Sign in to follow this  
Followers 0
niman

Indiana H7N8 HPAI & LPAI Sequences At Genbank

38 posts in this topic

Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI486916A/northern pintail/California/2789/2011 (A/H9N2) segment 3 (PA)3818.10.000000e+002123/2151 (98%)
text_code_colored.pngEPI549237A/blue-winged teal/TX/AI12-802/2012 (A/H10N3) segment 3 (PA)3812.60.000000e+002122/2151 (98%)
text_code_colored.pngEPI511416A/mallard/Wisconsin/11OS4368/2011 (A/H11N9) segment 3 (PA)3801.50.000000e+002120/2151 (98%)
text_code_colored.pngEPI549236A/blue-winged teal/TX/AI12-801/2012 (A/H10N3) segment 3 (PA)3796.00.000000e+002111/2139 (98%)
text_code_colored.pngEPI584361A/redhead/Ohio/13OS0406/2013 (A/H7N3) segment 3 (PA)3790.40.000000e+002118/2151 (98%)
text_code_colored.pngEPI526250A/American green-winged teal/Wisconsin/13OS3468/2013 (A/H7N3) segment 3 (PA)3784.90.000000e+002117/2151 (98%)
text_code_colored.pngEPI614135A/American green-winged teal/Ohio/12OS2256/2012 (A/H6N5) segment 3 (PA)3779.40.000000e+002116/2151 (98%)
text_code_colored.pngEPI614026A/American green-winged teal/Wisconsin/12OS2997/2012 (A/H4N6) segment 3 (PA)3779.40.000000e+002116/2151 (98%)
text_code_colored.pngEPI343060A/blue-winged teal/Alberta/378/2007 (A/H0) segment 3 (PA)3779.40.000000e+002116/2151 (98%)
text_code_colored.pngEPI343049A/blue-winged teal/Alberta/380/2007 (A/H0) segment 3 (PA)3773.80.000000e+002115/2151 (98%)
text_code_colored.pngEPI526211A/blue-winged teal/Ohio/13OS2037/2013 (A/H7N1) segment 3 (PA)3768.30.000000e+002114/2151 (98%)
text_code_colored.pngEPI511468A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 3 (PA)3768.30.000000e+002114/2151 (98%)
text_code_colored.pngEPI345105A/bufflehead/Alberta/399/2007 (A/H0) segment 3 (PA)3768.30.000000e+002114/2151 (98%)
text_code_colored.pngEPI511376A/greater scaup/Wisconsin/11OS5760/2011 (A/H10N2) segment 3 (PA)3762.70.000000e+002113/2151 (98%)
text_code_colored.pngEPI511371A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 3 (PA)3762.70.000000e+002113/2151 (98%)
text_code_colored.pngEPI511430A/American green-winged teal/Mississippi/11OS5903/2011 (A/H4N6) segment 3 (PA)3751.70.000000e+002111/2151 (98%)
text_code_colored.pngEPI614117A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 3 (PA)3746.10.000000e+002110/2151 (98%)
text_code_colored.pngEPI511346A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 3 (PA)3740.60.000000e+002109/2151 (98%)
text_code_colored.pngEPI614088A/mallard/Missouri/12OS5759/2012 (A/H11N9) segment 3 (PA)3729.50.000000e+002107/2151 (97%)
text_code_colored.pngEPI614017A/blue winged-teal/Wisconsin/12OS3069/2012 (A/H11N9) segment 3 (PA)3690.70.000000e+002100/2151 (97%)
text_code_colored.pngEPI700509A/mallard/Interior Alaska/11ML00069/2011 (A/H2N3) segment 3 (PA)3685.20.000000e+002099/2151 (97%)
text_code_colored.pngEPI227246A/mallard/Alberta/11527/2005 (A/H3N8) segment 3 (PA)3679.60.000000e+002098/2151 (97%)
text_code_colored.pngEPI332987A/pintail/Alaska/99/2005 (A/H0) segment 3 (PA)3635.30.000000e+002090/2151 (97%)
text_code_colored.pngEPI298663A/mallard/Interior Alaska/6MP0891/2006 (A/H4N6) segment 3 (PA)3635.30.000000e+002090/2151 (97%)
text_code_colored.pngEPI614217A/mallard/Alberta/26/2001 (A/H0) segment 3 (PA)3629.80.000000e+002089/2151 (97%)
text_code_colored.pngEPI59866A/green-winged teal/Ohio/1844/2005 (A/H11N9) segment 3 (PA)3629.80.000000e+002089/2151 (97%)
text_code_colored.pngEPI49402A/pintail/Alaska/310/2005 (A/H4N6) segment 3 (PA)3629.80.000000e+002089/2151 (97%)
text_code_colored.pngEPI333931A/northern pintail/Wisconsin/4198/2009 (A/H11N9) segment 3 (PA)3624.20.000000e+002089/2152 (97%)
text_code_colored.pngEPI328225A/mallard/California/8834/2008 (A/H5N9) segment 3 (PA)3624.20.000000e+002088/2151 (97%)
text_code_colored.pngEPI298535A/northern pintail/Interior Alaska/6MP0817/2006 (A/H0) segment 3 (PA)3624.20.000000e+002088/2151 (97%)
text_code_colored.pngEPI238090A/mallard/Minnesota/382/2000 (A/H5N3) segment 3 (PA)3624.20.000000e+002088/2151 (97%)
text_code_colored.pngEPI298607A/green-winged teal/Interior Alaska/6MP1077/2006 (A/H3N8) segment 3 (PA)3618.70.000000e+002087/2151 (97%)
text_code_colored.pngEPI159138A/mallard/MN/479/2000 (A/H5N3) segment 3 (PA)3618.70.000000e+002087/2151 (97%)
text_code_colored.pngEPI442231A/greater white-fronted goose/Alaska/44064-108/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI299803A/mallard/Interior Alaska/6MP0990R1/2006 (A/H0) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI298759A/mallard/Interior Alaska/6MP0038BR2/2006 (A/H2N3) segment 3 (PA)3613.20.000000e+002086/2151 (96%)
text_code_colored.pngEPI298687A/mallard/Interior Alaska/6MP0988/2006 (A/H0) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI298647A/northern pintail/Interior Alaska/6MP0792/2006 (A/H2N3) segment 3 (PA)3613.20.000000e+002086/2151 (96%)
text_code_colored.pngEPI298575A/mallard/Interior Alaska/6MP0992/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI298567A/mallard/Interior Alaska/6MP0991/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288891A/mallard/Alaska/44185-044/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288886A/mallard/Alaska/44187-131/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288885A/mallard/Alaska/44185-067/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288878A/mallard/Alaska/44187-129/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288866A/mallard/Alaska/44187-043/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288857A/mallard/Alaska/44185-078/2006 (A/H3N2) segment 3 (PA)3613.20.000000e+002087/2152 (96%)
text_code_colored.pngEPI288884A/mallard/Alaska/44185-043/2006 (A/H3N2) segment 3 (PA)3605.80.000000e+002085/2152 (96%)
text_code_colored.pngEPI442279A/emperor goose/Alaska/44323-246/2007 (A/H3N8) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI442257A/emperor goose/Alaska/44063-066/2006 (A/H2N5) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI288890A/mallard/Alaska/44183-124/2006 (A/H2N3) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI229634A/mallard/Maryland/948/2004 (A/H11N9) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI442254A/emperor goose/Alaska/44063-075/2006 (A/H2N5) segment 3 (PA)3598.40.000000e+002083/2151 (96%)
text_code_colored.pngEPI614212A/pintail/Alberta/25/2001 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI442233A/emperor goose/Alaska/44064-075/2006 (A/H2N5) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI442230A/brant/Alaska/44063-007/2006 (A/H2N1) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI343802A/mallard/Alberta/22/2001 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI343794A/mallard/Alberta/27/2001 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI299763A/mallard/Interior Alaska/6MP0905/2006 (A/H10N9) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI298767A/mallard/Interior Alaska/6MP0163AR2/2006 (A/H3N8) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI298671A/mallard/Interior Alaska/6MP0951/2006 (A/H3N8) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI298639A/mallard/Interior Alaska/6MP0272/2006 (A/H3N8) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI229642A/mallard/Maryland/950/2004 (A/H11N9) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI229618A/mallard/Maryland/922/2004 (A/H11N9) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI229599A/blue-winged teal/Ohio/658/2004 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI229592A/green-winged teal/Ohio/648/2004 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI172224A/blue-winged teal/Manitoba/13436/2005 (A/H3N8) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI166788A/northern pintail/Alaska/44183-123/2006 (A/H2N3) segment 3 (PA)3596.50.000000e+002077/2142 (96%)
text_code_colored.pngEPI52155A/blue-winged teal/Ohio/658/2004 (A/H7N3) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI442260A/emperor goose/Alaska/44063-029/2006 (A/H2N1) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI298735A/mallard/Interior Alaska/6MP0972R1/2006 (A/H3N8) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI285899A/northern pintail/California/466371/2006 (A/H5N2) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI229650A/mallard/Maryland/954/2004 (A/H11N9) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI229626A/mallard/Maryland/926/2004 (A/H11N9) segment 3 (PA)3591.00.000000e+002083/2152 (96%)
text_code_colored.pngEPI42054A/mallard/Alberta/34/2001 (A/H7N1) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI442237A/emperor goose/Alaska/44063-145/2006 (A/H2N1) segment 3 (PA)3587.30.000000e+002081/2151 (96%)
text_code_colored.pngEPI614244A/northern shoveler/North Carolina/1523546/2005 (A/H0) segment 3 (PA)3585.50.000000e+002081/2151 (96%)
text_code_colored.pngEPI298503A/green-winged teal/Interior Alaska/6MP0736/2006 (A/H3N8) segment 3 (PA)3585.50.000000e+002081/2151 (96%)
text_code_colored.pngEPI60208A/green-winged teal/Ohio/1324/2005 (A/H4N6) segment 3 (PA)3585.50.000000e+002081/2151 (96%)
text_code_colored.pngEPI59999A/green-winged teal/Ohio/1324/2005 (A/H4N6) segment 3 (PA)3585.50.000000e+002081/2151 (96%)
text_code_colored.pngEPI343337A/mallard/Alberta/256/2006 (A/H0) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI342991A/mallard/Alberta/507/2008 (A/H3N8) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI275169A/thick-billed murre/Alaska/44085-040/2006 (A/H10N3) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI80956A/mallard/Alberta/24/01 (A/H7N3) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI475436A/pintail/Alberta/68/2005 (A/H1N1) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI468612A/mallard/Alberta/201/1998 (A/H1N1) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI454182A/American black duck/North Carolina/1321373/2004 (A/H3N2) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI343304A/mallard/Alberta/297/2006 (A/H4N6) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI286504A/American widgeon/Washington/466769/2006 (A/H5N2) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI229506A/American black duck/North Carolina/675-075/2004 (A/H3N2) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI178029A/northern pintail/California/44221-789/2006 (A/H5N2) segment 3 (PA)3574.40.000000e+002073/2142 (96%)
text_code_colored.pngEPI159712A/turkey/CA/358533/2005 (A/H4N8) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI86732A/mallard/ALB/201/1998 (A/H1N1) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI227285A/mallard/California/GL30/2005 (A/H4N6) segment 3 (PA)3570.70.000000e+002079/2152 (96%)
text_code_colored.pngEPI468369A/pintail/Alberta/69/2005 (A/H1N1) segment 3 (PA)3568.80.000000e+002078/2151 (96%)
text_code_colored.pngEPI435728A/pintail/Alberta/69/2005 (A/H1N1) segment 3 (PA)3568.80.000000e+002078/2151 (96%)
text_code_colored.pngEPI343356A/mallard/Alberta/246/2006 (A/H4N6) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI343348A/mallard/Alberta/254/2006 (A/H4N6) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI343328A/mallard/Alberta/258/2006 (A/H4N6) segment 3 (PA)3568.80.000000e+002079/2152 (96%)
text_code_colored.pngEPI229692A/chicken/British Columbia/04 (A/H7N3) segment 3 (PA)3568.80.000000e+002078/2151 (96%)
text_code_colored.pngEPI178030A/northern pintail/California/44221-794/2006 (A/H3N8) segment 3 (PA)3568.80.000000e+002072/2142 (96%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI334349A/bufflehead/Illinois/4016/2009 (A/H4N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)
text_code_colored.pngEPI419535A/American green-winged teal/Mississippi/11OS257/2011 (A/H11N9) segment 5 (NP)2654.80.000000e+001477/1497 (98%)
text_code_colored.pngEPI418545A/mallard/Wisconsin/10OS3166/2010 (A/H0) segment 5 (NP)2654.80.000000e+001477/1497 (98%)
text_code_colored.pngEPI512266A/blue-winged teal/Wisconsin/11OS2873/2011 (A/H3N2) segment 5 (NP)2649.20.000000e+001476/1497 (98%)
text_code_colored.pngEPI616325A/northern shoveler/Missouri/12OS5755/2012 (A/H10N3) segment 5 (NP)2632.60.000000e+001473/1497 (98%)
text_code_colored.pngEPI328267A/mallard/California/6957/2008 (A/H10N7) segment 5 (NP)2632.60.000000e+001473/1497 (98%)
text_code_colored.pngEPI616165A/American green-winged teal/Ohio/12OS2137/2012 (A/H4N6) segment 5 (NP)2627.10.000000e+001472/1497 (98%)
text_code_colored.pngEPI512884A/mallard/Wisconsin/11OS4204/2011 (A/H0) segment 5 (NP)2627.10.000000e+001472/1497 (98%)
text_code_colored.pngEPI689534A/American green winged teal/Mississippi/A00630203/2009 (A/H7N6) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI328574A/northern shoveler/California/9710/2008 (A/H10N7) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI299358A/northern shoveler/Mississippi/09OS589/2009 (A/H4N6) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI333661A/American green-winged teal/Mississippi/300/2010 (A/H11N9) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI690051A/northern shoveler/Nevada/A00505416/2008 (A/H7N6) segment 5 (NP)2604.90.000000e+001469/1498 (98%)
text_code_colored.pngEPI328481A/green-winged teal/California/10197/2008 (A/H10N7) segment 5 (NP)2604.90.000000e+001469/1498 (98%)
text_code_colored.pngEPI645515A/blue-winged teal/Ohio/13OS2104/2013 (A/H2N3) segment 5 (NP)2588.30.000000e+001465/1497 (97%)
text_code_colored.pngEPI178799A/northern shoveler/California/HKWF392sm/2007 (A/H10N7) segment 5 (NP)2588.30.000000e+001465/1497 (97%)
text_code_colored.pngEPI435840A/mallard/Alberta/152/2006 (A/H1N3) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI328644A/mallard/California/11032/2008 (A/H0N8) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI328589A/northern shoveler/California/9235/2008 (A/H10N8) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI328075A/northern shoveler/California/9781/2008 (A/H1N3) segment 5 (NP)2582.70.000000e+001465/1498 (97%)
text_code_colored.pngEPI290714A/northern shoveler/Washington/44249-752/2006 (A/H7N3) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI290706A/northern shoveler/Washington/44249-749/2006 (A/H7N3) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI442357A/greater white-fronted goose/Alaska/44049-046/2006 (A/H5N2) segment 5 (NP)2577.20.000000e+001463/1497 (97%)
text_code_colored.pngEPI286140A/white front goose/Alaska//445210/2006 (A/H5N2) segment 5 (NP)2577.20.000000e+001463/1497 (97%)
text_code_colored.pngEPI280601A/white front goose/Alaska/477003/2007 (A/H5N2) segment 5 (NP)2571.70.000000e+001462/1497 (97%)
text_code_colored.pngEPI280585A/tundra swan/Alaska/442960/2006 (A/H5N2) segment 5 (NP)2571.70.000000e+001462/1497 (97%)
text_code_colored.pngEPI292417A/American green-winged teal/California/44287-305/2007 (A/H7N6) segment 5 (NP)2566.10.000000e+001461/1497 (97%)
text_code_colored.pngEPI290661A/American green-winged teal/California/28228/2007 (A/H7N6) segment 5 (NP)2566.10.000000e+001461/1497 (97%)
text_code_colored.pngEPI292804A/northern shoveler/California/JN770/2006 (A/H10N3) segment 5 (NP)2564.30.000000e+001454/1487 (97%)
text_code_colored.pngEPI442383A/tundra swan/Alaska/44049-168/2006 (A/H5N2) segment 5 (NP)2562.40.000000e+001457/1492 (97%)
text_code_colored.pngEPI343451A/mallard/Alberta/190/2006 (A/H0) segment 5 (NP)2560.60.000000e+001460/1497 (97%)
text_code_colored.pngEPI241717A/mallard/Alberta/11513/2005 (A/H0) segment 5 (NP)2560.60.000000e+001460/1497 (97%)
text_code_colored.pngEPI689675A/blue winged teal/Missouri/A00624484/2008 (A/H7N3) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI689668A/blue winged teal/Missouri/A00624483/2008 (A/H7N3) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI475399A/pintail/Alberta/68/2005 (A/H1N1) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI437289A/blue-winged teal/Alberta/405/2008 (A/H10N7) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI435791A/pintail/Alberta/69/2005 (A/H1N1) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI468371A/pintail/Alberta/69/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI455875A/mallard/Minnesota/Sg-00630/2008 (A/H10N7) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI449918A/mallard/Minnesota/AI09-3819/2009 (A/H0) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI435805A/mallard/Alberta/257/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI435798A/mallard/Alberta/240/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI334118A/mallard/Illinois/3747/2009 (A/H6N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI327273A/mallard/Alberta/11393/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI280481A/waterfowl/Colorado/443593/2006 (A/H5N2) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI503530A/wild bird/Chile/1805/2008 (A/H5N9) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI450032A/mallard/Arkansas/AI09-5761/2009 (A/H2N3) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI449854A/northern pintail/Minnesota/AI09-3254/2009 (A/H6N2) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI333933A/northern pintail/Wisconsin/4198/2009 (A/H11N9) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI298301A/blue-winged teal/Minnesota/Sg-00201/2007 (A/H4N6) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI222304A/mallard/Manitoba/23912/2007 (A/H4N7) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI131965A/mallard/Missouri/209/2006 (A/H11N9) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI442354A/greater white-fronted goose/Alaska/44065-031/2006 (A/H5N2) segment 5 (NP)2542.10.000000e+001446/1481 (97%)
text_code_colored.pngEPI689730A/domestic duck/West Virginia/A00140913/2008 (A/H7N3) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI452222A/northern pintail/Interior Alaska/9BM7882R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI452145A/northern pintail/Interior Alaska/9BM11643R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI452004A/northern pintail/Interior Alaska/9BM6510R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI436946A/northern pintail/Interior Alaska/9BM8109R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI407675A/northern shoveler/Interior Alaska/9BM1447R2/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI403274A/northern pintail/Alberta/3/2009 (A/H0) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI334203A/northern shoveler/Mississippi/236/2010 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI333733A/northern shovelerMissouri/196/2009 (A/H10N3) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI299510A/American green-winged teal/Illinois/08OS2713/2008 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI299502A/mallard/Illinois/08OS2711/2008 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI299398A/mallard/Illinois/08OS2710/2008 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI290800A/mallard/Washington/44338-195/2007 (A/H12N5) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI227450A/redhead/Alberta/11817/2005 (A/H4N6) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI220550A/green winged teal/California/AKS1305/2008 (A/H11N9) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI700493A/mallard/Interior Alaska/11ML00058/2011 (A/H7N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI699583A/mallard/Interior Alaska/11BM03577/2011 (A/H7N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI689742A/domestic duck/West Virginia/A00140915/2008 (A/H7N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI689723A/domestic duck/West Virginia/A00140912/2008 (A/H7N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI455976A/mallard/Minnesota/Sg-01005/2008 (A/H0) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI452124A/northern pintail/Interior Alaska/9BM11409R0/2009 (A/H12N5) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI450045A/northern shoveler/Arkansas/AI09-6012/2009 (A/H10N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI448675A/blue-winged teal/North Dakota/Sg-00740/2008 (A/H3N8) segment 5 (NP)2532.90.000000e+001456/1498 (97%)
text_code_colored.pngEPI436979A/northern pintail/Interior Alaska/9BM8967R0/2009 (A/H8N4) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI433101A/American green-winged teal/Interior Alaska/9BM5045R0/2009 (A/H8N4) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI415985A/northern pintail/Interior Alaska/10BM02549R0 (A/H0) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI413412A/mallard/Ohio/10OS1319/2010 (A/H4N6) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI327859A/mallard/California/6768/2009 (A/H1N1) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI299558A/environment/Indiana/08OS3524/2008 (A/H1N2) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI299486A/mallard/Illinois/08OS2315/2008 (A/H4N6) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI292689A/American green-winged teal/California/44363-067/2007 (A/H11N9) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI280841A/mallard/Oregon/461067-2/2006 (A/H5N2) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI230699A/mallard/California/K752/2006 (A/H10N7) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI690027A/northern pintail/Texas/A00466052/2009 (A/H7N3) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI616825A/mallard/Minnesota/AI07-3433/2007 (A/H7N3) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI513040A/mallard/Illinois/11OS5570/2011 (A/H3N8) segment 5 (NP)2527.30.000000e+001455/1498 (97%)
text_code_colored.pngEPI512339A/mallard/Wisconsin/11OS4493/2011 (A/H1N3) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI455983A/mallard/Minnesota/Sg-01030/2008 (A/H10N7) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI452018A/northern pintail/Interior Alaska/9BM7152R2/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI436884A/mallard/Interior Alaska/9BM10537R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI432856A/northern shoveler/Interior Alaska/9BM2925R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI414327A/mallard/Interior Alaska/9BM2705R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI414305A/mallard/Interior Alaska/9BM2351R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI414290A/mallard/Interior Alaska/9BM2388R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI387268A/northern shoveler/California/3628/2011 (A/H10) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI333821A/lesser scaup/Illinois/4115/2009 (A/H10N7) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI328716A/mallard/California/8118/2008 (A/H11N9) segment 5 (NP)2527.30.000000e+001454/1497 (97%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI616385A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 8 (NS)1520.90.000000e+00833/838 (99%)
text_code_colored.pngEPI418930A/common goldeneye/Wisconsin/10OS4202/2010 (A/H7N6) segment 8 (NS)1509.80.000000e+00831/838 (99%)
text_code_colored.pngEPI513052A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 8 (NS)1498.80.000000e+00829/838 (98%)
text_code_colored.pngEPI512957A/greater scaup/Wisconsin/11OS5760/2011 (A/H10N2) segment 8 (NS)1498.80.000000e+00829/838 (98%)
text_code_colored.pngEPI512878A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 8 (NS)1498.80.000000e+00829/838 (98%)
text_code_colored.pngEPI420191A/bufflehead/California/3118/2011 (A/H4N8) segment 8 (NS)1498.80.000000e+00829/838 (98%)
text_code_colored.pngEPI512347A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 8 (NS)1493.20.000000e+00828/838 (98%)
text_code_colored.pngEPI454969A/bufflehead/North Carolina/NC6412-125/2005 (A/H4N8) segment 8 (NS)1408.30.000000e+00812/837 (97%)
text_code_colored.pngEPI87529A/mallard duck/ALB/25/1985 (A/H4N6) segment 8 (NS)1352.90.000000e+00804/839 (95%)
text_code_colored.pngEPI342913A/mallard/Alberta/254/2003 (A/H3N3) segment 8 (NS)1341.80.000000e+00802/839 (95%)
text_code_colored.pngEPI85990A/mallard duck/ALB/76/1985 (A/H6N3) segment 8 (NS)1341.80.000000e+00802/839 (95%)
text_code_colored.pngEPI468275A/blue winged teal/Louisiana/B228/1986 (A/H1N1) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI453660A/American green-winged teal/Interior Alaska/10BM08222R0/2010 (A/H3N8) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI453232A/northern pintail/Interior Alaska/9BM7972R0/2009 (A/H4N6) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI452866A/American green-winged teal/Interior Alaska/9BM8129R0/2009 (A/H4N6) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI452859A/northern pintail/Interior Alaska/9BM8119R0/2009 (A/H4N6) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI452760A/northern pintail/Interior Alaska/9BM11789R0/2009 (A/H3N8) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI452040A/mallard/Interior Alaska/9BM7216R0/2009 (A/H8N4) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI448339A/blue-winged teal/Louisiana/42B/1987 (A/H2N3) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI333780A/mallard/Illinois/4179/2009 (A/H11N9) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI120383A/duck/NJ/7717-70/1995 (A/H1N1) segment 8 (NS)1336.20.000000e+00802/840 (95%)
text_code_colored.pngEPI88577A/mallard duck/ALB/763/1983 (A/H11N8) segment 8 (NS)1336.20.000000e+00802/840 (95%)
text_code_colored.pngEPI87180A/mallard/ALB/118/1995 (A/H3N5) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI59768A/mallard/Ohio/399/1987 (A/H11N9) segment 8 (NS)1336.20.000000e+00801/839 (95%)
text_code_colored.pngEPI486838A/mallard/California/3310/2012 (A/H2N3) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI486826A/mallard/California/3223/2012 (A/H2N3) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI486803A/mallard/California/3174/2012 (A/H2N3) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI486796A/mallard/California/3172/2012 (A/H2N3) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI486789A/mallard/California/3171/2012 (A/H2N3) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI486366A/mallard/California/2997/2012 (A/H2N3) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI486320A/mallard/California/2885/2012 (A/H2N3) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI486100A/mallard/California/3435/2012 (A/H2N3) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI486093A/mallard/California/3113/2012 (A/H3) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI485048A/mallard/California/3078/2012 (A/H2N3) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI453324A/northern pintail/Interior Alaska/9BM6095R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI453317A/northern pintail/Interior Alaska/9BM6094R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI453310A/northern pintail/Interior Alaska/9BM6039R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI453239A/mallard/Interior Alaska/9BM10375R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI453211A/northern pintail/Interior Alaska/9BM6145R0/2009 (A/H3N8) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI453204A/northern pintail/Interior Alaska/9BM6040R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI453097A/mallard/Interior Alaska/9BM12523R0/2009 (A/H3N8) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452957A/northern pintail/Interior Alaska/9BM10835R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452943A/northern pintail/Interior Alaska/9BM10813R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452908A/mallard/Interior Alaska/9BM8829R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452901A/northern pintail/Interior Alaska/9BM8815R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452894A/northern pintail/Interior Alaska/9BM8803R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452880A/mallard/Interior Alaska/9BM8471R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI452830A/northern pintail/Interior Alaska/9BM7632R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452823A/northern pintail/Interior Alaska/9BM7620R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452795A/northern pintail/Interior Alaska/9BM12066R1/2009 (A/H3N8) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452739A/northern pintail/Interior Alaska/9BM11572R0/2009 (A/H3N8) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452704A/mallard/Interior Alaska/9BM11015R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452683A/northern pintail/Interior Alaska/9BM10877R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452669A/mallard/Interior Alaska/9BM10095R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452627A/northern pintail/Interior Alaska/9BM7254R0/2009 (A/H3N8) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI452620A/northern pintail/Interior Alaska/9BM7252R0/2009 (A/H3N8) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI452578A/mallard/Interior Alaska/9BM6886R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452571A/northern pintail/Interior Alaska/9BM6494R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452536A/northern pintail/Interior Alaska/9BM6146R0/2009 (A/H3N8) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI452529A/northern pintail/Interior Alaska/9BM6144R0/2009 (A/H3N8) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI452284A/mallard/Interior Alaska/9BM8389R0/2009 (A/H8N4) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI452026A/mallard/Interior Alaska/9BM7162R0/2009 (A/H8N4) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI451991A/northern pintail/Interior Alaska/9BM6226R0/2009 (A/H0) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI449996A/blue-winged teal/Louisiana/AI09-5159/2009 (A/H3N8) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI449975A/American green-winged teal/Texas/AI09-4396/2009 (A/H3N9) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI442305A/American green-winged teal/Alaska/44419-241/2008 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI437609A/pintail/Alberta/140/1996 (A/H1N1) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI437079A/mallard/Interior Alaska/9BM8470R0/2009 (A/H0) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI437016A/northern pintail/Interior Alaska/9BM9419R0/2009 (A/H0) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI436916A/northern pintail/Interior Alaska/9BM11661R0/2009 (A/H0) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI432991A/northern pintail/Interior Alaska/9BM4660R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI432977A/northern pintail/Interior Alaska/9BM4641R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI432963A/northern pintail/Interior Alaska/9BM4583R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI432916A/northern pintail/Interior Alaska/9BM4347R0/2009 (A/H4N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI432843A/mallard/Interior Alaska/9BM8468R0/2009 (A/H0) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI432820A/mallard/Interior Alaska/9BM8469R0/2009 (A/H0) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI401891A/knot/Delaware Bay/526/1988 (A/H6N8) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI370946A/mallard/Alberta/529/1980 (A/H2N3) segment 8 (NS)1330.70.000000e+00801/840 (95%)
text_code_colored.pngEPI344318A/mallard/Alberta/85/1994 (A/H3N8) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI343715A/pintail/Alberta/166/2003 (A/H3N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI158627A/mallard/MN/259/1999 (A/H3N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI86234A/pintail/Alberta/166/2003 (A/H3N6) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI85718A/knot/DE/526/1988 (A/H6N8) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI34151A/wigeon/Ohio/379/1988 (A/H5N2) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI22415A/pintail/Alberta/156/97 (A/H3N8) segment 8 (NS)1330.70.000000e+00800/839 (95%)
text_code_colored.pngEPI616925A/ruddy turnstone/New Jersey/65/1985 (A/H7N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI614523A/American green-winged teal/Wisconsin/12OS2994/2012 (A/H1N1) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI486910A/mallard/California/3418/2012 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI486782A/mallard/California/3167/2012 (A/H2N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI486732A/mallard/California/3148/2012 (A/H2N3) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI453153A/northern pintail/Interior Alaska/9BM9989R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI453104A/northern pintail/Interior Alaska/9BM9447R0/2009 (A/H3N8) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI453090A/northern shoveler/Interior Alaska/9BM12519R0/2009 (A/H4N8) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452816A/northern pintail/Interior Alaska/9BM7496R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452781A/northern pintail/Interior Alaska/9BM11915R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452613A/northern pintail/Interior Alaska/9BM7232R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452550A/American green-winged teal/Interior Alaska/9BM6258R0/2009 (A/H4N6) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452494A/mallard/Interior Alaska/9BM10370R0/2009 (A/H10N7) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452487A/mallard/Interior Alaska/9BM10369R0/2009 (A/H10N7) segment 8 (NS)1325.20.000000e+00799/839 (95%)
text_code_colored.pngEPI452277A/mallard/Interior Alaska/9BM8287R0/2009 (A/H10N7) segment 8 (NS)1325.20.000000e+00799/839 (95%)

Share this post


Link to post
Share on other sites
LOCUS       KU585916                1696 bp    cRNA    linear   VRL 10-FEB-2016
DEFINITION  Influenza A virus (A/turkey/Indiana/16-001574-7/2016(H7N8)) segment
            4 hemagglutinin (HA) gene, complete cds.
ACCESSION   KU585916
VERSION     KU585916.1  GI:985701767
KEYWORDS    .
SOURCE      Influenza A virus (A/turkey/Indiana/16-001574-7/2016(H7N8))
  ORGANISM  Influenza A virus (A/turkey/Indiana/16-001574-7/2016(H7N8))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1696)
  AUTHORS   Killian,M.L., Hines,N.L. and Torchetti,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2016) Diagnostic Virology Laboratory, National
            Veterinary Services Laboratories (NVSL), USDA APHIS VS, 1920 Dayton
            Avenue, Ames, IA 50010, USA
COMMENT     GenBank Accession Numbers KU585913-KU585920 represent sequences
            from the 8 segments of Influenza A virus
            (A/turkey/Indiana/16-001574-7/2016(H7N8)).
            
            ##Assembly-Data-START##
            Assembly Method       :: SeqMan NGen v. v4
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1696
                     /organism="Influenza A virus
                     (A/turkey/Indiana/16-001574-7/2016(H7N8))"
                     /mol_type="viral cRNA"
                     /strain="A/turkey/Indiana/16-001574-7/2016"
                     /serotype="H7N8"
                     /isolation_source="OP swab; pooled sample"
                     /host="turkey; commercial"
                     /db_xref="taxon:1785959"
                     /segment="4"
                     /country="USA: Dubois County, Indiana"
                     /collection_date="Jan-2016"
                     /note="NVSL 16-001574-7; EP1; LPAI"
     gene            7..1689
                     /gene="HA"
     CDS             7..1689
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="AMD38712.1"
                     /db_xref="GI:985701768"
                     /translation="MNTQILALIACMLIGAKGDKICLGHHAVANGTKVNTLTERGIEV
                     VNATETVETANIKKICTQGKRPTDLGQCGLLGTLIGPPQCDQFLEFDADLIIERREGT
                     DVCYPGKFTNKESLRQILRGSGGIDKESMGFTYSGIRTNGATSACRRSGSSFYAEMKW
                     LLSNSDNAAFPQMTKSYRNPRSKPALIIWGVHHSGSVTEQTKLYGSGNKLITVGSSKY
                     QQSFTPSPGARPQVNGQSGRIDFHWLLLDPNDTVTFTFNGAFIAPDRASFLRGESLGV
                     QSDVPLDSSCKGDCFHNGGTIVSSLPFQNINPRTVGKCPRYVKQTSLLLATGMRNVPE
                     NPKTRGLFGAIAGFIENGWEGLIDGWYGFRHQNAQGKGTAADYKSTQSAIDQITGKLN
                     RLIDKTNQQFELIDNEFSEIEQQIGNVINWTRDSMTEVWSYNAELLVAMENQHTIDLA
                     DSEMNKLYERVRKQLRENAEEDGTGCFEIFHKCDDQCMESIRNNTYDHTQYRAESLQN
                     RIQIDPVKLSSGYKDIILWFSFGASCFLLLAIAMGLVFICIKNGNMRCTICI"
     sig_peptide     7..60
                     /gene="HA"
     mat_peptide     61..1023
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1024..1686
                     /gene="HA"
                     /product="HA2"
ORIGIN      
        1 tacaaaatga acactcaaat tttggcactc attgcttgta tgctgatcgg agctaaagga
       61 gacaaaatat gtcttgggca ccatgctgtg gcaaatggaa caaaagtgaa cacactaaca
      121 gagagaggaa tcgaagtagt aaatgccaca gaaacggtgg agactgcaaa tattaagaaa
      181 atatgcactc aggggaaaag accaacagat ctgggacaat gcggacttct aggaacccta
      241 ataggacctc cccaatgcga tcaattcctg gagtttgacg ctgatttaat aattgaacgg
      301 agagaaggaa cggatgtgtg ttatcctggg aagttcacaa ataaagaatc actgaggcag
      361 atcctccgag ggtcaggagg aattgataag gaatcaatgg gtttcactta tagtggaata
      421 agaaccaatg gggcaacgag tgcttgcaga agatcaggtt cttccttcta tgcggagatg
      481 aagtggttat tgtcgaattc agacaatgcg gcttttcccc aaatgactaa gtcgtacaga
      541 aatcccagga gcaaaccagc tctaataatt tggggagtgc atcactctgg atcggttact
      601 gaacagacca aactctatgg gagtggaaac aagttgataa cagtaggaag ctcgaaatac
      661 cagcagtcat tcaccccaag cccgggggca cgaccacagg tgaatgggca atcaggaagg
      721 attgattttc attggctact ccttgacccc aacgacacag tgactttcac tttcaatggg
      781 gcattcatag ctcctgacag agcaagtttc cttagagggg agtcactagg agttcaaagt
      841 gacgttcctt tggattctag ttgcaagggg gattgcttcc acaatggagg tacgatagtg
      901 agctcactgc cattccagaa catcaaccct agaacagtgg gaaaatgccc tcgatatgtc
      961 aaacagacaa gcctcctctt ggctacaggg atgaggaacg tcccagagaa ccccaagacc
     1021 agaggtcttt ttggagcgat tgctggattc atagagaatg ggtgggaagg cctcattgat
     1081 ggatggtacg gtttcaggca tcaaaatgca caaggaaaag gtactgcagc tgattacaaa
     1141 agcactcaat ctgcaataga tcagatcaca ggcaaattga atcgtctaat tgacaaaaca
     1201 aatcagcagt ttgaactgat agacaacgaa ttcagtgaaa tagaacaaca gattgggaat
     1261 gtcattaatt ggacacgaga ttcaatgact gaagtatggt cgtataatgc tgaactgctg
     1321 gtagctatgg aaaatcagca cacaatagat cttgcagact cagaaatgaa caaactttac
     1381 gagcgtgtaa ggaaacaact gagggagaat gctgaagagg atgggactgg atgctttgag
     1441 atattccata agtgtgatga tcaatgcatg gagagcataa ggaacaacac ctacgaccat
     1501 acccaataca gagcagagtc attgcagaat agaatacaga tagacccagt gaaactgagt
     1561 agtggataca aagacataat cttatggttt agcttcgggg catcatgttt tcttcttcta
     1621 gccattgcaa tgggattggt cttcatttgc ataaagaatg gaaacatgcg gtgcactatt
     1681 tgtatatagt ttgaga

Share this post


Link to post
Share on other sites
Isolate detail
Isolate name:
 
A/turkey/Indiana/16-001574-7/2016 
 
 
Isolate ID:
 
EPI_ISL_211728 
 
 
Passage details/history:
 
 
 
 
Type:
 
A / H7N8 
 
 
Lineage:
 
 
Sample information

 

Collection date:
 
2016-01 (Day unknown) 
 
 
Host
 
Turkey 
 
 
Additional host information:
 
 
 
 
Domestic status:
 
 
 
 
Is vaccinated:
 
 
 
 
Location:
 
United States 
 
 
Additional location information:
 
 
 
 
Health status:
 
 
 
 
Specimen source:
 
 
 
 
Strain or commercial product name used for vaccination:
 
 
 
 
Institute information

 

Originating lab:
 
 
 
Sample ID given by the sample provider:
 
 
 
 
Address:
 
 
 
Submitting lab:
 
Other Database Import
 
Sample ID given by the submitting laboratory:
 
 
 
 
Authors:
 
Killian,M.L.;
Hines,N.L.;
Torchetti,M.
 
Address:
 
 
 
Publication
Publication
 
In vivo antiviral resistance

 

Antiviral resistance tested by experimental procedures
 
Adamantanes:
 
Unknown 
 
 
Oseltamivir:
 
Unknown 
 
 
Zanamivir:
 
Unknown 
 
 
Peramivir:
 
Unknown 
 
 
Other:
 
Unknown 
 
 
Additional information
Antigenic characterization:
 
 
 
 
Note:
 
NVSL 16-001574-7; EP1; LPAI
 
 
Sequence

 

segmentidentifierlengthaccession #INSDCSequence
 
PB2
 
A/turkey/Indiana/16-001574-7/2016
 
2287
 
EPI709581
 
 
 
 
PB1
 
A/turkey/Indiana/16-001574-7/2016
 
2290
 
EPI709582
 
 
 
 
PA
 
A/turkey/Indiana/16-001574-7/2016
 
2182
 
EPI709583
 
 
 
 
HA
 
A/turkey/Indiana/16-001574-7/2016
 
1696
 
EPI709584
 
 
 
 
NP
 
A/turkey/Indiana/16-001574-7/2016
 
1524
 
EPI709585
 
 
 
 
NA
 
A/turkey/Indiana/16-001574-7/2016
 
1419
 
EPI709586
 
 
 
 
MP
 
A/turkey/Indiana/16-001574-7/2016
 
987
 
EPI709587
 
 
 
 
NS
 
A/turkey/Indiana/16-001574-7/2016
 
850
 
EPI709588
 
 
 
Submitter information

 

Submitter:
 
, EpiFluDB 
 
 
Submission Date:
 
2016-01-25 
 
 
Last modifier:
 
Pohlmann, Anne (EpiFlu Data Curator) 
 
 
Last modified:
 
2016-02-10 
 
 
 

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI709584A/turkey/Indiana/16-001574-7/2016 (A/H7N8) segment 4 (HA)3109.00.000000e+001683/1683 (100%)
text_code_colored.pngEPI709576A/turkey/Indiana/16-001573-2/2016 (A/H7N8) segment 4 (HA)3092.40.000000e+001680/1683 (99%)
text_code_colored.pngEPI645556A/blue-winged teal/Iowa/13OS2316/2013 (A/H7N3) segment 4 (HA)2942.80.000000e+001653/1683 (98%)
text_code_colored.pngEPI594839A/mallard/Maryland/13OS3019/2014 (A/H0) segment 4 (HA)2915.10.000000e+001648/1683 (97%)
text_code_colored.pngEPI526172A/blue-winged teal/Ohio/13OS2037/2013 (A/H7N1) segment 4 (HA)2909.60.000000e+001647/1683 (97%)
text_code_colored.pngEPI419496A/American green-winged teal/Mississippi/11OS247/2011 (A/H0) segment 4 (HA)2826.50.000000e+001632/1683 (96%)
text_code_colored.pngEPI413380A/mallard/Missouri/10MO0551/2010 (A/H7N7) segment 4 (HA)2804.30.000000e+001628/1683 (96%)
text_code_colored.pngEPI689616A/blue winged teal/Minnesota/A00137660/2009 (A/H7N3) segment 4 (HA)2798.80.000000e+001627/1683 (96%)
text_code_colored.pngEPI419540A/American green-winged teal/Mississippi/11OS259/2011 (A/H0) segment 4 (HA)2798.80.000000e+001627/1683 (96%)
text_code_colored.pngEPI419497A/American green-winged teal/Mississippi/11OS250/2011 (A/H7N3) segment 4 (HA)2798.80.000000e+001627/1683 (96%)
text_code_colored.pngEPI419085A/American black duck/Wisconsin/10OS3949/2010 (A/H7N8) segment 4 (HA)2798.80.000000e+001627/1683 (96%)
text_code_colored.pngEPI418762A/American green-winged teal/Illinois/10OS3368/2010 (A/H7N7) segment 4 (HA)2798.80.000000e+001627/1683 (96%)
text_code_colored.pngEPI418759A/American green-winged teal/Illinois/10OS3329/2010 (A/H7N7) segment 4 (HA)2798.80.000000e+001627/1683 (96%)
text_code_colored.pngEPI616891A/mallard/Alberta/590/2010 (A/H7N8) segment 4 (HA)2793.30.000000e+001626/1683 (96%)
text_code_colored.pngEPI418597A/northern shoveler/Arkansas/11OS333/2011 (A/H0) segment 4 (HA)2793.30.000000e+001626/1683 (96%)
text_code_colored.pngEPI419446A/northern shoverl/Mississippi/11OS145/2011 (A/H7N9) segment 4 (HA)2787.70.000000e+001625/1683 (96%)
text_code_colored.pngEPI419234A/northern shoveler/Missouri/10OS4750/2010 (A/H7N3) segment 4 (HA)2787.70.000000e+001625/1683 (96%)
text_code_colored.pngEPI419498A/American green-winged teal/Mississippi/11OS255/2011 (A/H7N7) segment 4 (HA)2782.20.000000e+001624/1683 (96%)
text_code_colored.pngEPI418570A/northern shoveler/Arkansas/11OS171/2011 (A/H0) segment 4 (HA)2782.20.000000e+001624/1683 (96%)
text_code_colored.pngEPI419184A/northern shoveler/Missouri/10OS4700/2010 (A/H0) segment 4 (HA)2776.60.000000e+001623/1683 (96%)
text_code_colored.pngEPI419181A/northern shoveler/Missouri/10OS4632/2010 (A/H7N7) segment 4 (HA)2776.60.000000e+001623/1683 (96%)
text_code_colored.pngEPI616787A/blue-winged teal/Texas/AI12-909/2012 (A/H7N1) segment 4 (HA)2771.10.000000e+001622/1683 (96%)
text_code_colored.pngEPI419703A/American wigeon/Missouri/10MO0530/2010 (A/H0) segment 4 (HA)2771.10.000000e+001622/1683 (96%)
text_code_colored.pngEPI419542A/northern shoveler/Mississippi/11OS202/2011 (A/H7N7) segment 4 (HA)2771.10.000000e+001623/1684 (96%)
text_code_colored.pngEPI419233A/gadwall/Missouri/10OS4731/2010 (A/H7N3) segment 4 (HA)2771.10.000000e+001622/1683 (96%)
text_code_colored.pngEPI689523A/American green winged teal/Mississippi/A00630203/2009 (A/H7N6) segment 4 (HA)2765.60.000000e+001621/1683 (96%)
text_code_colored.pngEPI419543A/northern shoveler/Mississippi/11OS289/2011 (A/H7N3) segment 4 (HA)2765.60.000000e+001621/1683 (96%)
text_code_colored.pngEPI299451A/northern shoveler/Mississippi/09OS643/2009 (A/H7N7) segment 4 (HA)2765.60.000000e+001621/1683 (96%)
text_code_colored.pngEPI690006A/northern shoveler/Mississippi/A00602284/2009 (A/H0) segment 4 (HA)2760.00.000000e+001620/1683 (96%)
text_code_colored.pngEPI690005A/northern shoveler/Louisiana/A00557321/2009 (A/H7N3) segment 4 (HA)2760.00.000000e+001620/1683 (96%)
text_code_colored.pngEPI689614A/blue winged teal/Louisiana/A00557206/2009 (A/H7N7) segment 4 (HA)2760.00.000000e+001620/1683 (96%)
text_code_colored.pngEPI512246A/northern shoveler/Mississippi/12OS231/2012 (A/H0) segment 4 (HA)2760.00.000000e+001620/1683 (96%)
text_code_colored.pngEPI487352A/guinea fowl/Nebraska/17096/2011 (A/H7N9) segment 4 (HA)2760.00.000000e+001621/1684 (96%)
text_code_colored.pngEPI487328A/goose/Nebraska/17097/2011 (A/H7N9) segment 4 (HA)2760.00.000000e+001621/1684 (96%)
text_code_colored.pngEPI399915A/goose/Nebraska/17097-4/2011 (A/H7N9) segment 4 (HA)2760.00.000000e+001621/1684 (96%)
text_code_colored.pngEPI299347A/American green-winged teal/Mississippi/09OS046/2009 (A/H7N7) segment 4 (HA)2760.00.000000e+001620/1683 (96%)
text_code_colored.pngEPI690008A/northern shoveler/Mississippi/A00682947/2008 (A/H7N7) segment 4 (HA)2754.50.000000e+001619/1683 (96%)
text_code_colored.pngEPI689690A/bufflehead/Virginia/A00120022/2008 (A/H7N2) segment 4 (HA)2754.50.000000e+001619/1683 (96%)
text_code_colored.pngEPI399917A/guinea fowl/Nebraska/17096-1/2011 (A/H7N9) segment 4 (HA)2754.50.000000e+001620/1684 (96%)
text_code_colored.pngEPI689774A/mallard/New Jersey/A00122457/2008 (A/H7N8) segment 4 (HA)2748.90.000000e+001618/1683 (96%)
text_code_colored.pngEPI616857A/blue-winged teal/Louisiana/AI11-2911/2011 (A/H7N3) segment 4 (HA)2748.90.000000e+001618/1683 (96%)
text_code_colored.pngEPI616845A/blue-winged teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 4 (HA)2748.90.000000e+001618/1683 (96%)
text_code_colored.pngEPI512215A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 4 (HA)2748.90.000000e+001618/1683 (96%)
text_code_colored.pngEPI512201A/American green-winged teal/Mississippi/12OS397/2012 (A/H7N7) segment 4 (HA)2748.90.000000e+001618/1683 (96%)
text_code_colored.pngEPI449900A/blue-winged Teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 4 (HA)2748.90.000000e+001618/1683 (96%)
text_code_colored.pngEPI418798A/American green-winged teal/Illinois/10OS4014/2010 (A/H7N3) segment 4 (HA)2748.90.000000e+001618/1683 (96%)
text_code_colored.pngEPI585179A/redhead/Ohio/13OS0406/2013 (A/H7N3) segment 4 (HA)2743.40.000000e+001617/1683 (96%)
text_code_colored.pngEPI512431A/northern shoveler/Illinois/11OS4404/2011 (A/H7N3) segment 4 (HA)2743.40.000000e+001618/1684 (96%)
text_code_colored.pngEPI512194A/northern shoveler/Mississippi/12OS362/2012 (A/H7N7) segment 4 (HA)2743.40.000000e+001617/1683 (96%)
text_code_colored.pngEPI512180A/northern shoveler/Mississippi/12OS347/2012 (A/H7N7) segment 4 (HA)2743.40.000000e+001617/1683 (96%)
text_code_colored.pngEPI487317A/turkey/Minnesota/32710/2011 (A/H7N9) segment 4 (HA)2743.40.000000e+001618/1684 (96%)
text_code_colored.pngEPI487309A/turkey/Minnesota/31900/2011 (A/H7N9) segment 4 (HA)2743.40.000000e+001618/1684 (96%)
text_code_colored.pngEPI689773A/mallard/Nebraska/A00709657/2009 (A/H7N3) segment 4 (HA)2737.90.000000e+001617/1684 (96%)
text_code_colored.pngEPI689619A/blue winged teal/South Dakota/A00772794/2009 (A/H7N7) segment 4 (HA)2737.90.000000e+001616/1683 (96%)
text_code_colored.pngEPI512299A/northern shoveler/Arkansas/12OS158/2012 (A/H7N1) segment 4 (HA)2737.90.000000e+001616/1683 (96%)
text_code_colored.pngEPI569396A/blue-winged teal/LA/AI11-2911/2011 (A/H7N3) segment 4 (HA)2736.00.000000e+001610/1675 (96%)
text_code_colored.pngEPI689831A/mallard/New Jersey/A00926089/2010 (A/H7N3) segment 4 (HA)2732.30.000000e+001615/1683 (95%)
text_code_colored.pngEPI616382A/northern shoveler/Illinois/12OS4951/2012 (A/H7N3) segment 4 (HA)2732.30.000000e+001615/1683 (95%)
text_code_colored.pngEPI463745A/mallard/Minnesota/AI09-1714/2009 (A/H7N1) segment 4 (HA)2728.60.000000e+001614/1683 (95%)
text_code_colored.pngEPI689769A/mallard/Iowa/A00558620/2008 (A/H7N3) segment 4 (HA)2726.80.000000e+001615/1684 (95%)
text_code_colored.pngEPI689688A/blue winged teal/Texas/A00605473/2009 (A/H7N3) segment 4 (HA)2726.80.000000e+001614/1683 (95%)
text_code_colored.pngEPI689550A/American green winged teal/Texas/A00604814/2009 (A/H7N3) segment 4 (HA)2726.80.000000e+001614/1683 (95%)
text_code_colored.pngEPI689549A/American green winged teal/Texas/A00604032/2009 (A/H7N3) segment 4 (HA)2726.80.000000e+001614/1683 (95%)
text_code_colored.pngEPI689546A/American green winged teal/Texas/A00604024/2009 (A/H7N3) segment 4 (HA)2726.80.000000e+001614/1683 (95%)
text_code_colored.pngEPI434477A/mallard/Nova Scotia/00372/2010 (A/H7N7) segment 4 (HA)2726.80.000000e+001614/1683 (95%)
text_code_colored.pngEPI434430A/American black duck/New Brunswick/00344/2010 (A/H7N7) segment 4 (HA)2726.80.000000e+001614/1683 (95%)
text_code_colored.pngEPI418896A/common goldeneye/Wisconsin/10OS4202/2010 (A/H7N6) segment 4 (HA)2726.80.000000e+001614/1683 (95%)
text_code_colored.pngEPI689707A/blue winged teal/Texas/A00676566/2009 (A/H7N3) segment 4 (HA)2721.20.000000e+001613/1683 (95%)
text_code_colored.pngEPI689522A/American green winged teal/Mississippi/A00468514/2009 (A/H7N7) segment 4 (HA)2721.20.000000e+001613/1683 (95%)
text_code_colored.pngEPI526461A/American green-winged teal/Wisconsin/13OS3468/2013 (A/H7N3) segment 4 (HA)2721.20.000000e+001613/1683 (95%)
text_code_colored.pngEPI434481A/green-winged teal/New Brunswick/00392/2010 (A/H7N7) segment 4 (HA)2721.20.000000e+001613/1683 (95%)
text_code_colored.pngEPI689547A/American green winged teal/Texas/A00604029/2009 (A/H7N3) segment 4 (HA)2715.70.000000e+001612/1683 (95%)
text_code_colored.pngEPI616037A/northern shoveler/Ohio/12OS5539/2012 (A/H7N3) segment 4 (HA)2704.60.000000e+001610/1683 (95%)
text_code_colored.pngEPI616030A/American green-winged teal/Ohio/12OS5538/2012 (A/H7N3) segment 4 (HA)2699.10.000000e+001609/1683 (95%)
text_code_colored.pngEPI645360A/American green-winged teal/Ohio/13OS1769/2013 (A/H7N2) segment 4 (HA)2688.00.000000e+001608/1684 (95%)
text_code_colored.pngEPI645353A/blue-winged teal/Ohio/13OS1770/2013 (A/H7N3) segment 4 (HA)2688.00.000000e+001608/1684 (95%)
text_code_colored.pngEPI526457A/blue-winged teal/Ohio/13OS1773/2013 (A/H7N3) segment 4 (HA)2688.00.000000e+001608/1684 (95%)
text_code_colored.pngEPI526270A/American green-winged teal/Ohio/13OS1777/2013 (A/H7N3) segment 4 (HA)2688.00.000000e+001608/1684 (95%)
text_code_colored.pngEPI487934A/turkey/Minnesota/20400/2009 (A/H7N9) segment 4 (HA)2688.00.000000e+001608/1684 (95%)
text_code_colored.pngEPI487926A/turkey/Minnesota/18421/2009 (A/H7N9) segment 4 (HA)2688.00.000000e+001608/1684 (95%)
text_code_colored.pngEPI487918A/turkey/Minnesota/15591/2009 (A/H7N9) segment 4 (HA)2688.00.000000e+001608/1684 (95%)
text_code_colored.pngEPI487295A/turkey/Minnesota/14135-2/2009 (A/H7N9) segment 4 (HA)2688.00.000000e+001608/1684 (95%)
text_code_colored.pngEPI333728A/mallard/Missouri/220/2009 (A/H7N3) segment 4 (HA)2688.00.000000e+001607/1683 (95%)
text_code_colored.pngEPI690004A/northern pintail/Texas/A00466052/2009 (A/H7N3) segment 4 (HA)2682.50.000000e+001607/1684 (95%)
text_code_colored.pngEPI689871A/mallard/Oklahoma/A00744383/2009 (A/H7N3) segment 4 (HA)2682.50.000000e+001606/1683 (95%)
text_code_colored.pngEPI689771A/mallard/Michigan/A00869519/2009 (A/H7N3) segment 4 (HA)2682.50.000000e+001606/1683 (95%)
text_code_colored.pngEPI689739A/mallard/Illinois/A00325439/2009 (A/H7N3) segment 4 (HA)2682.50.000000e+001606/1683 (95%)
text_code_colored.pngEPI414400A/northern pintail/Interior Alaska/10BM02539R0/2010 (A/H7N3) segment 4 (HA)2682.50.000000e+001607/1684 (95%)
text_code_colored.pngEPI690010A/northern shoveler/Oklahoma/A00744384/2009 (A/H7N3) segment 4 (HA)2676.90.000000e+001605/1683 (95%)
text_code_colored.pngEPI689838A/mallard/Oklahoma/A00749161/2009 (A/H7N3) segment 4 (HA)2676.90.000000e+001605/1683 (95%)
text_code_colored.pngEPI689767A/mallard/Illinois/A00755320/2009 (A/H7N3) segment 4 (HA)2676.90.000000e+001605/1683 (95%)
text_code_colored.pngEPI616996A/mallard/Alberta/192/2010 (A/H7N3) segment 4 (HA)2676.90.000000e+001606/1684 (95%)
text_code_colored.pngEPI616983A/mallard/Alberta/167/2010 (A/H7N3) segment 4 (HA)2676.90.000000e+001606/1684 (95%)
text_code_colored.pngEPI487910A/turkey/Minnesota/14659/2009 (A/H7N9) segment 4 (HA)2676.90.000000e+001606/1684 (95%)
text_code_colored.pngEPI487303A/turkey/Minnesota/31676/2009 (A/H7N9) segment 4 (HA)2676.90.000000e+001607/1685 (95%)
text_code_colored.pngEPI451949A/northern pintail/Interior Alaska/10BM11038R0/2010 (A/H7N3) segment 4 (HA)2676.90.000000e+001605/1683 (95%)
text_code_colored.pngEPI451921A/northern pintail/Interior Alaska/10BM11366R0/2010 (A/H7N3) segment 4 (HA)2676.90.000000e+001605/1683 (95%)
text_code_colored.pngEPI451788A/northern pintail/Interior Alaska/10BM09481R0/2010 (A/H7N3) segment 4 (HA)2676.90.000000e+001605/1683 (95%)
text_code_colored.pngEPI451760A/mallard/Interior Alaska/10BM09539R0/2010 (A/H7N3) segment 4 (HA)2676.90.000000e+001605/1683 (95%)
text_code_colored.pngEPI451753A/mallard/Interior Alaska/10BM09528R0/2010 (A/H7N3) segment 4 (HA)2676.90.000000e+001605/1683 (95%)
 

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI709586A/turkey/Indiana/16-001574-7/2016 (A/H7N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI709578A/turkey/Indiana/16-001573-2/2016 (A/H7N8) segment 6 (NA)2610.40.000000e+001413/1413 (100%)
text_code_colored.pngEPI709570A/turkey/Indiana/16-001403-1/2016 (A/H7N8) segment 6 (NA)2604.90.000000e+001412/1413 (99%)
text_code_colored.pngEPI512876A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 6 (NA)2549.50.000000e+001402/1413 (99%)
text_code_colored.pngEPI512345A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 6 (NA)2549.50.000000e+001402/1413 (99%)
text_code_colored.pngEPI420189A/bufflehead/California/3118/2011 (A/H4N8) segment 6 (NA)2549.50.000000e+001402/1413 (99%)
text_code_colored.pngEPI450000A/lesser scaup/Louisiana/AI09-5204/2009 (A/H6N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)
text_code_colored.pngEPI334350A/bufflehead/Illinois/4016/2009 (A/H4N8) segment 6 (NA)2495.90.000000e+001391/1411 (98%)
text_code_colored.pngEPI154826A/bufflehead/California/HKWF205/2007 (A/H4N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)
text_code_colored.pngEPI418544A/mallard/Wisconsin/10OS3166/2010 (A/H0) segment 6 (NA)2453.50.000000e+001384/1412 (98%)
text_code_colored.pngEPI342994A/mallard/Alberta/507/2008 (A/H3N8) segment 6 (NA)2449.80.000000e+001384/1413 (97%)
text_code_colored.pngEPI513050A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 6 (NA)2436.90.000000e+001381/1412 (97%)
text_code_colored.pngEPI596199A/mallard/Maryland/13OS3020/2014 (A/H6N8) segment 6 (NA)2433.20.000000e+001381/1413 (97%)
text_code_colored.pngEPI234231A/blue-winged teal/North Dakota/Sg-00704/2008 (A/H3N8) segment 6 (NA)2429.50.000000e+001361/1384 (98%)
text_code_colored.pngEPI526433A/American green-winged teal/Ohio/13OS2094/2013 (A/H6N8) segment 6 (NA)2427.60.000000e+001380/1413 (97%)
text_code_colored.pngEPI615867A/willet/Peru-CH49/2010 (A/H6N8) segment 6 (NA)2425.80.000000e+001379/1412 (97%)
text_code_colored.pngEPI526391A/American green-winged teal/Ohio/13OS1781/2013 (A/H6N8) segment 6 (NA)2422.10.000000e+001379/1413 (97%)
text_code_colored.pngEPI526333A/American green-winged teal/Ohio/13OS2060/2013 (A/H6N8) segment 6 (NA)2422.10.000000e+001379/1413 (97%)
text_code_colored.pngEPI448654A/blue-winged teal/North Dakota/Sg-00719/2008 (A/H3N8) segment 6 (NA)2422.10.000000e+001379/1413 (97%)
text_code_colored.pngEPI234233A/blue-winged teal/North Dakota/Sg-00707/2008 (A/H4N8) segment 6 (NA)2420.20.000000e+001364/1391 (98%)
text_code_colored.pngEPI645418A/American green-winged teal/Ohio/13OS1840/2013 (A/H6N8) segment 6 (NA)2416.50.000000e+001378/1413 (97%)
text_code_colored.pngEPI343441A/mallard/Alberta/212/2006 (A/H3N8) segment 6 (NA)2416.50.000000e+001378/1413 (97%)
text_code_colored.pngEPI227374A/northern pintail/Alberta/11701/2005 (A/H3N8) segment 6 (NA)2411.00.000000e+001377/1413 (97%)
text_code_colored.pngEPI615874A/egret/Peru-CH50/2010 (A/H6N8) segment 6 (NA)2407.30.000000e+001369/1402 (97%)
text_code_colored.pngEPI343677A/mallard/Alberta/241/2004 (A/H3N8) segment 6 (NA)2405.50.000000e+001376/1413 (97%)
text_code_colored.pngEPI298668A/mallard/Interior Alaska/6MP0951/2006 (A/H3N8) segment 6 (NA)2405.50.000000e+001376/1413 (97%)
text_code_colored.pngEPI449527A/mallard/Minnesota/Sg-00860/2008 (A/H0) segment 6 (NA)2399.90.000000e+001376/1414 (97%)
text_code_colored.pngEPI343283A/mallard/Alberta/28/2007 (A/H3N8) segment 6 (NA)2399.90.000000e+001375/1413 (97%)
text_code_colored.pngEPI343275A/mallard/Alberta/34/2007 (A/H3N8) segment 6 (NA)2399.90.000000e+001375/1413 (97%)
text_code_colored.pngEPI343127A/mallard/Alberta/284/2007 (A/H0) segment 6 (NA)2399.90.000000e+001375/1413 (97%)
text_code_colored.pngEPI343043A/blue-winged teal/Alberta/387/2007 (A/H3N8) segment 6 (NA)2394.40.000000e+001374/1413 (97%)
text_code_colored.pngEPI298732A/mallard/Interior Alaska/6MP0972R1/2006 (A/H3N8) segment 6 (NA)2394.40.000000e+001374/1413 (97%)
text_code_colored.pngEPI298636A/mallard/Interior Alaska/6MP0272/2006 (A/H3N8) segment 6 (NA)2394.40.000000e+001374/1413 (97%)
text_code_colored.pngEPI298500A/green-winged teal/Interior Alaska/6MP0736/2006 (A/H3N8) segment 6 (NA)2394.40.000000e+001374/1413 (97%)
text_code_colored.pngEPI343452A/mallard/Alberta/190/2006 (A/H0) segment 6 (NA)2388.80.000000e+001373/1413 (97%)
text_code_colored.pngEPI343291A/mallard/Alberta/27/2007 (A/H3N8) segment 6 (NA)2388.80.000000e+001373/1413 (97%)
text_code_colored.pngEPI221422A/American green-winged teal/Interior Alaska/4/2007 (A/H3N8) segment 6 (NA)2388.80.000000e+001373/1413 (97%)
text_code_colored.pngEPI699696A/American green-winged teal/Interior Alaska/11BM03897/2011 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI699630A/American green-winged teal/Interior Alaska/11BM03657/2011 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI299575A/northern pintail/Interior Alaska/7MP0509/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI299060A/northern pintail/Interior Alaska/7MP2228/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI296892A/northern shoveler/Interior Alaska/7MP1765/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI263358A/mallard/Minnesota/Sg-00064/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI263094A/blue-winged teal/Minnesota/Sg-00037/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI222187A/mallard/Interior Alaska/2/2007 (A/H3N8) segment 6 (NA)2383.30.000000e+001372/1413 (97%)
text_code_colored.pngEPI234236A/blue-winged teal/North Dakota/Sg-00719/2008 (A/H3N8) segment 6 (NA)2379.60.000000e+001356/1390 (97%)
text_code_colored.pngEPI449681A/ring-necked duck/Minnesota/Sg-01066/2008 (A/H12N8) segment 6 (NA)2377.80.000000e+001372/1414 (97%)
text_code_colored.pngEPI449478A/mallard/Minnesota/Sg-00824/2008 (A/H0) segment 6 (NA)2377.80.000000e+001372/1414 (97%)
text_code_colored.pngEPI343109A/mallard/Alberta/318/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI342942A/mallard/Alberta/551/2009 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI299044A/northern pintail/Interior Alaska/7MP1822/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001372/1414 (97%)
text_code_colored.pngEPI296957A/American widgeon/Interior Alaska/7MP1707/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI296900A/northern shoveler/Interior Alaska/7MP0944/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI283597A/surface water/Minnesota/W07-2241/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263398A/ring-necked duck/Minnesota/Sg-00069/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263334A/mallard/Minnesota/Sg-00061/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263262A/mallard/Minnesota/Sg-00051/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263238A/mallard/Minnesota/Sg-00048/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263230A/mallard/Minnesota/Sg-00047/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI263206A/gadwall/Minnesota/Sg-00044/2007 (A/H3N8) segment 6 (NA)2377.80.000000e+001371/1413 (97%)
text_code_colored.pngEPI178641A/northern shoveler/Interior Alaska/3/2007 (A/H3N8) segment 6 (NA)2374.10.000000e+001369/1411 (97%)
text_code_colored.pngEPI595705A/mallard/Maryland/08OS3097/2008 (A/H10N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI442452A/greater white-fronted goose/Alaska/44299-055/2007 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI299204A/green-winged teal/Interior Alaska/8BM3706/2008 (A/H0) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI299196A/northern pintail/Interior Alaska/8BM3700/2008 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI225292A/mallard/Washington/20010-002/2006 (A/H3N8) segment 6 (NA)2372.20.000000e+001370/1413 (96%)
text_code_colored.pngEPI442451A/greater white-fronted goose/Alaska/44299-054/2007 (A/H3N8) segment 6 (NA)2370.40.000000e+001369/1412 (96%)
text_code_colored.pngEPI699131A/mallard/Interior Alaska/12ML00098/2012 (A/H3N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI450043A/mallard/Arkansas/AI09-5944/2009 (A/H4N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI449987A/blue-winged teal/Texas/AI09-4463/2009 (A/H4N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI418513A/ruddy duck/Wisconsin/10OS3191/2010 (A/H3N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI343315A/mallard/Alberta/279/2006 (A/H3N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI342923A/pintail/Alberta/207/1999 (A/H0) segment 6 (NA)2366.70.000000e+001370/1414 (96%)
text_code_colored.pngEPI328504A/bufflehead/California/8522/2008 (A/H4N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI263318A/mallard/Minnesota/Sg-00059/2007 (A/H3N8) segment 6 (NA)2366.70.000000e+001369/1413 (96%)
text_code_colored.pngEPI87760A/pintail/Alberta/207/1999 (A/H4N8) segment 6 (NA)2366.70.000000e+001370/1414 (96%)
text_code_colored.pngEPI450037A/mallard/Arkansas/AI09-5900/2009 (A/H3N8) segment 6 (NA)2361.10.000000e+001368/1413 (96%)
text_code_colored.pngEPI449786A/mallard/Minnesota/AI09-2571/2009 (A/H3N8) segment 6 (NA)2361.10.000000e+001369/1414 (96%)
text_code_colored.pngEPI402982A/mallard/Alberta/215/1999 (A/H0) segment 6 (NA)2361.10.000000e+001369/1414 (96%)
text_code_colored.pngEPI328645A/mallard/California/11032/2008 (A/H0N8) segment 6 (NA)2361.10.000000e+001368/1413 (96%)
text_code_colored.pngEPI526445A/American green-winged teal/Ohio/13OS2108/2013 (A/H3N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI526376A/blue-winged teal/Ohio/13OS2018/2013 (A/H3N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI449809A/blue-winged Teal/Minnesota/AI09-2977/2009 (A/H4N8) segment 6 (NA)2355.60.000000e+001368/1414 (96%)
text_code_colored.pngEPI448667A/mallard/North Dakota/Sg-00737/2008 (A/H6N8) segment 6 (NA)2355.60.000000e+001368/1414 (96%)
text_code_colored.pngEPI437063A/northern pintail/Interior Alaska/9BM12153R0/2009 (A/H4N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI328590A/northern shoveler/California/9235/2008 (A/H10N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI290783A/teal/Oregon/44336-130/2007 (A/H3N8) segment 6 (NA)2355.60.000000e+001367/1413 (96%)
text_code_colored.pngEPI290577A/northern pintail/Oregon/44249-559/2006 (A/H3N8) segment 6 (NA)2355.60.000000e+001368/1414 (96%)
text_code_colored.pngEPI290775A/American green-winged teal/Oregon/44336-124/2007 (A/H3N8) segment 6 (NA)2353.80.000000e+001357/1398 (97%)
text_code_colored.pngEPI526340A/American green-winged teal/Ohio/13OS2106/2013 (A/H3N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI448479A/mallard/Minnesota/346256/2000 (A/H0) segment 6 (NA)2350.10.000000e+001368/1415 (96%)
text_code_colored.pngEPI387233A/mallard/California/3188/2010 (A/H6N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI344280A/lesser scaup/Alberta/206/1995 (A/H3N8) segment 6 (NA)2350.10.000000e+001367/1414 (96%)
text_code_colored.pngEPI298956A/American wigeon/Interior Alaska/7MP1726/2007 (A/H3N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI296973A/mallard/Interior Alaska/7MP1700/2007 (A/H3N8) segment 6 (NA)2350.10.000000e+001366/1413 (96%)
text_code_colored.pngEPI238106A/mallard/Minnesota/448/2000 (A/H3N8) segment 6 (NA)2350.10.000000e+001368/1415 (96%)
text_code_colored.pngEPI442450A/greater white-fronted goose/Alaska/44299-002/2007 (A/H3N8) segment 6 (NA)2346.40.000000e+001354/1396 (96%)
text_code_colored.pngEPI512948A/American green-winged teal/Illinois/11OS4814/2011 (A/H3N8) segment 6 (NA)2344.50.000000e+001365/1413 (96%)
text_code_colored.pngEPI238511A/mallard/Minnesota/190/1999 (A/H3N8) segment 6 (NA)2344.50.000000e+001367/1415 (96%)
text_code_colored.pngEPI222337A/northern pintail/Alaska/7MP0508/2007 (A/H3N8) segment 6 (NA)2344.50.000000e+001365/1413 (96%)
 

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI709587A/turkey/Indiana/16-001574-7/2016 (A/H7N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI709579A/turkey/Indiana/16-001573-2/2016 (A/H7N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI709571A/turkey/Indiana/16-001403-1/2016 (A/H7N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI616384A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI513049A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI512344A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI512875A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI420188A/bufflehead/California/3118/2011 (A/H4N8) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI689817A/mallard/Nebraska/A00709657/2009 (A/H7N3) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI689575A/American green winged teal/Texas/A00604814/2009 (A/H7N3) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI689568A/American green winged teal/Texas/A00604032/2009 (A/H7N3) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI689561A/American green winged teal/Texas/A00604029/2009 (A/H7N3) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI689548A/American green winged teal/Texas/A00604024/2009 (A/H7N3) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI449999A/lesser scaup/Louisiana/AI09-5204/2009 (A/H6N8) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI690043A/northern shoveler/Mississippi/A00682947/2008 (A/H7N7) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI419526A/American green-winged teal/Mississippi/11OS256/2011 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI689700A/blue winged teal/Texas/A00605473/2009 (A/H7N3) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI689645A/blue winged teal/Louisiana/A00557206/2009 (A/H7N7) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI418971A/mallard/Wisconsin/10OS3169/2010 (A/H4N9) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI376067A/mallard/California/1475/2010 (A/H3N8) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI327661A/mallard/California/1156/2010 (A/H4N6) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI689789A/mallard/Iowa/A00558620/2008 (A/H7N3) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI689689A/blue winged teal/Texas/A00676566/2009 (A/H7N3) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI616847A/blue-winged teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI449901A/blue-winged Teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI449736A/mallard/Minnesota/AI09-1867/2009 (A/H8N4) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI449729A/mallard/Minnesota/AI09-1854/2009 (A/H8N4) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI449722A/mallard/Minnesota/AI09-1833/2009 (A/H8N4) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI435155A/American black duck/New Brunswick/00867/2010 (A/H5N2) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI398693A/mallard/California/1154/2010 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI387273A/mallard/California/1297/2010 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI327669A/mallard/California/1154/2010 (A/H0) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI327653A/mallard/California/1210/2010 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI327637A/mallard/California/1188/2010 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI689833A/mallard/New York/A00723392/2009 (A/H7N3) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI689659A/blue winged teal/Minnesota/A00137660/2009 (A/H7N3) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI689487A/American black duck/Delaware/A00870108/2010 (A/H7N3) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512992A/mallard/Wisconsin/11OS3092/2011 (A/H3N2) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512985A/mallard/Wisconsin/11OS3079/2011 (A/H3N2) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512964A/mallard/Illinois/11OS5582/2011 (A/H1N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512947A/American green-winged teal/Illinois/11OS4814/2011 (A/H3N8) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512919A/mallard/Wisconsin/11OS3106/2011 (A/H3N2) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476339A/blue-winged teal/Canada/3240/2011 (A/H4N6) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476272A/blue-winged teal/Canada/3241/2011 (A/H4N6) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476265A/blue-winged teal/Canada/3239/2011 (A/H4N6) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476258A/blue-winged teal/Canada/3237/2011 (A/H4N6) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476213A/thick-billed murre/Canada/1871/2011 (A/H1N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476150A/common eider/Maine/270/2011 (A/H1N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476143A/mallard/Maine/202/2011 (A/H1N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476123A/bufflehead/Maine/161/2011 (A/H1N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI449328A/mallard/Minnesota/Sg-00804/2008 (A/H3N8) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI419167A/mallard/Wisconsin/10OS3866/2010 (A/H3N6) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI331963A/blue-winged teal/Guatemala/CIP049-06/2010 (A/H8N4) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI331955A/blue-winged teal/Guatemala/CIP049-12/2010 (A/H5N4) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI331947A/blue-winged teal/Guatemala/CIP049-13/2010 (A/H5N4) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI331939A/blue-winged teal/Guatemala/CIP049-14/2010 (A/H8N4) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI331915A/blue-winged teal/Guatemala/CIP049-15/2010 (A/H8N4) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI616449A/blue-winged teal/Illinois/12OS4788/2012 (A/H1N1) segment 7 (MP)1725.90.000000e+00966/982 (98%)
text_code_colored.pngEPI463748A/mallard/Minnesota/AI09-1714/2009 (A/H7N1) segment 7 (MP)1725.90.000000e+00966/982 (98%)
text_code_colored.pngEPI419062A/American green-winged teal/Wisconsin/10OS2955/2010 (A/H5N2) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI419055A/mallard/Wisconsin/10OS2945/2010 (A/H0) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI327629A/mallard/California/1289/2010 (A/H4N6) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI328420A/northern pintail/California/6495/2008 (A/H6N1) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI699389A/American green-winged teal/Interior Alaska/11BM00293/2011 (A/H10N5) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI699370A/American green-winged teal/Interior Alaska/11BM00304/2011 (A/H10N5) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI512209A/American green-winged teal/Mississippi/12OS405/2012 (A/H10N7) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI420253A/mallard/California/3569/2010 (A/H1N3) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI328317A/mallard/California/6420/2008 (A/H6N2) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI299195A/northern pintail/Interior Alaska/8BM3700/2008 (A/H3N8) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI220470A/env/California/7279/2008 (A/H2N3) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI159708A/turkey/CA/358533/2005 (A/H4N8) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI645489A/American green-winged teal/Wisconsin/13OS3465/2013 (A/H6N8) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI616170A/blue-winged teal/Ohio/12OS2138/2012 (A/H10N9) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI512233A/mallard/Arkansas/12OS184/2012 (A/H10N7) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI454938A/ruddy turnstone/New Jersey/AI06-582/2006 (A/H6N7) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI450079A/red-necked grebe/Minnesota/AI10-2530/2010 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI450071A/red-necked grebe/Minnesota/AI10-2529/2010 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI442481A/spectacled eider/Alaska/44173-055/2006 (A/H3N8) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI419704A/American wigeon/Missouri/10MO0530/2010 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI418727A/American green-winged teal/Wisconsin/10OS2767/2010 (A/H6N8) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI376081A/northern shoveler/California/3185/2010 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI369979A/mallard/Alberta/297/2007 (A/H2N9) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI334380A/mallard/Illinois/3048/2009 (A/H11N2) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI333743A/northern shovelerMissouri/141/2009 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI333607A/American green-winged teal/Mississippi/404/2010 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI300071A/northern pintail/Interior Alaska/8BM3696/2008 (A/H3N8) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI300064A/northern shoveler/Interior Alaska/8BM3671/2008 (A/H4N1) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI299727A/northern pintail/Interior Alaska/8BM3723/2008 (A/H4N1) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI299452A/northern shoveler/Mississippi/09OS643/2009 (A/H7N7) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI299203A/green-winged teal/Interior Alaska/8BM3706/2008 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI299027A/duck/Interior Alaska/7MP1582/2007 (A/H1N1) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI298340A/blue-winged teal/Louisiana/Sg-00189/2007 (A/H3N6) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI292834A/bufflehead/California/JN1016/2006 (A/H2N9) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI290758A/American green-winged teal/California/44287-395/2007 (A/H8N3) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI290696A/northern shoveler/Washington/44249-731/2006 (A/H10N7) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI280527A/mallard/Idaho/455398-2/2006 (A/H5N2) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI280519A/mallard/Washington/456277-7/2006 (A/H5N2) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI263207A/gadwall/Minnesota/Sg-00044/2007 (A/H3N8) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI225343A/pintail/Alberta/21/2006 (A/H1N1) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI220501A/env/California/7335/2008 (A/H2N3) segment 7 (MP)1703.70.000000e+00962/982 (97%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI709581A/turkey/Indiana/16-001574-7/2016 (A/H7N8) segment 1 (PB2)4211.50.000000e+002280/2280 (100%)
text_code_colored.pngEPI709573A/turkey/Indiana/16-001573-2/2016 (A/H7N8) segment 1 (PB2)4189.30.000000e+002276/2280 (99%)
text_code_colored.pngEPI709565A/turkey/Indiana/16-001403-1/2016 (A/H7N8) segment 1 (PB2)4189.30.000000e+002276/2280 (99%)
text_code_colored.pngEPI616237A/blue-winged teal/Ohio/12OS2106/2012 (A/H4N6) segment 1 (PB2)4073.00.000000e+002255/2280 (98%)
text_code_colored.pngEPI418607A/northern shoveler/Arkansas/11OS333/2011 (A/H0) segment 1 (PB2)4039.70.000000e+002249/2280 (98%)
text_code_colored.pngEPI263193A/blue-winged teal/Texas/Sg-00081/2007 (A/H4N6) segment 1 (PB2)4039.70.000000e+002249/2280 (98%)
text_code_colored.pngEPI512780A/mallard/Wisconsin/11OS3407/2011 (A/H4N9) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI298321A/mallard/Minnesota/Sg-00220/2007 (A/H6N1) segment 1 (PB2)4028.70.000000e+002247/2280 (98%)
text_code_colored.pngEPI513061A/mallard/Wisconsin/11OS3577/2011 (A/H6N5) segment 1 (PB2)4023.10.000000e+002246/2280 (98%)
text_code_colored.pngEPI513029A/blue-winged teal/Iowa/44555-551/2011 (A/H3N2) segment 1 (PB2)4023.10.000000e+002246/2280 (98%)
text_code_colored.pngEPI403280A/northern pintail/Alberta/3/2009 (A/H0) segment 1 (PB2)4023.10.000000e+002246/2280 (98%)
text_code_colored.pngEPI449885A/blue-winged Teal/Minnesota/AI09-3575/2009 (A/H4N8) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI449783A/mallard/Minnesota/AI09-2519/2009 (A/H3N6) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI435864A/mallard/Alberta/91/2007 (A/H1N5) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI334157A/American green-winged teal/Illinois/3053/2009 (A/H0) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI327703A/mallard/California/5351/2009 (A/H1N1) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI298202A/mallard/Minnesota/Sg-00214/2007 (A/H6N1) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI298138A/mallard/Minnesota/Sg-00182/2007 (A/H6N1) segment 1 (PB2)4017.60.000000e+002246/2281 (98%)
text_code_colored.pngEPI284098A/green-winged teal/Minnesota/Sg-00197/2007 (A/H6N8) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI263185A/blue-winged teal/Texas/Sg-00080/2007 (A/H4N6) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI263145A/blue-winged teal/Texas/Sg-00075/2007 (A/H4N6) segment 1 (PB2)4017.60.000000e+002245/2280 (98%)
text_code_colored.pngEPI333581A/mallard/Mississippi/413/2010 (A/H1N1) segment 1 (PB2)4012.00.000000e+002244/2280 (98%)
text_code_colored.pngEPI298122A/mallard/Minnesota/Sg-00167/2007 (A/H6N1) segment 1 (PB2)4012.00.000000e+002238/2271 (98%)
text_code_colored.pngEPI154574A/northern shoveler/California/HKWF1370/2007 (A/H10N3) segment 1 (PB2)4012.00.000000e+002245/2281 (98%)
text_code_colored.pngEPI449997A/blue-winged teal/Louisiana/AI09-5159/2009 (A/H3N8) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI449964A/northern pintail/Minnesota/AI09-4322/2009 (A/H3N8) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI449432A/mallard/Minnesota/Sg-00692/2008 (A/H2N3) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI449285A/northern pintail/North Dakota/Sg-00749/2008 (A/H0) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI342961A/northern pintail/Alberta/8/2009 (A/H3N8) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI333769A/mallard/Illinois/4180/2009 (A/H6N1) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI328351A/environment/California/7810/2008 (A/H4N6) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI290812A/mallard/Washington/44338-362/2007 (A/H11N9) segment 1 (PB2)4006.50.000000e+002243/2280 (98%)
text_code_colored.pngEPI449412A/mallard/Minnesota/Sg-00672/2008 (A/H3N8) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI449320A/blue-winged teal/Minnesota/Sg-00787/2008 (A/H3N8) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI448578A/mallard/Minnesota/Sg-00571/2008 (A/H0) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI418783A/American green-winged teal/Illinois/10OS3343/2010 (A/H2N3) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI342989A/mallard/Alberta/507/2008 (A/H3N8) segment 1 (PB2)4001.00.000000e+002242/2280 (98%)
text_code_colored.pngEPI512200A/northern shoveler/Mississippi/12OS362/2012 (A/H7N7) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI449418A/mallard/Minnesota/Sg-00674/2008 (A/H3N8) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI448671A/mallard/North Dakota/Sg-00737/2008 (A/H6N8) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI447990A/mallard/Arkansas/AI09-5944/2009 (A/H4N8) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI418970A/mallard/Wisconsin/10OS3144/2010 (A/H6N1) segment 1 (PB2)3995.40.000000e+002241/2280 (98%)
text_code_colored.pngEPI616168A/American green-winged teal/Ohio/12OS2137/2012 (A/H4N6) segment 1 (PB2)3989.90.000000e+002241/2281 (98%)
text_code_colored.pngEPI614546A/blue winged-teal/Wisconsin/12OS4239/2012 (A/H3N2) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI595926A/mallard/Maryland/09OS254/2009 (A/H1N1) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI512298A/mallard/Arkansas/12OS140/2012 (A/H11N3) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI512245A/American green-winged teal/Mississippi/12OS191/2012 (A/H5N3) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI451652A/mallard/Interior Alaska/10BM07575R0/2010 (A/H7N3) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI449292A/blue-winged teal/North Dakota/Sg-00750/2008 (A/H4N6) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI420088A/mallard/California/2584V/2011 (A/H4N9) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI419815A/mallard/California/2532V/2011 (A/H4N6) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI419659A/gadwall/Missouri/10MO0280/2010 (A/H5N2) segment 1 (PB2)3989.90.000000e+002240/2280 (98%)
text_code_colored.pngEPI333785A/mallard/Illinois/4162/2009 (A/H11N2) segment 1 (PB2)3989.90.000000e+002241/2281 (98%)
text_code_colored.pngEPI435836A/mallard/Alberta/128/2006 (A/H1N1) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI420129A/mallard/California/2594V/2011 (A/H4N6) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI420122A/mallard/California/2594P/2011 (A/H4N6) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI420115A/mallard/California/2590V/2011 (A/H4N6) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI420081A/mallard/California/2584P/2011 (A/H4N9) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI418864A/mallard/Wisconsin/10OS2667/2010 (A/H11N9) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI418826A/northern shoveler/Illinois/10OS3619/2010 (A/H11N9) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI296761A/mallard/Alberta/128/2006 (A/H1N1) segment 1 (PB2)3984.30.000000e+002239/2280 (98%)
text_code_colored.pngEPI166118A/mallard/Minnesota/Sg-00169/2007 (A/H3N8) segment 1 (PB2)3984.30.000000e+002217/2247 (98%)
text_code_colored.pngEPI298233A/mallard/Minnesota/Sg-00223/2007 (A/H6N1) segment 1 (PB2)3982.50.000000e+002221/2253 (98%)
text_code_colored.pngEPI616314A/northern shoveler/Illinois/12OS4951/2012 (A/H7N3) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI512342A/mallard/Wisconsin/11OS4493/2011 (A/H1N3) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI468388A/mallard/Missouri/466554-14/2007 (A/H1N1) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI453954A/mallard/Interior Alaska/10BM11311R0/2010 (A/H3N8) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI449713A/mallard/Minnesota/AI09-1684/2009 (A/H1N1) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI449706A/mallard/Minnesota/AI09-1678/2009 (A/H1N1) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI449514A/green-winged teal/Minnesota/Sg-00841/2008 (A/H0) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI449362A/mallard/Minnesota/SG-00932/2008 (A/H6N1) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI419143A/northern shoveler/Mississippi/10OS4526/2010 (A/H6N2) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI419116A/gadwall/Mississippi/10OS4531/2010 (A/H6N2) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI333881A/blue-winged teal/Wisconsin/2649/2009 (A/H6N1) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI299482A/gadwall/Wisconsin/08OS2296/2008 (A/H6N2) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI188187A/mallard/Minnesota/Sg-00462/2008 (A/H6N1) segment 1 (PB2)3978.80.000000e+002238/2280 (98%)
text_code_colored.pngEPI188713A/mallard/Minnesota/Sg-00692/2008 (A/H2N3) segment 1 (PB2)3977.00.000000e+002225/2261 (98%)
text_code_colored.pngEPI154747A/mallard duck/Minnesota/Sg-00105/2007 (A/H6N1) segment 1 (PB2)3977.00.000000e+002215/2246 (98%)
text_code_colored.pngEPI154715A/blue-winged teal/Texas/Sg-00081/2007 (A/H4N6) segment 1 (PB2)3977.00.000000e+002215/2246 (98%)
text_code_colored.pngEPI689545A/American green winged teal/Texas/A00586649/2009 (A/H7N3) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI689521A/American green winged teal/Colorado/A00660616/2008 (A/H7N3) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI442129A/emperor goose/Alaska/44300-287/2007 (A/H1N2) segment 1 (PB2)3973.30.000000e+002224/2261 (98%)
text_code_colored.pngEPI420143A/mallard/California/2595V/2011 (A/H12N5) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI420136A/mallard/California/2595P/2011 (A/H12N5) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI419808A/mallard/California/2531V/2011 (A/H5N1) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI419759A/northern shoveler/California/2815/2011 (A/H5N2) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI419525A/American green-winged teal/Mississippi/11OS255/2011 (A/H7N7) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI418556A/northern pintail/Mississippi/10OS4521/2010 (A/H0) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI413395A/mallard/Ohio/10OS1470/2010 (A/H3N2) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI413388A/mallard/Ohio/10OS1469/2010 (A/H3N2) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI387293A/mallard/California/1335-1/2010 (A/H10) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI387286A/mallard/California/1335/2010 (A/H10) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI333825A/gadwall/Illinois/3860/2009 (A/H6N1) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI328854A/Stellers eider/Alaska/44354-356/2007 (A/H3N6) segment 1 (PB2)3973.30.000000e+002215/2247 (98%)
text_code_colored.pngEPI328852A/Stellers eider/Alaska/44354-353/2007 (A/H3N6) segment 1 (PB2)3973.30.000000e+002215/2247 (98%)
text_code_colored.pngEPI328851A/Stellers eider/Alaska/44354-352/2007 (A/H3N6) segment 1 (PB2)3973.30.000000e+002215/2247 (98%)
text_code_colored.pngEPI328528A/American wigeon/California/8547/2008 (A/H6N1) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI328231A/mallard/California/8293/2008 (A/H6N1) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI328191A/mallard/California/8432/2008 (A/H6N1) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)
text_code_colored.pngEPI188155A/northern pintail/South Dakota/Sg-00454/2008 (A/H6N5) segment 1 (PB2)3973.30.000000e+002237/2280 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI709582A/turkey/Indiana/16-001574-7/2016 (A/H7N8) segment 2 (PB1)4200.40.000000e+002274/2274 (100%)
text_code_colored.pngEPI709574A/turkey/Indiana/16-001573-2/2016 (A/H7N8) segment 2 (PB1)4178.20.000000e+002270/2274 (99%)
text_code_colored.pngEPI709566A/turkey/Indiana/16-001403-1/2016 (A/H7N8) segment 2 (PB1)4178.20.000000e+002270/2274 (99%)
text_code_colored.pngEPI616386A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 2 (PB1)4133.90.000000e+002262/2274 (99%)
text_code_colored.pngEPI512213A/American green-winged teal/Mississippi/12OS405/2012 (A/H10N7) segment 2 (PB1)4111.80.000000e+002258/2274 (99%)
text_code_colored.pngEPI512237A/mallard/Arkansas/12OS184/2012 (A/H10N7) segment 2 (PB1)4100.70.000000e+002256/2274 (99%)
text_code_colored.pngEPI616094A/northern shoveler/Ohio/12OS5647/2012 (A/H2N3) segment 2 (PB1)4089.60.000000e+002254/2274 (99%)
text_code_colored.pngEPI526269A/American green-winged teal/Ohio/13OS1777/2013 (A/H7N3) segment 2 (PB1)4078.50.000000e+002252/2274 (99%)
text_code_colored.pngEPI645359A/American green-winged teal/Ohio/13OS1769/2013 (A/H7N2) segment 2 (PB1)4073.00.000000e+002251/2274 (98%)
text_code_colored.pngEPI645352A/blue-winged teal/Ohio/13OS1770/2013 (A/H7N3) segment 2 (PB1)4073.00.000000e+002251/2274 (98%)
text_code_colored.pngEPI616348A/American green-winged teal/Mississippi/12OS5061/2012 (A/H5N2) segment 2 (PB1)4067.40.000000e+002250/2274 (98%)
text_code_colored.pngEPI526456A/blue-winged teal/Ohio/13OS1773/2013 (A/H7N3) segment 2 (PB1)4056.40.000000e+002249/2275 (98%)
text_code_colored.pngEPI542051A/mallard/Idaho/ND0002644/2013 (A/H3N8) segment 2 (PB1)4050.80.000000e+002247/2274 (98%)
text_code_colored.pngEPI419327A/mallard/Illinois/10OS4111/2010 (A/H10N7) segment 2 (PB1)4050.80.000000e+002247/2274 (98%)
text_code_colored.pngEPI451933A/mallard/Interior Alaska/10BM11434R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451912A/northern pintail/Interior Alaska/10BM10906R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451877A/mallard/Interior Alaska/10BM10811R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451870A/northern pintail/Interior Alaska/10BM10809R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451863A/northern pintail/Interior Alaska/10BM10807R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451856A/northern pintail/Interior Alaska/10BM10805R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451849A/northern pintail/Interior Alaska/10BM10801R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451826A/northern pintail/Interior Alaska/10BM10476R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451819A/mallard/Interior Alaska/10BM10324R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451812A/northern pintail/Interior Alaska/10BM10166R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451805A/northern pintail/Interior Alaska/10BM09832R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451798A/mallard/Interior Alaska/10BM09818R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451793A/northern pintail/Interior Alaska/10BM09481R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451751A/northern pintail/Interior Alaska/10BM09348R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451744A/northern pintail/Interior Alaska/10BM09347R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451709A/northern pintail/Interior Alaska/10BM08705R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451674A/mallard/Interior Alaska/10BM08099R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451658A/northern pintail/Interior Alaska/10BM07737R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451644A/mallard/Interior Alaska/10BM07501R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451637A/northern pintail/Interior Alaska/10BM07469R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451630A/northern pintail/Interior Alaska/10BM07458R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451623A/northern pintail/Interior Alaska/10BM07260R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451601A/northern pintail/Interior Alaska/10BM07114R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451594A/northern pintail/Interior Alaska/10BM07106R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451587A/mallard/Interior Alaska/10BM07092R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451580A/mallard/Interior Alaska/10BM07085R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451454A/mallard/Interior Alaska/10BM09141R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436829A/mallard/Interior Alaska/10BM06911R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436822A/mallard/Interior Alaska/10BM06909R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436811A/mallard/Interior Alaska/10BM06905R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436804A/northern pintail/Interior Alaska/10BM06899R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436796A/northern pintail/Interior Alaska/10BM06524R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436666A/mallard/Interior Alaska/10BM05860R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI436575A/mallard/Interior Alaska/10BM05347R0/2010 (A/H7N3) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI432814A/northern pintail/Interior Alaska/10BM06901R0/2010 (A/H0) segment 2 (PB1)4045.30.000000e+002246/2274 (98%)
text_code_colored.pngEPI451961A/mallard/Interior Alaska/10BM12534R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451779A/mallard/Interior Alaska/10BM09563R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451772A/mallard/Interior Alaska/10BM09548R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451765A/mallard/Interior Alaska/10BM09539R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451758A/mallard/Interior Alaska/10BM09528R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451737A/northern pintail/Interior Alaska/10BM09181R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451688A/mallard/Interior Alaska/10BM08120R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451681A/mallard/Interior Alaska/10BM08100R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451615A/northern pintail/Interior Alaska/10BM07121R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451608A/northern pintail/Interior Alaska/10BM07120R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451563A/mallard/Interior Alaska/10BM07072R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451556A/mallard/Interior Alaska/10BM07066R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451549A/northern pintail/Interior Alaska/10BM07029R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI451441A/northern pintail/Interior Alaska/10BM07267R0/2010 (A/H0) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436867A/northern pintail/Interior Alaska/10BM06720R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436793A/northern pintail/Interior Alaska/10BM06895R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436773A/mallard/Interior Alaska/10BM06838R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436679A/northern pintail/Interior Alaska/10BM06306R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI436665A/northern pintail/Interior Alaska/10BM06303R0/2010 (A/H7N3) segment 2 (PB1)4039.70.000000e+002245/2274 (98%)
text_code_colored.pngEPI453953A/mallard/Interior Alaska/10BM11311R0/2010 (A/H3N8) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI453932A/mallard/Interior Alaska/10BM10829R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451919A/northern pintail/Interior Alaska/10BM11208R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451905A/mallard/Interior Alaska/10BM10876R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451898A/mallard/Interior Alaska/10BM10861R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451891A/mallard/Interior Alaska/10BM10859R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451884A/northern pintail/Interior Alaska/10BM10853R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451842A/northern pintail/Interior Alaska/10BM10790R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451833A/mallard/Interior Alaska/10BM10787R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451730A/mallard/Interior Alaska/10BM08884R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451723A/mallard/Interior Alaska/10BM08883R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451716A/mallard/Interior Alaska/10BM08874R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451702A/northern pintail/Interior Alaska/10BM08586R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451695A/northern pintail/Interior Alaska/10BM08400R0/2010 (A/H7N3) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI451666A/northern pintail/Interior Alaska/10BM07821R0/2010 (A/H0) segment 2 (PB1)4034.20.000000e+002244/2274 (98%)
text_code_colored.pngEPI616327A/northern shoveler/Missouri/12OS5755/2012 (A/H10N3) segment 2 (PB1)4028.70.000000e+002243/2274 (98%)
text_code_colored.pngEPI451940A/northern pintail/Interior Alaska/10BM11945R0/2010 (A/H7N3) segment 2 (PB1)4028.70.000000e+002243/2274 (98%)
text_code_colored.pngEPI699707A/mallard/Interior Alaska/11BM03859/2011 (A/H0) segment 2 (PB1)4017.60.000000e+002241/2274 (98%)
text_code_colored.pngEPI699570A/mallard/Interior Alaska/11BM03102/2011 (A/H4N6) segment 2 (PB1)4012.00.000000e+002240/2274 (98%)
text_code_colored.pngEPI512982A/American green-winged teal/Wisconsin/11OS3053/2011 (A/H6N1) segment 2 (PB1)4012.00.000000e+002240/2274 (98%)
text_code_colored.pngEPI419688A/mallard/Missouri/10MO0391/2010 (A/H10N7) segment 2 (PB1)4012.00.000000e+002240/2274 (98%)
text_code_colored.pngEPI614557A/blue winged-teal/Wisconsin/12OS2603/2012 (A/H3N2) segment 2 (PB1)4006.50.000000e+002239/2274 (98%)
text_code_colored.pngEPI542045A/mallard/Idaho/ND0002643/2013 (A/H4N8) segment 2 (PB1)4006.50.000000e+002239/2274 (98%)
text_code_colored.pngEPI699448A/mallard/Interior Alaska/11BM02089/2011 (A/H4N6) segment 2 (PB1)4001.00.000000e+002238/2274 (98%)
text_code_colored.pngEPI542057A/mallard/Idaho/ND0002645/2013 (A/H4N6) segment 2 (PB1)4001.00.000000e+002238/2274 (98%)
text_code_colored.pngEPI512733A/American green-winged teal/Wisconsin/11OS3431/2011 (A/H5N2) segment 2 (PB1)4001.00.000000e+002238/2274 (98%)
text_code_colored.pngEPI700085A/American wigeon/Interior Alaska/11CH00036/2011 (A/H4N6) segment 2 (PB1)3995.40.000000e+002237/2274 (98%)
text_code_colored.pngEPI699647A/mallard/Interior Alaska/11BM03599/2011 (A/H4N6) segment 2 (PB1)3995.40.000000e+002237/2274 (98%)
text_code_colored.pngEPI334243A/mallard/Missouri/350/2009 (A/H11N9) segment 2 (PB1)3995.40.000000e+002238/2275 (98%)
text_code_colored.pngEPI700078A/mallard/Interior Alaska/11CH00019/2011 (A/H4N6) segment 2 (PB1)3989.90.000000e+002237/2275 (98%)
text_code_colored.pngEPI699556A/mallard/Interior Alaska/11BM02987/2011 (A/H2N6) segment 2 (PB1)3989.90.000000e+002236/2274 (98%)
text_code_colored.pngEPI542063A/mallard/Idaho/ND0002646/2013 (A/H4N6) segment 2 (PB1)3989.90.000000e+002236/2274 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI709583A/turkey/Indiana/16-001574-7/2016 (A/H7N8) segment 3 (PA)3973.30.000000e+002151/2151 (100%)
text_code_colored.pngEPI709575A/turkey/Indiana/16-001573-2/2016 (A/H7N8) segment 3 (PA)3967.70.000000e+002150/2151 (99%)
text_code_colored.pngEPI709567A/turkey/Indiana/16-001403-1/2016 (A/H7N8) segment 3 (PA)3967.70.000000e+002150/2151 (99%)
text_code_colored.pngEPI486916A/northern pintail/California/2789/2011 (A/H9N2) segment 3 (PA)3823.70.000000e+002124/2151 (98%)
text_code_colored.pngEPI549237A/blue-winged teal/TX/AI12-802/2012 (A/H10N3) segment 3 (PA)3818.10.000000e+002123/2151 (98%)
text_code_colored.pngEPI511416A/mallard/Wisconsin/11OS4368/2011 (A/H11N9) segment 3 (PA)3807.10.000000e+002121/2151 (98%)
text_code_colored.pngEPI549236A/blue-winged teal/TX/AI12-801/2012 (A/H10N3) segment 3 (PA)3801.50.000000e+002112/2139 (98%)
text_code_colored.pngEPI584361A/redhead/Ohio/13OS0406/2013 (A/H7N3) segment 3 (PA)3796.00.000000e+002119/2151 (98%)
text_code_colored.pngEPI526250A/American green-winged teal/Wisconsin/13OS3468/2013 (A/H7N3) segment 3 (PA)3790.40.000000e+002118/2151 (98%)
text_code_colored.pngEPI614135A/American green-winged teal/Ohio/12OS2256/2012 (A/H6N5) segment 3 (PA)3784.90.000000e+002117/2151 (98%)
text_code_colored.pngEPI614026A/American green-winged teal/Wisconsin/12OS2997/2012 (A/H4N6) segment 3 (PA)3784.90.000000e+002117/2151 (98%)
text_code_colored.pngEPI343060A/blue-winged teal/Alberta/378/2007 (A/H0) segment 3 (PA)3784.90.000000e+002117/2151 (98%)
text_code_colored.pngEPI343049A/blue-winged teal/Alberta/380/2007 (A/H0) segment 3 (PA)3779.40.000000e+002116/2151 (98%)
text_code_colored.pngEPI526211A/blue-winged teal/Ohio/13OS2037/2013 (A/H7N1) segment 3 (PA)3773.80.000000e+002115/2151 (98%)
text_code_colored.pngEPI511468A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 3 (PA)3773.80.000000e+002115/2151 (98%)
text_code_colored.pngEPI345105A/bufflehead/Alberta/399/2007 (A/H0) segment 3 (PA)3773.80.000000e+002115/2151 (98%)
text_code_colored.pngEPI511376A/greater scaup/Wisconsin/11OS5760/2011 (A/H10N2) segment 3 (PA)3768.30.000000e+002114/2151 (98%)
text_code_colored.pngEPI511371A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 3 (PA)3768.30.000000e+002114/2151 (98%)
text_code_colored.pngEPI511430A/American green-winged teal/Mississippi/11OS5903/2011 (A/H4N6) segment 3 (PA)3757.20.000000e+002112/2151 (98%)
text_code_colored.pngEPI614117A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 3 (PA)3751.70.000000e+002111/2151 (98%)
text_code_colored.pngEPI511346A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 3 (PA)3746.10.000000e+002110/2151 (98%)
text_code_colored.pngEPI614088A/mallard/Missouri/12OS5759/2012 (A/H11N9) segment 3 (PA)3735.00.000000e+002108/2151 (98%)
text_code_colored.pngEPI614017A/blue winged-teal/Wisconsin/12OS3069/2012 (A/H11N9) segment 3 (PA)3696.30.000000e+002101/2151 (97%)
text_code_colored.pngEPI700509A/mallard/Interior Alaska/11ML00069/2011 (A/H2N3) segment 3 (PA)3690.70.000000e+002100/2151 (97%)
text_code_colored.pngEPI227246A/mallard/Alberta/11527/2005 (A/H3N8) segment 3 (PA)3685.20.000000e+002099/2151 (97%)
text_code_colored.pngEPI332987A/pintail/Alaska/99/2005 (A/H0) segment 3 (PA)3640.90.000000e+002091/2151 (97%)
text_code_colored.pngEPI298663A/mallard/Interior Alaska/6MP0891/2006 (A/H4N6) segment 3 (PA)3640.90.000000e+002091/2151 (97%)
text_code_colored.pngEPI614217A/mallard/Alberta/26/2001 (A/H0) segment 3 (PA)3635.30.000000e+002090/2151 (97%)
text_code_colored.pngEPI59866A/green-winged teal/Ohio/1844/2005 (A/H11N9) segment 3 (PA)3635.30.000000e+002090/2151 (97%)
text_code_colored.pngEPI49402A/pintail/Alaska/310/2005 (A/H4N6) segment 3 (PA)3635.30.000000e+002090/2151 (97%)
text_code_colored.pngEPI333931A/northern pintail/Wisconsin/4198/2009 (A/H11N9) segment 3 (PA)3629.80.000000e+002090/2152 (97%)
text_code_colored.pngEPI328225A/mallard/California/8834/2008 (A/H5N9) segment 3 (PA)3629.80.000000e+002089/2151 (97%)
text_code_colored.pngEPI298535A/northern pintail/Interior Alaska/6MP0817/2006 (A/H0) segment 3 (PA)3629.80.000000e+002089/2151 (97%)
text_code_colored.pngEPI238090A/mallard/Minnesota/382/2000 (A/H5N3) segment 3 (PA)3629.80.000000e+002089/2151 (97%)
text_code_colored.pngEPI298607A/green-winged teal/Interior Alaska/6MP1077/2006 (A/H3N8) segment 3 (PA)3624.20.000000e+002088/2151 (97%)
text_code_colored.pngEPI159138A/mallard/MN/479/2000 (A/H5N3) segment 3 (PA)3624.20.000000e+002088/2151 (97%)
text_code_colored.pngEPI442231A/greater white-fronted goose/Alaska/44064-108/2006 (A/H3N2) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI299803A/mallard/Interior Alaska/6MP0990R1/2006 (A/H0) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI298759A/mallard/Interior Alaska/6MP0038BR2/2006 (A/H2N3) segment 3 (PA)3618.70.000000e+002087/2151 (97%)
text_code_colored.pngEPI298687A/mallard/Interior Alaska/6MP0988/2006 (A/H0) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI298647A/northern pintail/Interior Alaska/6MP0792/2006 (A/H2N3) segment 3 (PA)3618.70.000000e+002087/2151 (97%)
text_code_colored.pngEPI298575A/mallard/Interior Alaska/6MP0992/2006 (A/H3N2) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI298567A/mallard/Interior Alaska/6MP0991/2006 (A/H3N2) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI288891A/mallard/Alaska/44185-044/2006 (A/H3N2) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI288886A/mallard/Alaska/44187-131/2006 (A/H3N2) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI288885A/mallard/Alaska/44185-067/2006 (A/H3N2) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI288878A/mallard/Alaska/44187-129/2006 (A/H3N2) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI288866A/mallard/Alaska/44187-043/2006 (A/H3N2) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI288857A/mallard/Alaska/44185-078/2006 (A/H3N2) segment 3 (PA)3618.70.000000e+002088/2152 (97%)
text_code_colored.pngEPI288884A/mallard/Alaska/44185-043/2006 (A/H3N2) segment 3 (PA)3611.30.000000e+002086/2152 (96%)
text_code_colored.pngEPI442279A/emperor goose/Alaska/44323-246/2007 (A/H3N8) segment 3 (PA)3607.60.000000e+002085/2151 (96%)
text_code_colored.pngEPI442257A/emperor goose/Alaska/44063-066/2006 (A/H2N5) segment 3 (PA)3607.60.000000e+002085/2151 (96%)
text_code_colored.pngEPI288890A/mallard/Alaska/44183-124/2006 (A/H2N3) segment 3 (PA)3607.60.000000e+002085/2151 (96%)
text_code_colored.pngEPI229634A/mallard/Maryland/948/2004 (A/H11N9) segment 3 (PA)3607.60.000000e+002085/2151 (96%)
text_code_colored.pngEPI442254A/emperor goose/Alaska/44063-075/2006 (A/H2N5) segment 3 (PA)3603.90.000000e+002084/2151 (96%)
text_code_colored.pngEPI614212A/pintail/Alberta/25/2001 (A/H7N3) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI442233A/emperor goose/Alaska/44064-075/2006 (A/H2N5) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI442230A/brant/Alaska/44063-007/2006 (A/H2N1) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI343802A/mallard/Alberta/22/2001 (A/H7N3) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI343794A/mallard/Alberta/27/2001 (A/H7N3) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI299763A/mallard/Interior Alaska/6MP0905/2006 (A/H10N9) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI298767A/mallard/Interior Alaska/6MP0163AR2/2006 (A/H3N8) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI298671A/mallard/Interior Alaska/6MP0951/2006 (A/H3N8) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI298639A/mallard/Interior Alaska/6MP0272/2006 (A/H3N8) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI229642A/mallard/Maryland/950/2004 (A/H11N9) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI229618A/mallard/Maryland/922/2004 (A/H11N9) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI229599A/blue-winged teal/Ohio/658/2004 (A/H7N3) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI229592A/green-winged teal/Ohio/648/2004 (A/H7N3) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI172224A/blue-winged teal/Manitoba/13436/2005 (A/H3N8) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI166788A/northern pintail/Alaska/44183-123/2006 (A/H2N3) segment 3 (PA)3602.10.000000e+002078/2142 (97%)
text_code_colored.pngEPI52155A/blue-winged teal/Ohio/658/2004 (A/H7N3) segment 3 (PA)3602.10.000000e+002084/2151 (96%)
text_code_colored.pngEPI442260A/emperor goose/Alaska/44063-029/2006 (A/H2N1) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI298735A/mallard/Interior Alaska/6MP0972R1/2006 (A/H3N8) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI285899A/northern pintail/California/466371/2006 (A/H5N2) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI229650A/mallard/Maryland/954/2004 (A/H11N9) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI229626A/mallard/Maryland/926/2004 (A/H11N9) segment 3 (PA)3596.50.000000e+002084/2152 (96%)
text_code_colored.pngEPI42054A/mallard/Alberta/34/2001 (A/H7N1) segment 3 (PA)3596.50.000000e+002083/2151 (96%)
text_code_colored.pngEPI442237A/emperor goose/Alaska/44063-145/2006 (A/H2N1) segment 3 (PA)3592.90.000000e+002082/2151 (96%)
text_code_colored.pngEPI614244A/northern shoveler/North Carolina/1523546/2005 (A/H0) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI298503A/green-winged teal/Interior Alaska/6MP0736/2006 (A/H3N8) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI60208A/green-winged teal/Ohio/1324/2005 (A/H4N6) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI59999A/green-winged teal/Ohio/1324/2005 (A/H4N6) segment 3 (PA)3591.00.000000e+002082/2151 (96%)
text_code_colored.pngEPI343337A/mallard/Alberta/256/2006 (A/H0) segment 3 (PA)3585.50.000000e+002081/2151 (96%)
text_code_colored.pngEPI342991A/mallard/Alberta/507/2008 (A/H3N8) segment 3 (PA)3585.50.000000e+002082/2152 (96%)
text_code_colored.pngEPI275169A/thick-billed murre/Alaska/44085-040/2006 (A/H10N3) segment 3 (PA)3585.50.000000e+002081/2151 (96%)
text_code_colored.pngEPI80956A/mallard/Alberta/24/01 (A/H7N3) segment 3 (PA)3585.50.000000e+002081/2151 (96%)
text_code_colored.pngEPI475436A/pintail/Alberta/68/2005 (A/H1N1) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI468612A/mallard/Alberta/201/1998 (A/H1N1) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI454182A/American black duck/North Carolina/1321373/2004 (A/H3N2) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI343304A/mallard/Alberta/297/2006 (A/H4N6) segment 3 (PA)3579.90.000000e+002081/2152 (96%)
text_code_colored.pngEPI286504A/American widgeon/Washington/466769/2006 (A/H5N2) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI229506A/American black duck/North Carolina/675-075/2004 (A/H3N2) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI178029A/northern pintail/California/44221-789/2006 (A/H5N2) segment 3 (PA)3579.90.000000e+002074/2142 (96%)
text_code_colored.pngEPI159712A/turkey/CA/358533/2005 (A/H4N8) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI86732A/mallard/ALB/201/1998 (A/H1N1) segment 3 (PA)3579.90.000000e+002080/2151 (96%)
text_code_colored.pngEPI227285A/mallard/California/GL30/2005 (A/H4N6) segment 3 (PA)3576.20.000000e+002080/2152 (96%)
text_code_colored.pngEPI468369A/pintail/Alberta/69/2005 (A/H1N1) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI435728A/pintail/Alberta/69/2005 (A/H1N1) segment 3 (PA)3574.40.000000e+002079/2151 (96%)
text_code_colored.pngEPI343356A/mallard/Alberta/246/2006 (A/H4N6) segment 3 (PA)3574.40.000000e+002080/2152 (96%)
text_code_colored.pngEPI343348A/mallard/Alberta/254/2006 (A/H4N6) segment 3 (PA)3574.40.000000e+002080/2152 (96%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI709585A/turkey/Indiana/16-001574-7/2016 (A/H7N8) segment 5 (NP)2765.60.000000e+001497/1497 (100%)
text_code_colored.pngEPI709577A/turkey/Indiana/16-001573-2/2016 (A/H7N8) segment 5 (NP)2754.50.000000e+001495/1497 (99%)
text_code_colored.pngEPI709569A/turkey/Indiana/16-001403-1/2016 (A/H7N8) segment 5 (NP)2754.50.000000e+001495/1497 (99%)
text_code_colored.pngEPI334349A/bufflehead/Illinois/4016/2009 (A/H4N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)
text_code_colored.pngEPI419535A/American green-winged teal/Mississippi/11OS257/2011 (A/H11N9) segment 5 (NP)2654.80.000000e+001477/1497 (98%)
text_code_colored.pngEPI418545A/mallard/Wisconsin/10OS3166/2010 (A/H0) segment 5 (NP)2654.80.000000e+001477/1497 (98%)
text_code_colored.pngEPI512266A/blue-winged teal/Wisconsin/11OS2873/2011 (A/H3N2) segment 5 (NP)2649.20.000000e+001476/1497 (98%)
text_code_colored.pngEPI616325A/northern shoveler/Missouri/12OS5755/2012 (A/H10N3) segment 5 (NP)2632.60.000000e+001473/1497 (98%)
text_code_colored.pngEPI328267A/mallard/California/6957/2008 (A/H10N7) segment 5 (NP)2632.60.000000e+001473/1497 (98%)
text_code_colored.pngEPI616165A/American green-winged teal/Ohio/12OS2137/2012 (A/H4N6) segment 5 (NP)2627.10.000000e+001472/1497 (98%)
text_code_colored.pngEPI512884A/mallard/Wisconsin/11OS4204/2011 (A/H0) segment 5 (NP)2627.10.000000e+001472/1497 (98%)
text_code_colored.pngEPI689534A/American green winged teal/Mississippi/A00630203/2009 (A/H7N6) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI328574A/northern shoveler/California/9710/2008 (A/H10N7) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI299358A/northern shoveler/Mississippi/09OS589/2009 (A/H4N6) segment 5 (NP)2621.50.000000e+001471/1497 (98%)
text_code_colored.pngEPI333661A/American green-winged teal/Mississippi/300/2010 (A/H11N9) segment 5 (NP)2610.40.000000e+001469/1497 (98%)
text_code_colored.pngEPI690051A/northern shoveler/Nevada/A00505416/2008 (A/H7N6) segment 5 (NP)2604.90.000000e+001469/1498 (98%)
text_code_colored.pngEPI328481A/green-winged teal/California/10197/2008 (A/H10N7) segment 5 (NP)2604.90.000000e+001469/1498 (98%)
text_code_colored.pngEPI645515A/blue-winged teal/Ohio/13OS2104/2013 (A/H2N3) segment 5 (NP)2588.30.000000e+001465/1497 (97%)
text_code_colored.pngEPI178799A/northern shoveler/California/HKWF392sm/2007 (A/H10N7) segment 5 (NP)2588.30.000000e+001465/1497 (97%)
text_code_colored.pngEPI435840A/mallard/Alberta/152/2006 (A/H1N3) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI328644A/mallard/California/11032/2008 (A/H0N8) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI328589A/northern shoveler/California/9235/2008 (A/H10N8) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI328075A/northern shoveler/California/9781/2008 (A/H1N3) segment 5 (NP)2582.70.000000e+001465/1498 (97%)
text_code_colored.pngEPI290714A/northern shoveler/Washington/44249-752/2006 (A/H7N3) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI290706A/northern shoveler/Washington/44249-749/2006 (A/H7N3) segment 5 (NP)2582.70.000000e+001464/1497 (97%)
text_code_colored.pngEPI442357A/greater white-fronted goose/Alaska/44049-046/2006 (A/H5N2) segment 5 (NP)2577.20.000000e+001463/1497 (97%)
text_code_colored.pngEPI286140A/white front goose/Alaska//445210/2006 (A/H5N2) segment 5 (NP)2577.20.000000e+001463/1497 (97%)
text_code_colored.pngEPI280601A/white front goose/Alaska/477003/2007 (A/H5N2) segment 5 (NP)2571.70.000000e+001462/1497 (97%)
text_code_colored.pngEPI280585A/tundra swan/Alaska/442960/2006 (A/H5N2) segment 5 (NP)2571.70.000000e+001462/1497 (97%)
text_code_colored.pngEPI292417A/American green-winged teal/California/44287-305/2007 (A/H7N6) segment 5 (NP)2566.10.000000e+001461/1497 (97%)
text_code_colored.pngEPI290661A/American green-winged teal/California/28228/2007 (A/H7N6) segment 5 (NP)2566.10.000000e+001461/1497 (97%)
text_code_colored.pngEPI292804A/northern shoveler/California/JN770/2006 (A/H10N3) segment 5 (NP)2564.30.000000e+001454/1487 (97%)
text_code_colored.pngEPI442383A/tundra swan/Alaska/44049-168/2006 (A/H5N2) segment 5 (NP)2562.40.000000e+001457/1492 (97%)
text_code_colored.pngEPI343451A/mallard/Alberta/190/2006 (A/H0) segment 5 (NP)2560.60.000000e+001460/1497 (97%)
text_code_colored.pngEPI241717A/mallard/Alberta/11513/2005 (A/H0) segment 5 (NP)2560.60.000000e+001460/1497 (97%)
text_code_colored.pngEPI689675A/blue winged teal/Missouri/A00624484/2008 (A/H7N3) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI689668A/blue winged teal/Missouri/A00624483/2008 (A/H7N3) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI475399A/pintail/Alberta/68/2005 (A/H1N1) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI437289A/blue-winged teal/Alberta/405/2008 (A/H10N7) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI435791A/pintail/Alberta/69/2005 (A/H1N1) segment 5 (NP)2555.00.000000e+001459/1497 (97%)
text_code_colored.pngEPI468371A/pintail/Alberta/69/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI455875A/mallard/Minnesota/Sg-00630/2008 (A/H10N7) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI449918A/mallard/Minnesota/AI09-3819/2009 (A/H0) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI435805A/mallard/Alberta/257/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI435798A/mallard/Alberta/240/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI334118A/mallard/Illinois/3747/2009 (A/H6N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI327273A/mallard/Alberta/11393/2005 (A/H1N1) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI280481A/waterfowl/Colorado/443593/2006 (A/H5N2) segment 5 (NP)2549.50.000000e+001458/1497 (97%)
text_code_colored.pngEPI503530A/wild bird/Chile/1805/2008 (A/H5N9) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI450032A/mallard/Arkansas/AI09-5761/2009 (A/H2N3) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI449854A/northern pintail/Minnesota/AI09-3254/2009 (A/H6N2) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI333933A/northern pintail/Wisconsin/4198/2009 (A/H11N9) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI298301A/blue-winged teal/Minnesota/Sg-00201/2007 (A/H4N6) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI222304A/mallard/Manitoba/23912/2007 (A/H4N7) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI131965A/mallard/Missouri/209/2006 (A/H11N9) segment 5 (NP)2544.00.000000e+001457/1497 (97%)
text_code_colored.pngEPI442354A/greater white-fronted goose/Alaska/44065-031/2006 (A/H5N2) segment 5 (NP)2542.10.000000e+001446/1481 (97%)
text_code_colored.pngEPI689730A/domestic duck/West Virginia/A00140913/2008 (A/H7N3) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI452222A/northern pintail/Interior Alaska/9BM7882R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI452145A/northern pintail/Interior Alaska/9BM11643R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI452004A/northern pintail/Interior Alaska/9BM6510R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI436946A/northern pintail/Interior Alaska/9BM8109R0/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI407675A/northern shoveler/Interior Alaska/9BM1447R2/2009 (A/H8N4) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI403274A/northern pintail/Alberta/3/2009 (A/H0) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI334203A/northern shoveler/Mississippi/236/2010 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI333733A/northern shovelerMissouri/196/2009 (A/H10N3) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI299510A/American green-winged teal/Illinois/08OS2713/2008 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI299502A/mallard/Illinois/08OS2711/2008 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI299398A/mallard/Illinois/08OS2710/2008 (A/H10N7) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI290800A/mallard/Washington/44338-195/2007 (A/H12N5) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI227450A/redhead/Alberta/11817/2005 (A/H4N6) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI220550A/green winged teal/California/AKS1305/2008 (A/H11N9) segment 5 (NP)2538.40.000000e+001456/1497 (97%)
text_code_colored.pngEPI700493A/mallard/Interior Alaska/11ML00058/2011 (A/H7N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI699583A/mallard/Interior Alaska/11BM03577/2011 (A/H7N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI689742A/domestic duck/West Virginia/A00140915/2008 (A/H7N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI689723A/domestic duck/West Virginia/A00140912/2008 (A/H7N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI455976A/mallard/Minnesota/Sg-01005/2008 (A/H0) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI452124A/northern pintail/Interior Alaska/9BM11409R0/2009 (A/H12N5) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI450045A/northern shoveler/Arkansas/AI09-6012/2009 (A/H10N3) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI448675A/blue-winged teal/North Dakota/Sg-00740/2008 (A/H3N8) segment 5 (NP)2532.90.000000e+001456/1498 (97%)
text_code_colored.pngEPI436979A/northern pintail/Interior Alaska/9BM8967R0/2009 (A/H8N4) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI433101A/American green-winged teal/Interior Alaska/9BM5045R0/2009 (A/H8N4) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI415985A/northern pintail/Interior Alaska/10BM02549R0 (A/H0) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI413412A/mallard/Ohio/10OS1319/2010 (A/H4N6) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI327859A/mallard/California/6768/2009 (A/H1N1) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI299558A/environment/Indiana/08OS3524/2008 (A/H1N2) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI299486A/mallard/Illinois/08OS2315/2008 (A/H4N6) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI292689A/American green-winged teal/California/44363-067/2007 (A/H11N9) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI280841A/mallard/Oregon/461067-2/2006 (A/H5N2) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI230699A/mallard/California/K752/2006 (A/H10N7) segment 5 (NP)2532.90.000000e+001455/1497 (97%)
text_code_colored.pngEPI690027A/northern pintail/Texas/A00466052/2009 (A/H7N3) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI616825A/mallard/Minnesota/AI07-3433/2007 (A/H7N3) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI513040A/mallard/Illinois/11OS5570/2011 (A/H3N8) segment 5 (NP)2527.30.000000e+001455/1498 (97%)
text_code_colored.pngEPI512339A/mallard/Wisconsin/11OS4493/2011 (A/H1N3) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI455983A/mallard/Minnesota/Sg-01030/2008 (A/H10N7) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI452018A/northern pintail/Interior Alaska/9BM7152R2/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI436884A/mallard/Interior Alaska/9BM10537R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI432856A/northern shoveler/Interior Alaska/9BM2925R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI414327A/mallard/Interior Alaska/9BM2705R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI414305A/mallard/Interior Alaska/9BM2351R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%)
text_code_colored.pngEPI414290A/mallard/Interior Alaska/9BM2388R0/2009 (A/H8N4) segment 5 (NP)2527.30.000000e+001454/1497 (97%

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI709587A/turkey/Indiana/16-001574-7/2016 (A/H7N8) segment 7 (MP)1814.50.000000e+00982/982 (100%)
text_code_colored.pngEPI709579A/turkey/Indiana/16-001573-2/2016 (A/H7N8) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI709571A/turkey/Indiana/16-001403-1/2016 (A/H7N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI616384A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI513049A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI512344A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI512875A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI420188A/bufflehead/California/3118/2011 (A/H4N8) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI689817A/mallard/Nebraska/A00709657/2009 (A/H7N3) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI689575A/American green winged teal/Texas/A00604814/2009 (A/H7N3) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI689568A/American green winged teal/Texas/A00604032/2009 (A/H7N3) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI689561A/American green winged teal/Texas/A00604029/2009 (A/H7N3) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI689548A/American green winged teal/Texas/A00604024/2009 (A/H7N3) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI449999A/lesser scaup/Louisiana/AI09-5204/2009 (A/H6N8) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI690043A/northern shoveler/Mississippi/A00682947/2008 (A/H7N7) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI419526A/American green-winged teal/Mississippi/11OS256/2011 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI689700A/blue winged teal/Texas/A00605473/2009 (A/H7N3) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI689645A/blue winged teal/Louisiana/A00557206/2009 (A/H7N7) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI418971A/mallard/Wisconsin/10OS3169/2010 (A/H4N9) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI376067A/mallard/California/1475/2010 (A/H3N8) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI327661A/mallard/California/1156/2010 (A/H4N6) segment 7 (MP)1742.50.000000e+00969/982 (98%)
text_code_colored.pngEPI689789A/mallard/Iowa/A00558620/2008 (A/H7N3) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI689689A/blue winged teal/Texas/A00676566/2009 (A/H7N3) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI616847A/blue-winged teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI449901A/blue-winged Teal/North Dakota/AI09-3760/2009 (A/H7N3) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI449736A/mallard/Minnesota/AI09-1867/2009 (A/H8N4) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI449729A/mallard/Minnesota/AI09-1854/2009 (A/H8N4) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI449722A/mallard/Minnesota/AI09-1833/2009 (A/H8N4) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI435155A/American black duck/New Brunswick/00867/2010 (A/H5N2) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI398693A/mallard/California/1154/2010 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI387273A/mallard/California/1297/2010 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI327669A/mallard/California/1154/2010 (A/H0) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI327653A/mallard/California/1210/2010 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI327637A/mallard/California/1188/2010 (A/H4N6) segment 7 (MP)1737.00.000000e+00968/982 (98%)
text_code_colored.pngEPI689833A/mallard/New York/A00723392/2009 (A/H7N3) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI689659A/blue winged teal/Minnesota/A00137660/2009 (A/H7N3) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI689487A/American black duck/Delaware/A00870108/2010 (A/H7N3) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512992A/mallard/Wisconsin/11OS3092/2011 (A/H3N2) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512985A/mallard/Wisconsin/11OS3079/2011 (A/H3N2) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512964A/mallard/Illinois/11OS5582/2011 (A/H1N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512947A/American green-winged teal/Illinois/11OS4814/2011 (A/H3N8) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI512919A/mallard/Wisconsin/11OS3106/2011 (A/H3N2) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476339A/blue-winged teal/Canada/3240/2011 (A/H4N6) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476272A/blue-winged teal/Canada/3241/2011 (A/H4N6) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476265A/blue-winged teal/Canada/3239/2011 (A/H4N6) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476258A/blue-winged teal/Canada/3237/2011 (A/H4N6) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476213A/thick-billed murre/Canada/1871/2011 (A/H1N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476150A/common eider/Maine/270/2011 (A/H1N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476143A/mallard/Maine/202/2011 (A/H1N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI476123A/bufflehead/Maine/161/2011 (A/H1N1) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI449328A/mallard/Minnesota/Sg-00804/2008 (A/H3N8) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI419167A/mallard/Wisconsin/10OS3866/2010 (A/H3N6) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI331963A/blue-winged teal/Guatemala/CIP049-06/2010 (A/H8N4) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI331955A/blue-winged teal/Guatemala/CIP049-12/2010 (A/H5N4) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI331947A/blue-winged teal/Guatemala/CIP049-13/2010 (A/H5N4) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI331939A/blue-winged teal/Guatemala/CIP049-14/2010 (A/H8N4) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI331915A/blue-winged teal/Guatemala/CIP049-15/2010 (A/H8N4) segment 7 (MP)1731.40.000000e+00967/982 (98%)
text_code_colored.pngEPI616449A/blue-winged teal/Illinois/12OS4788/2012 (A/H1N1) segment 7 (MP)1725.90.000000e+00966/982 (98%)
text_code_colored.pngEPI463748A/mallard/Minnesota/AI09-1714/2009 (A/H7N1) segment 7 (MP)1725.90.000000e+00966/982 (98%)
text_code_colored.pngEPI419062A/American green-winged teal/Wisconsin/10OS2955/2010 (A/H5N2) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI419055A/mallard/Wisconsin/10OS2945/2010 (A/H0) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI327629A/mallard/California/1289/2010 (A/H4N6) segment 7 (MP)1720.40.000000e+00965/982 (98%)
text_code_colored.pngEPI328420A/northern pintail/California/6495/2008 (A/H6N1) segment 7 (MP)1714.80.000000e+00964/982 (98%)
text_code_colored.pngEPI699389A/American green-winged teal/Interior Alaska/11BM00293/2011 (A/H10N5) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI699370A/American green-winged teal/Interior Alaska/11BM00304/2011 (A/H10N5) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI512209A/American green-winged teal/Mississippi/12OS405/2012 (A/H10N7) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI420253A/mallard/California/3569/2010 (A/H1N3) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI328317A/mallard/California/6420/2008 (A/H6N2) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI299195A/northern pintail/Interior Alaska/8BM3700/2008 (A/H3N8) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI220470A/env/California/7279/2008 (A/H2N3) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI159708A/turkey/CA/358533/2005 (A/H4N8) segment 7 (MP)1709.30.000000e+00963/982 (98%)
text_code_colored.pngEPI645489A/American green-winged teal/Wisconsin/13OS3465/2013 (A/H6N8) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI616170A/blue-winged teal/Ohio/12OS2138/2012 (A/H10N9) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI512233A/mallard/Arkansas/12OS184/2012 (A/H10N7) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI454938A/ruddy turnstone/New Jersey/AI06-582/2006 (A/H6N7) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI450079A/red-necked grebe/Minnesota/AI10-2530/2010 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI450071A/red-necked grebe/Minnesota/AI10-2529/2010 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI442481A/spectacled eider/Alaska/44173-055/2006 (A/H3N8) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI419704A/American wigeon/Missouri/10MO0530/2010 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI418727A/American green-winged teal/Wisconsin/10OS2767/2010 (A/H6N8) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI376081A/northern shoveler/California/3185/2010 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI369979A/mallard/Alberta/297/2007 (A/H2N9) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI334380A/mallard/Illinois/3048/2009 (A/H11N2) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI333743A/northern shovelerMissouri/141/2009 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI333607A/American green-winged teal/Mississippi/404/2010 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI300071A/northern pintail/Interior Alaska/8BM3696/2008 (A/H3N8) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI300064A/northern shoveler/Interior Alaska/8BM3671/2008 (A/H4N1) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI299727A/northern pintail/Interior Alaska/8BM3723/2008 (A/H4N1) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI299452A/northern shoveler/Mississippi/09OS643/2009 (A/H7N7) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI299203A/green-winged teal/Interior Alaska/8BM3706/2008 (A/H0) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI299027A/duck/Interior Alaska/7MP1582/2007 (A/H1N1) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI298340A/blue-winged teal/Louisiana/Sg-00189/2007 (A/H3N6) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI292834A/bufflehead/California/JN1016/2006 (A/H2N9) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI290758A/American green-winged teal/California/44287-395/2007 (A/H8N3) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI290696A/northern shoveler/Washington/44249-731/2006 (A/H10N7) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI280527A/mallard/Idaho/455398-2/2006 (A/H5N2) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI280519A/mallard/Washington/456277-7/2006 (A/H5N2) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI263207A/gadwall/Minnesota/Sg-00044/2007 (A/H3N8) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI225343A/pintail/Alberta/21/2006 (A/H1N1) segment 7 (MP)1703.70.000000e+00962/982 (97%)
text_code_colored.pngEPI220501A/env/California/7335/2008 (A/H2N3) segment 7 (MP)1703.70.000000e+00962/982 (97%)
 

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.