Sign in to follow this  
Followers 0
niman

Full Zika Sequence From December 2015 Martinique Outbreak

6 posts in this topic

LOCUS       KU647676               10617 bp    RNA     linear   VRL 04-FEB-2016
DEFINITION  Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene,
            complete cds.
ACCESSION   KU647676
VERSION     KU647676.1  GI:984915975
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus; Spondweni virus group.
REFERENCE   1  (bases 1 to 10617)
  AUTHORS   Piorkowski,G., Gallian,P., Baronti,C., Richard,P., Leparc
            Goffart,I. and De Lamballerie,X.
  TITLE     Complete coding sequence of Zika virus from Martinique outbreak
            2015
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10617)
  AUTHORS   Piorkowski,G., Gallian,P., Baronti,C., Richard,P., Leparc
            Goffart,I. and De Lamballerie,X.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2016) Umr190 Unite des Virus Emergents, Faculte
            de Medecine de Marseille, 27 Boulevard Jean Moulin, Marseille
            13005, France
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. 8.5.1
            Coverage              :: 8570
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10617
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="MRS_OPY_Martinique_PaRi_2015"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /lab_host="Vero cells"
                     /country="Martinique"
                     /collection_date="Dec-2015"
                     /note="EVA 1589"
     CDS             48..10319
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AMC33116.1"
                     /db_xref="GI:984915976"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGAETSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFWAKDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALTAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVAKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa
       61 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga
      121 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca
      181 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc
      241 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca
      301 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag
      361 gcgcagaaac tagtgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg
      421 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca
      481 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac
      541 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag
      601 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc
      661 acaaaaaagg tgaagcacgg agatctagaa gagccgtgac gctcccctcc cattccacta
      721 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga
      781 ttagagtcga aaattggata ttcaggaacc ctggtttcgc tttagcagca gctgccatcg
      841 cgtggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga
      901 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta
      961 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg
     1021 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg
     1081 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc
     1141 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa
     1201 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga
     1261 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc
     1321 tggagtaccg gataatgttg tcagttcatg gctcccagca cagtgggatg atcgttaatg
     1381 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa
     1441 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag
     1501 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca
     1561 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac
     1621 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg
     1681 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg
     1741 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa
     1801 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca
     1861 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga
     1921 cagatggacc ttgcaaggtt ccagcccaga tggcggtgga catgcaaact ctgaccccag
     1981 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga
     2041 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga
     2101 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg
     2161 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg
     2221 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat
     2281 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt
     2341 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt
     2401 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga
     2461 aggagacgag atgtggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca
     2521 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg
     2581 aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag
     2641 tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg
     2701 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc
     2761 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata
     2821 acagctttgt cgtggatggt gacacactga aggaatgccc actcaaacat agagcatgga
     2881 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg
     2941 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa
     3001 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga
     3061 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaaa tcccacacat
     3121 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac
     3181 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg
     3241 aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg gaggaaacat
     3301 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat
     3361 ggtgctgcag ggagtgcaca atgcccccac tgtcgttctg ggctaaagat ggctgttggt
     3421 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcaatggtga
     3481 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca
     3541 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg
     3601 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa
     3661 ttttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc
     3721 tgacagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt
     3781 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct
     3841 ctgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa
     3901 tacgagcgat ggttgttcca cgcactgaca acatcacctt ggcaatcctg gctgctctga
     3961 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg
     4021 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca
     4081 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt
     4141 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc
     4201 tgatatgtgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg
     4261 ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca
     4321 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc
     4381 ggctcgacgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc
     4441 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag
     4501 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg
     4561 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt
     4621 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag
     4681 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag
     4741 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat
     4801 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg
     4861 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca
     4921 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt
     4981 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta
     5041 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga
     5101 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga
     5161 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag
     5221 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt
     5281 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc
     5341 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata
     5401 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa
     5461 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc
     5521 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga
     5581 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg
     5641 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg
     5701 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt
     5761 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg
     5821 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg
     5881 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga
     5941 atcccaataa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag
     6001 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc
     6061 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca
     6121 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg
     6181 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct
     6241 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca
     6301 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc
     6361 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag
     6421 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg
     6481 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg
     6541 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc
     6601 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg
     6661 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg
     6721 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc
     6781 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg
     6841 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc
     6901 taatgggaag gagagaggag ggggcaacca taggattctc aatggacatt gacctgcggc
     6961 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac
     7021 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag
     7081 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccactgc
     7141 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc
     7201 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc
     7261 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg
     7321 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca
     7381 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg
     7441 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga
     7501 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt
     7561 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag
     7621 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct
     7681 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca
     7741 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt
     7801 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag
     7861 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa
     7921 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aacatagtcc
     7981 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt
     8041 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc
     8101 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt
     8161 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag
     8221 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag
     8281 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg
     8341 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg
     8401 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga
     8461 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg
     8521 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg
     8581 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga
     8641 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc
     8701 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag
     8761 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggttc
     8821 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg
     8881 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga
     8941 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg
     9001 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc
     9061 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag
     9121 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc
     9181 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcatcagca
     9241 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct
     9301 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag
     9361 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac
     9421 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata
     9481 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag
     9541 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag
     9601 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg
     9661 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact
     9721 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt
     9781 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag
     9841 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc
     9901 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg
     9961 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat
    10021 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc
    10081 acatggaaga caagacccca gttgcgaaat ggacagacat tccctatttg ggaaaaaggg
    10141 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca
    10201 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact
    10261 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag
    10321 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc
    10381 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg
    10441 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca
    10501 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg
    10561 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggag

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1901619016100%0.099%KJ776791.1
1900319003100%0.099%KU321639.1
1899018990100%0.099%KU365779.1
1898118981100%0.099%KU365780.1
1897218972100%0.099%KU365777.1
1895418954100%0.099%KU365778.1
185321853297%0.099%KU312312.1
177571775796%0.098%JN860885.1
177241772495%0.099%KF993678.1
176071760796%0.098%EU545988.1
164291642996%0.095%HQ234499.1

Share this post


Link to post
Share on other sites

Volume 22, Number 5—May 2016

Letter

Phylogeny of Zika Virus in Western Hemisphere, 2015

Robert S. LanciottiComments to Author , Amy J. Lambert, Mark Holodniy, Sonia Saavedra, and Leticia del Carmen Castillo Signor
Author affiliations: Centers for Disease Control and Prevention, Fort Collins, Colorado, USA (R.S. Lanciotti, A.J. Lambert)Department of Veterans Affairs, Palo Alto, California, USA (M. Holodniy)VA Caribbean Health Care System, San Juan, Puerto Rico, USA (S. Saavedra)Laboratorio Nacional de Salud Guatemala, Villa Nueva, Guatemala (L. del Carmen Castillo Signor)

Main Article

Figure

Phylogenetic tree of Zika virus isolates identified from Guatemala and Puerto Rico in December 2015 (indicated in boldface) compared with reference isolates obtained from GenBank. The isolates from Guatemala and Puerto Rico grouped with other Asian genotype viruses. The tree was derived by neighbor-joining methods (bootstrapped 1,000 times) using complete-genome sequences. Location, year identified, and GenBank strain identification for the viruses used in tree construction are shown. Scale bar

Figure. Phylogenetic tree of Zika virus isolates identified from Guatemala and Puerto Rico in December 2015 (indicated in boldface) compared with reference isolates obtained from GenBank. The isolates from Guatemala and Puerto Rico grouped with other Asian genotype viruses. The tree was derived by neighbor-joining methods (bootstrapped 1,000 times) using complete-genome sequences. Location, year identified, and GenBank strain identification for the viruses used in tree construction are shown. Scale bar indicates number of nucleotide substitutions per site. GenBank accession nos.: KU321639 (Brazil 2015 SPH2015), KJ776791 (French Polynesia H/PF/2013), KF383115 (Central African Republic ARB1362), KF383116 (Senegal 1968 ArD7117), KF383117 (Senegal 1997 ArD128000), KF383118 (Senegal 2001 ArD157995), KF383119 (Senegal 2001 ArD158084), KF268948 (CAR 1979 ARB13565), KF268949 (CAR 1980 ARB15076), KF268950 (CAR 1976 ARB7701), EU545988 (Yap 2007), KF993678 (Thailand 2013 PLCal_ZV), JN860885 (Cambodia 2010 FSS13025), HQ234499 (Malaysia 1966 P6-740), HQ234501 (Senegal 1984 ArD41519), HQ234500 (Nigeria 1968 IbH 30656), LC002520 (Uganda 1947 MR766), KU501215 (Puerto Rico PRVABC59), KU501216 (Guatemala 8375), and KU501217 (Guatemala 103344).

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
191131911399%0.099%KU365778.1
191021910299%0.099%KU365779.1
190931909399%0.099%KU365780.1
190841908499%0.099%KU365777.1
190551905599%0.099%KU321639.1
189921899299%0.099%KJ776791.1
185831858397%0.099%KU312312.1
177391773996%0.098%JN860885.1
176881768894%0.099%KF993678.1
175851758596%0.098%EU545988.1
164241642496%0.095%HQ234499.1

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1852518525100%0.0100%KU647676.1
1840218402100%0.099%KU509998.1
1839918399100%0.099%KJ776791.1
1839018390100%0.099%KU321639.1
1838118381100%0.099%KU365779.1
1836618366100%0.099%KU365780.1
1836318363100%0.099%KU365777.1
1835718357100%0.099%KU501217.1
1835418354100%0.099%KU501216.1
1834818348100%0.099%KU365778.1
1834818348100%0.099%KU312312.1
1833918339100%0.099%KU501215.1
177571775799%0.098%JN860885.1
177241772498%0.099%KF993678.1
1760717607100%0.098%EU545988.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.