/2006 (A/H1N1) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI166118A/mallard/Minnesota/Sg-00169/2007 (A/H3N8) segment 1 (PB2)3995.40.000000e+002219/2247 (98%)
text_code_colored.pngEPI616314A/northern shoveler/Illinois/12OS4951/2012 (A/H7N3) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI595926A/mallard/Maryland/09OS254/2009 (A/H1N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI512342A/mallard/Wisconsin/11OS4493/2011 (A/H1N3) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI468388A/mallard/Missouri/466554-14/2007 (A/H1N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI453954A/mallard/Interior Alaska/10BM11311R0/2010 (A/H3N8) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI449713A/mallard/Minnesota/AI09-1684/2009 (A/H1N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI449706A/mallard/Minnesota/AI09-1678/2009 (A/H1N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI449514A/green-winged teal/Minnesota/Sg-00841/2008 (A/H0) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI449362A/mallard/Minnesota/SG-00932/2008 (A/H6N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI420088A/mallard/California/2584V/2011 (A/H4N9) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI419815A/mallard/California/2532V/2011 (A/H4N6) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI419143A/northern shoveler/Mississippi/10OS4526/2010 (A/H6N2) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI419116A/gadwall/Mississippi/10OS4531/2010 (A/H6N2) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI333881A/blue-winged teal/Wisconsin/2649/2009 (A/H6N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI299482A/gadwall/Wisconsin/08OS2296/2008 (A/H6N2) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI188187A/mallard/Minnesota/Sg-00462/2008 (A/H6N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI298233A/mallard/Minnesota/Sg-00223/2007 (A/H6N1) segment 1 (PB2)3988.00.000000e+002222/2253 (98%)
text_code_colored.pngEPI188713A/mallard/Minnesota/Sg-00692/2008 (A/H2N3) segment 1 (PB2)3988.00.000000e+002227/2261 (98%)
text_code_colored.pngEPI154747A/mallard duck/Minnesota/Sg-00105/2007 (A/H6N1) segment 1 (PB2)3988.00.000000e+002217/2246 (98%)
text_code_colored.pngEPI154715A/blue-winged teal/Texas/Sg-00081/2007 (A/H4N6) segment 1 (PB2)3988.00.000000e+002217/2246 (98%)
text_code_colored.pngEPI689545A/American green winged teal/Texas/A00586649/2009 (A/H7N3) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI689521A/American green winged teal/Colorado/A00660616/2008 (A/H7N3) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI442129A/emperor goose/Alaska/44300-287/2007 (A/H1N2) segment 1 (PB2)3984.30.000000e+002226/2261 (98%)
text_code_colored.pngEPI420129A/mallard/California/2594V/2011 (A/H4N6) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI420122A/mallard/California/2594P/2011 (A/H4N6) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI420115A/mallard/California/2590V/2011 (A/H4N6) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI420081A/mallard/California/2584P/2011 (A/H4N9) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI419525A/American green-winged teal/Mississippi/11OS255/2011 (A/H7N7) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI418556A/northern pintail/Mississippi/10OS4521/2010 (A/H0) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI413395A/mallard/Ohio/10OS1470/2010 (A/H3N2) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI413388A/mallard/Ohio/10OS1469/2010 (A/H3N2) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI387293A/mallard/California/1335-1/2010 (A/H10) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI387286A/mallard/California/1335/2010 (A/H10) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI333825A/gadwall/Illinois/3860/2009 (A/H6N1) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI328528A/American wigeon/California/8547/2008 (A/H6N1) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI328231A/mallard/California/8293/2008 (A/H6N1) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI328191A/mallard/California/8432/2008 (A/H6N1) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI188155A/northern pintail/South Dakota/Sg-00454/2008 (A/H6N5) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI166244A/mallard/Minnesota/Sg-00223/2007 (A/H6N1) segment 1 (PB2)3984.30.000000e+002217/2247 (98%)
text_code_colored.pngEPI188677A/mallard/Minnesota/Sg-00683/2008 (A/H3N8) segment 1 (PB2)3982.50.000000e+002226/2261 (98%)
text_code_colored.pngEPI188662A/mallard/Minnesota/Sg-00679/2008 (A/H3N8) segment 1 (PB2)3982.50.000000e+002226/2261 (98%)
text_code_colored.pngEPI188634A/mallard/Minnesota/Sg-00672/2008 (A/H3N8) segment 1 (PB2)3982.50.000000e+002226/2261 (98%)
text_code_colored.pngEPI188194A/mallard/Minnesota/Sg-00464/2008 (A/H6N1) segment 1 (PB2)3980.70.000000e+002238/2280 (98%)
text_code_colored.pngEPI616057A/mallard/Ohio/12OS5582/2012 (A/H0) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI595723A/mallard/Maryland/08OS3111/2008 (A/H10N7) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI512430A/northern shoveler/Illinois/11OS5680/2011 (A/H11N9) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI419053A/mallard/Wisconsin/10OS2918/2010 (A/H4N6) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI419046A/mallard/Wisconsin/10OS2917/2010 (A/H4N6) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI616386A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 2 (PB1)4133.90.000000e+002262/2274 (99%)
text_code_colored.pngEPI512213A/American green-winged teal/Mississippi/12OS405/2012 (A/H10N7) segment 2 (PB1)4111.80.000000e+002258/2274 (99%)
text_code_colored.pngEPI512237A/mallard/Arkansas/12OS184/2012 (A/H10N7) segment 2 (PB1)4100.70.000000e+002256/2274 (99%)
text_code_colored.pngEPI616094A/northern shoveler/Ohio/12OS5647/2012 (A/H2N3) segment 2 (PB1)4089.60.000000e+002254/2274 (99%)
text_code_colored.pngEPI526269A/American green-winged teal/Ohio/13OS1777/2013 (A/H7N3) segment 2 (PB1)4078.50.000000e+002252/2274 (99%)
text_code_colored.pngEPI645359A/American green-winged teal/Ohio/13OS1769/2013 (A/H7N2) segment 2 (PB1)4073.00.000000e+002251/2274 (98%)
text_code_colored.pngEPI645352A/blue-winged teal/Ohio/13OS1770/2013 (A/H7N3) segment 2 (PB1)4073.00.000000e+002251/2274 (98%)
text_code_colored.pngEPI616348A/American green-winged teal/Mississippi/12OS5061/2012 (A/H5N2) segment 2 (PB1)4067.40.000000e+002250/2274 (98%)
text_code_colored.pngEPI526456A/blue-winged teal/Ohio/13OS1773/2013 (A/H7N3) segment 2 (PB1)4056.40.000000e+002249/2275 (98%)
text_code_colored.pngEPI542051A/mallard/Idaho/ND0002644/2013 (A/H3N8) segment 2 (PB1)4050.80.000000e+002247/2274 (98%)
text_code_colored.pngEPI419327A/mallard/Illinois/10OS4111/2010 (A/H10N7) segment 2 (PB1)4050.80.000000e+002247/2274 (98%)
text_code_colored.pngEPI451933A/mallard/Interior Alaska/10BM11434R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451912A/northern pintail/Interior Alaska/10BM10906R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451877A/mallard/Interior Alaska/10BM10811R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451870A/northern pintail/Interior Alaska/10BM10809R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451863A/northern pintail/Interior Alaska/10BM10807R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451856A/northern pintail/Interior Alaska/10BM10805R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451849A/northern pintail/Interior Alaska/10BM10801R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451826A/northern pintail/Interior Alaska/10BM10476R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451819A/mallard/Interior Alaska/10BM10324R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451812A/northern pintail/Interior Alaska/10BM10166R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451805A/northern pintail/Interior Alaska/10BM09832R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451798A/mallard/Interior Alaska/10BM09818R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451793A/northern pintail/Interior Alaska/10BM09481R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451751A/northern pintail/Interior Alaska/10BM09348R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451744A/northern pintail/Interior Alaska/10BM09347R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451709A/northern pintail/Interior Alaska/10BM08705R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451674A/mallard/Interior Alaska/10BM08099R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451658A/northern pintail/Interior Alaska/10BM07737R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451644A/mallard/Interior Alaska/10BM07501R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451637A/northern pintail/Interior Alaska/10BM07469R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451630A/northern pintail/Interior Alaska/10BM07458R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451623A/northern pintail/Interior Alaska/10BM07260R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451601A/northern pintail/Interior Alaska/10BM07114R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451594A/northern pintail/Interior Alaska/10BM07106R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451587A/mallard/Interior Alaska/10BM07092R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451580A/mallard/Interior Alaska/10BM07085R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451454A/mallard/Interior Alaska/10BM09141R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436829A/mallard/Interior Alaska/10BM06911R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436822A/mallard/Interior Alaska/10BM06909R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436811A/mallard/Interior Alaska/10BM06905R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436804A/northern pintail/Interior Alaska/10BM06899R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436796A/northern pintail/Interior Alaska/10BM06524R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436666A/mallard/Interior Alaska/10BM05860R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436575A/mallard/Interior Alaska/10BM05347R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI432814A/northern pintail/Interior Alaska/10BM06901R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451961A/mallard/Interior Alaska/10BM12534R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451779A/mallard/Interior Alaska/10BM09563R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451772A/mallard/Interior Alaska/10BM09548R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451765A/mallard/Interior Alaska/10BM09539R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451758A/mallard/Interior Alaska/10BM09528R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451737A/northern pintail/Interior Alaska/10BM09181R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451688A/mallard/Interior Alaska/10BM08120R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451681A/mallard/Interior Alaska/10BM08100R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451615A/northern pintail/Interior Alaska/10BM07121R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451608A/northern pintail/Interior Alaska/10BM07120R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451563A/mallard/Interior Alaska/10BM07072R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451556A/mallard/Interior Alaska/10BM07066R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451549A/northern pintail/Interior Alaska/10BM07029R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451441A/northern pintail/Interior Alaska/10BM07267R0/2010 (A/H0) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436867A/northern pintail/Interior Alaska/10BM06720R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436793A/northern pintail/Interior Alaska/10BM06895R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436773A/mallard/Interior Alaska/10BM06838R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436679A/northern pintail/Interior Alaska/10BM06306R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436665A/northern pintail/Interior Alaska/10BM06303R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI453953A/mallard/Interior Alaska/10BM11311R0/2010 (A/H3N8) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI453932A/mallard/Interior Alaska/10BM10829R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451919A/northern pintail/Interior Alaska/10BM11208R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451905A/mallard/Interior Alaska/10BM10876R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451898A/mallard/Interior Alaska/10BM10861R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451891A/mallard/Interior Alaska/10BM10859R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451884A/northern pintail/Interior Alaska/10BM10853R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451842A/northern pintail/Interior Alaska/10BM10790R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451833A/mallard/Interior Alaska/10BM10787R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451730A/mallard/Interior Alaska/10BM08884R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451723A/mallard/Interior Alaska/10BM08883R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451716A/mallard/Interior Alaska/10BM08874R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451702A/northern pintail/Interior Alaska/10BM08586R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451695A/northern pintail/Interior Alaska/10BM08400R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451666A/northern pintail/Interior Alaska/10BM07821R0/2010 (A/H0) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI616327A/northern shoveler/Missouri/12OS5755/2012 (A/H10N3) segment 2 (PB1)4028.70.000000e+002243/2274 (98%)
text_code_colored.pngEPI451940A/northern pintail/Interior Alaska/10BM11945R0/2010 (A/H7N3) segment 2 (PB1)4028.70.000000e+002243/2274 (98%)
text_code_colored.pngEPI699707A/mallard/Interior Alaska/11BM03859/2011 (A/H0) segment 2 (PB1)4017.60.000000e+002241/2274 (98%)
text_code_colored.pngEPI699570A/mallard/Interior Alaska/11BM03102/2011 (A/H4N6) segment 2 (PB1)4012.00.000000e+002240/2274 (98%)
text_code_colored.pngEPI512982A/American green-winged teal/Wisconsin/11OS3053/2011 (A/H6N1) segment 2 (PB1)4012.00.000000e+002240/2274 (98%)
text_code_colored.pngEPI419688A/mallard/Missouri/10MO0391/2010 (A/H10N7) segment 2 (PB1)4012.00.000000e+002240/2274 (98%)
text_code_colored.pngEPI614557A/blue winged-teal/Wisconsin/12OS2603/2012 (A/H3N2) segment 2 (PB1)4006.50.000000e+002239/2274 (98%)
text_code_colored.pngEPI542045A/mallard/Idaho/ND0002643/2013 (A/H4N8) segment 2 (PB1)4006.50.000000e+002239/2274 (98%)
text_code_colored.pngEPI699448A/mallard/Interior Alaska/11BM02089/2011 (A/H4N6) segment 2 (PB1)4001.00.000000e+002238/2274 (98%)
text_code_colored.pngEPI542057A/mallard/Idaho/ND0002645/2013 (A/H4N6) segment 2 (PB1)4001.00.000000e+002238/2274 (98%)
text_code_colored.pngEPI512733A/American green-winged teal/Wisconsin/11OS3431/2011 (A/H5N2) segment 2 (PB1)4001.00.000000e+002238/2274 (98%)
text_code_colored.pngEPI700085A/American wigeon/Interior Alaska/11CH00036/2011 (A/H4N6) segment 2 (PB1)3995.40.000000e+002237/2274 (98%)
text_code_colored.pngEPI699647A/mallard/Interior Alaska/11BM03599/2011 (A/H4N6) segment 2 (PB1)3995.40.000000e+002237/2274 (98%)
text_code_colored.pngEPI334243A/mallard/Missouri/350/2009 (A/H11N9) segment 2 (PB1)3995.40.000000e+002238/2275 (98%)
text_code_colored.pngEPI700078A/mallard/Interior Alaska/11CH00019/2011 (A/H4N6) segment 2 (PB1)3989.90.000000e+002237/2275 (98%)
text_code_colored.pngEPI699556A/mallard/Interior Alaska/11BM02987/2011 (A/H2N6) segment 2 (PB1)3989.90.000000e+002236/2274 (98%)
text_code_colored.pngEPI542063A/mallard/Idaho/ND0002646/2013 (A/H4N6) segment 2 (PB1)3989.90.000000e+002236/2274 (98%)
text_code_colored.pngEPI700503A/northern pintail/Interior Alaska/11ML00065/2011 (A/H3N6) segment 2 (PB1)3984.30.000000e+002236/2275 (98%)
text_code_colored.pngEPI699728A/American green-winged teal/Interior Alaska/11BM03897/2011 (A/H3N8) segment 2 (PB1)3984.30.000000e+002235/2274 (98%)
text_code_colored.pngEPI419930A/mallard/California/2556V/2011 (A/H3N8) segment 2 (PB1)3984.30.000000e+002235/2274 (98%)

Share this post


Link to post
Share on other sites