Sign in to follow this  
Followers 0
niman

Full Zika Sequence From December 2015 Puerto Rico Outbreak

2 posts in this topic

LOCUS       KU501215               10675 bp    RNA     linear   VRL 01-FEB-2016
DEFINITION  Zika virus strain PRVABC59, complete genome.
ACCESSION   KU501215
VERSION     KU501215.1  GI:984874581
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus; Spondweni virus group.
REFERENCE   1  (bases 1 to 10675)
  AUTHORS   Lanciotti,R.S., Lambert,A.J., Holodniy,M., Saavedra,S. and del
            Carmen Castillo Signor,L.
  TITLE     Phylogeny of Zika Virus in Western Hemisphere, 2015
  JOURNAL   Emerging Infect. Dis. (2016) In press
  REMARK    Publication Status: Available-Online prior to print
            DOI: 10.3201/eid2205.160065
REFERENCE   2  (bases 1 to 10675)
  AUTHORS   Lanciotti,R.S. and Holodniy,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JAN-2016) Diagnostic & Reference Laboratory,
            Arbovirus Diseases Branch, Centers for Disease Control &
            Prevention, 3150 Rampart Road, Fort Collins, CO 80521, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. V7
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10675
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="PRVABC59"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Puerto Rico"
                     /collection_date="01-Dec-2015"
     CDS             107..10378
                     /note="C-prM/M-E-NS1-NS2a-NS2b-NS3-NS4A-NS4B-NS5"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AMC13911.1"
                     /db_xref="GI:984874582"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMETIKKFKKDLAAMLRIINARKEKK
                     RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYVATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 gttgttgatc tgtgtgaatc agactgcgac agttcgagtt tgaagcgaaa gctagcaaca
       61 gtatcaacag gttttatttt ggatttggaa acgagagttt ctggtcatga aaaacccaaa
      121 aaagaaatcc ggaggattcc ggattgtcaa tatgctaaaa cgcggagtag cccgtgtgag
      181 cccctttggg ggcttgaaga ggctgccagc cggacttctg ctgggtcatg ggcccatcag
      241 gatggtcttg gcgattctag cctttttgag attcacggca atcaagccat cactgggtct
      301 catcaataga tggggttcag tggggaaaaa agaggctatg gaaacaataa agaagttcaa
      361 gaaagatctg gctgccatgc tgagaataat caatgctagg aaggagaaga agagacgagg
      421 cgcagatact agtgtcggaa ttgttggcct cctgctgacc acagctatgg cagcggaggt
      481 cactagacgt gggagtgcat actatatgta cttggacaga aacgatgctg gggaggccat
      541 atcttttcca accacattgg ggatgaataa gtgttatata cagatcatgg atcttggaca
      601 catgtgtgat gccaccatga gctatgaatg ccctatgctg gatgaggggg tggaaccaga
      661 tgacgtcgat tgttggtgca acacgacgtc aacttgggtt gtgtacggaa cctgccatca
      721 caaaaaaggt gaagcacgga gatctagaag agctgtgacg ctcccctccc attccaccag
      781 gaagctgcaa acgcggtcgc aaacctggtt ggaatcaaga gaatacacaa agcacttgat
      841 tagagtcgaa aattggatat tcaggaaccc tggcttcgcg ttagcagcag ctgccatcgc
      901 ttggcttttg ggaagctcaa cgagccaaaa agtcatatac ttggtcatga tactgctgat
      961 tgccccggca tacagcatca ggtgcatagg agtcagcaat agggactttg tggaaggtat
     1021 gtcaggtggg acttgggttg atgttgtctt ggaacatgga ggttgtgtca ccgtaatggc
     1081 acaggacaaa ccgactgtcg acatagagct ggttacaaca acagtcagca acatggcgga
     1141 ggtaagatcc tactgctatg aggcatcaat atcagacatg gcttctgaca gccgctgccc
     1201 aacacaaggt gaagcctacc ttgacaagca atcagacact caatatgtct gcaaaagaac
     1261 gttagtggac agaggctggg gaaatggatg tggacttttt ggcaaaggga gcctggtgac
     1321 atgcgctaag tttgcatgct ccaagaaaat gaccgggaag agcatccagc cagagaatct
     1381 ggagtaccgg ataatgctgt cagttcatgg ctcccagcac agtgggatga tcgttaatga
     1441 cacaggacat gaaactgatg agaatagagc gaaagttgag ataacgccca attcaccgag
     1501 agccgaagcc accctggggg gttttggaag cctaggactt gattgtgaac cgaggacagg
     1561 ccttgacttt tcagatttgt attacttgac tatgaataac aagcactggt tggttcacaa
     1621 ggagtggttc cacgacattc cattaccttg gcacgctggg gcagacaccg gaactccaca
     1681 ctggaacaac aaagaagcac tggtagagtt caaggacgca catgccaaaa ggcaaactgt
     1741 cgtggttcta gggagtcaag aaggagcagt tcacacggcc cttgctggag ctctggaggc
     1801 tgagatggat ggtgcaaagg gaaggctgtc ctctggccac ttgaaatgtc gcctgaaaat
     1861 ggataaactt agattgaagg gcgtgtcata ctccttgtgt actgcagcgt tcacattcac
     1921 caagatcccg gctgaaacac tgcacgggac agtcacagtg gaggtacagt acgcagggac
     1981 agatggacct tgcaaggttc cagctcagat ggcggtggac atgcaaactc tgaccccagt
     2041 tgggaggttg ataaccgcta accccgtaat cactgaaagc actgagaact ctaagatgat
     2101 gctggaactt gatccaccat ttggggactc ttacattgtc ataggagtcg gggagaagaa
     2161 gatcacccac cactggcaca ggagtggcag caccattgga aaagcatttg aagccactgt
     2221 gagaggtgcc aagagaatgg cagtcttggg agacacagcc tgggactttg gatcagttgg
     2281 aggcgctctc aactcattgg gcaagggcat ccatcaaatt tttggagcag ctttcaaatc
     2341 attgtttgga ggaatgtcct ggttctcaca aattctcatt ggaacgttgc tgatgtggtt
     2401 gggtctgaac acaaagaatg gatctatttc ccttatgtgc ttggccttag ggggagtgtt
     2461 gatcttctta tccacagccg tctctgctga tgtggggtgc tcggtggact tctcaaagaa
     2521 ggagacgaga tgcggtacag gggtgttcgt ctataacgac gttgaagcct ggagggacag
     2581 gtacaagtac catcctgact ccccccgtag attggcagca gcagtcaagc aagcctggga
     2641 agatggtatc tgcgggatct cctctgtttc aagaatggaa aacatcatgt ggagatcagt
     2701 agaaggggag ctcaacgcaa tcctggaaga gaatggagtt caactgacgg tcgttgtggg
     2761 atctgtaaaa aaccccatgt ggagaggtcc acagagattg cccgtgcctg tgaacgagct
     2821 gccccacggc tggaaggctt gggggaaatc gtatttcgtc agagcagcaa agacaaataa
     2881 cagctttgtc gtggatggtg acacactgaa ggaatgccca ctcaaacata gagcatggaa
     2941 cagctttctt gtggaggatc atgggttcgg ggtatttcac actagtgtct ggctcaaggt
     3001 tagagaagat tattcattag agtgtgatcc agccgttatt ggaacagctg ttaagggaaa
     3061 ggaggctgta cacagtgatc taggctactg gattgagagt gagaagaatg acacatggag
     3121 gctgaagagg gcccatctga tcgagatgaa aacatgtgaa tggccaaagt cccacacatt
     3181 gtggacagat ggaatagaag agagtgatct gatcataccc aagtctttag ctgggccact
     3241 cagccatcac aataccagag agggctacag gacccaaatg aaagggccat ggcacagtga
     3301 agagcttgaa attcggtttg aggaatgccc aggcactaag gtccacgtgg aggaaacatg
     3361 tggaacaaga ggaccatctc tgagatcaac cactgcaagc ggaagggtga tcgaggaatg
     3421 gtgctgcagg gagtgcacaa tgcccccact gtcgttccgg gctaaagatg gctgttggta
     3481 tggaatggag ataaggccca ggaaagaacc agaaagcaac ttagtaaggt caatggtgac
     3541 tgcaggatca actgatcaca tggaccactt ctcccttgga gtgcttgtga tcctgctcat
     3601 ggtgcaggaa gggctgaaga agagaatgac cacaaagatc atcataagca catcaatggc
     3661 agtgctggta gctatgatcc tgggaggatt ttcaatgagt gacctggcta agcttgcaat
     3721 tttgatgggt gccaccttcg cggaaatgaa cactggagga gatgtagctc atctggcgct
     3781 gatagcggca ttcaaagtca gaccagcgtt gctggtatct ttcatcttca gagctaattg
     3841 gacaccccgt gaaagcatgc tgctggcctt ggcctcgtgt cttttgcaaa ctgcgatctc
     3901 cgccttggaa ggcgacctga tggttctcat caatggtttt gctttggcct ggttggcaat
     3961 acgagcgatg gttgttccac gcactgataa catcaccttg gcaatcctgg ctgctctgac
     4021 accactggcc cggggcacac tgcttgtggc gtggagagca ggccttgcta cttgcggggg
     4081 gtttatgctc ctctctctga agggaaaagg cagtgtgaag aagaacttac catttgtcat
     4141 ggccctggga ctaaccgctg tgaggctggt cgaccccatc aacgtggtgg gactgctgtt
     4201 gctcacaagg agtgggaagc ggagctggcc ccctagcgaa gtactcacag ctgttggcct
     4261 gatatgcgca ttggctggag ggttcgccaa ggcagatata gagatggctg ggcccatggc
     4321 cgcggtcggt ctgctaattg tcagttacgt ggtctcagga aagagtgtgg acatgtacat
     4381 tgaaagagca ggtgacatca catgggaaaa agatgcggaa gtcactggaa acagtccccg
     4441 gctcgatgtg gcgctagatg agagtggtga tttctccctg gtggaggatg acggtccccc
     4501 catgagagag atcatactca aggtggtcct gatgaccatc tgtggcatga acccaatagc
     4561 catacccttt gcagctggag cgtggtacgt atacgtgaag actggaaaaa ggagtggtgc
     4621 tctatgggat gtgcctgctc ccaaggaagt aaaaaagggg gagaccacag atggagtgta
     4681 cagagtaatg actcgtagac tgctaggttc aacacaagtt ggagtgggag ttatgcaaga
     4741 gggggtcttt cacactatgt ggcacgtcac aaaaggatcc gcgctgagaa gcggtgaagg
     4801 gagacttgat ccatactggg gagatgtcaa gcaggatctg gtgtcatact gtggtccatg
     4861 gaagctagat gccgcctggg atgggcacag cgaggtgcag ctcttggccg tgccccccgg
     4921 agagagagcg aggaacatcc agactctgcc cggaatattt aagacaaagg atggggacat
     4981 tggagcggtt gcgctggatt acccagcagg aacttcagga tctccaatcc tagacaagtg
     5041 tgggagagtg ataggacttt atggcaatgg ggtcgtgatc aaaaacggga gttatgttag
     5101 tgccatcacc caagggagga gggaggaaga gactcctgtt gagtgcttcg agccctcgat
     5161 gctgaagaag aagcagctaa ctgtcttaga cttgcatcct ggagctggga aaaccaggag
     5221 agttcttcct gaaatagtcc gtgaagccat aaaaacaaga ctccgtactg tgatcttagc
     5281 tccaaccagg gttgtcgctg ctgaaatgga ggaggccctt agagggcttc cagtgcgtta
     5341 tatgacaaca gcagtcaatg tcacccactc tggaacagaa atcgtcgact taatgtgcca
     5401 tgccaccttc acttcacgtc tactacagcc aatcagagtc cccaactata atctgtatat
     5461 tatggatgag gcccacttca cagatccctc aagtatagca gcaagaggat acatttcaac
     5521 aagggttgag atgggcgagg cggctgccat cttcatgacc gccacgccac caggaacccg
     5581 tgacgcattt ccggactcca actcaccaat tatggacacc gaagtggaag tcccagagag
     5641 agcctggagc tcaggctttg attgggtgac ggatcattct ggaaaaacag tttggtttgt
     5701 tccaagcgtg aggaacggca atgagatcgc agcttgtctg acaaaggctg gaaaacgggt
     5761 catacagctc agcagaaaga cttttgagac agagttccag aaaacaaaac atcaagagtg
     5821 ggactttgtc gtgacaactg acatttcaga gatgggcgcc aactttaaag ctgaccgtgt
     5881 catagattcc aggagatgcc taaagccggt catacttgat ggcgagagag tcattctggc
     5941 tggacccatg cctgtcacac atgccagcgc tgcccagagg agggggcgca taggcaggaa
     6001 tcccaacaaa cctggagatg agtatctgta tggaggtggg tgcgcagaga ctgacgaaga
     6061 ccatgcacac tggcttgaag caagaatgct ccttgacaat atttacctcc aagatggcct
     6121 catagcctcg ctctatcgac ctgaggccga caaagtagca gccattgagg gagagttcaa
     6181 gcttaggacg gagcaaagga agacctttgt ggaactcatg aaaagaggag atcttcctgt
     6241 ttggctggcc tatcaggttg catctgccgg aataacctac acagatagaa gatggtgctt
     6301 tgatggcacg accaacaaca ccataatgga agacagtgtg ccggcagagg tgtggaccag
     6361 acacggagag aaaagagtgc tcaaaccgag gtggatggac gccagagttt gttcagatca
     6421 tgcggccctg aagtcattca aggagtttgc cgctgggaaa agaggagcgg cttttggagt
     6481 gatggaagcc ctgggaacac tgccaggaca catgacagag agattccagg aagccattga
     6541 caacctcgct gtgctcatgc gggcagagac tggaagcagg ccttacaaag ccgcggcggc
     6601 ccaattgccg gagaccctag agaccataat gcttttgggg ttgctgggaa cagtctcgct
     6661 gggaatcttc ttcgtcttga tgaggaacaa gggcataggg aagatgggct ttggaatggt
     6721 gactcttggg gccagcgcat ggctcatgtg gctctcggaa attgagccag ccagaattgc
     6781 atgtgtcctc attgttgtgt tcctattgct ggtggtgctc atacctgagc cagaaaagca
     6841 aagatctccc caggacaacc aaatggcaat catcatcatg gtagcagtag gtcttctggg
     6901 cttgattacc gccaatgaac tcggatggtt ggagagaaca aagagtgacc taagccatct
     6961 aatgggaagg agagaggagg gggcaaccat aggattctca atggacattg acctgcggcc
     7021 agcctcagct tgggccatct atgctgcctt gacaactttc attaccccag ccgtccaaca
     7081 tgcagtgacc acctcataca acaactactc cttaatggcg atggccacgc aagctggagt
     7141 gttgtttggc atgggcaaag ggatgccatt ctacgcatgg gactttggag tcccgctgct
     7201 aatgataggt tgctactcac aattaacacc cctgacccta atagtggcca tcattttgct
     7261 cgtggcgcac tacatgtact tgatcccagg gctgcaggca gcagctgcgc gtgctgccca
     7321 gaagagaacg gcagctggca tcatgaagaa ccctgttgtg gatggaatag tggtgactga
     7381 cattgacaca atgacaattg acccccaagt ggagaaaaag atgggacagg tgctactcat
     7441 agcagtagcc gtctccagcg ccatactgtc gcggaccgcc tgggggtggg gggaggctgg
     7501 ggctctgatc acagccgcaa cttccacttt gtgggaaggc tctccgaaca agtactggaa
     7561 ctcctctaca gccacttcac tgtgtaacat ttttagggga agttacttgg ctggagcttc
     7621 tctaatctac acagtaacaa gaaacgctgg cttggtcaag agacgtgggg gtggaacagg
     7681 agagaccctg ggagagaaat ggaaggcccg cttgaaccag atgtcggccc tggagttcta
     7741 ctcctacaaa aagtcaggca tcaccgaggt gtgcagagaa gaggcccgcc gcgccctcaa
     7801 ggacggtgtg gcaacgggag gccatgctgt gtcccgagga agtgcaaagc tgagatggtt
     7861 ggtggagcgg ggatacctgc agccctatgg aaaggtcatt gatcttggat gtggcagagg
     7921 gggctggagt tactacgtcg ccaccatccg caaagttcaa gaagtgaaag gatacacaaa
     7981 aggaggccct ggtcatgaag aacccgtgtt ggtgcaaagc tatgggtgga acatagtccg
     8041 tcttaagagt ggggtggacg tctttcatat ggcggctgag ccgtgtgaca cgttgctgtg
     8101 tgacataggt gagtcatcat ctagtcctga agtggaagaa gcacggacgc tcagagtcct
     8161 ctccatggtg ggggattggc ttgaaaaaag accaggagcc ttttgtataa aagtgttgtg
     8221 cccatacacc agcactatga tggaaaccct ggagcgactg cagcgtaggt atgggggagg
     8281 actggtcaga gtgccactct cccgcaactc tacacatgag atgtactggg tctctggagc
     8341 gaaaagcaac accataaaaa gtgtgtccac cacgagccag ctcctcttgg ggcgcatgga
     8401 cgggcctagg aggccagtga aatatgagga ggatgtgaat ctcggctctg gcacgcgggc
     8461 tgtggtaagc tgcgctgaag ctcccaacat gaagatcatt ggtaaccgca ttgaaaggat
     8521 ccgcagtgag cacgcggaaa cgtggttctt tgacgagaac cacccatata ggacatgggc
     8581 ttaccatgga agctatgagg cccccacaca agggtcagcg tcctctctaa taaacggggt
     8641 tgtcaggctc ctgtcaaaac cctgggatgt ggtgactgga gtcacaggaa tagccatgac
     8701 cgacaccaca ccgtatggtc agcaaagagt tttcaaggaa aaagtggaca ctagggtgcc
     8761 agacccccaa gaaggcactc gtcaggttat gagcatggtc tcttcctggt tgtggaaaga
     8821 gctaggcaaa cacaaacggc cacgagtctg caccaaagaa gagttcatca acaaggttcg
     8881 tagcaatgca gcattagggg caatatttga agaggaaaaa gagtggaaga ctgcagtgga
     8941 agctgtgaac gatccaaggt tctgggctct agtggacaag gaaagagagc accacctgag
     9001 aggagagtgc cagagctgtg tgtacaacat gatgggaaaa agagaaaaga aacaagggga
     9061 atttggaaag gccaagggca gccgcgccat ctggtatatg tggctagggg ctagatttct
     9121 agagttcgaa gcccttggat tcttgaacga ggatcactgg atggggagag agaactcagg
     9181 aggtggtgtt gaagggctgg gattacaaag actcggatat gtcctagaag agatgagtcg
     9241 tataccagga ggaaggatgt atgcagatga cactgctggc tgggacaccc gcattagcag
     9301 gtttgatctg gagaatgaag ctctaatcac caaccaaatg gagaaagggc acagggcctt
     9361 ggcattggcc ataatcaagt acacatacca aaacaaagtg gtaaaggtcc ttagaccagc
     9421 tgaaaaaggg aaaacagtta tggacattat ttcgagacaa gaccaaaggg ggagcggaca
     9481 agttgtcact tacgctctta acacatttac caacctagtg gtgcaactca ttcggaatat
     9541 ggaggctgag gaagttctag agatgcaaga cttgtggctg ctgcggaggt cagagaaagt
     9601 gaccaactgg ttgcagagca acggatggga taggctcaaa cgaatggcag tcagtggaga
     9661 tgattgcgtt gtgaagccaa ttgatgatag gtttgcacat gccctcaggt tcttgaatga
     9721 tatgggaaaa gttaggaagg acacacaaga gtggaaaccc tcaactggat gggacaactg
     9781 ggaagaagtt ccgttttgct cccaccactt caacaagctc catctcaagg acgggaggtc
     9841 cattgtggtt ccctgccgcc accaagatga actgattggc cgggcccgcg tctctccagg
     9901 ggcgggatgg agcatccggg agactgcttg cctagcaaaa tcatatgcgc aaatgtggca
     9961 gctcctttat ttccacagaa gggacctccg actgatggcc aatgccattt gttcatctgt
    10021 gccagttgac tgggttccaa ctgggagaac tacctggtca atccatggaa agggagaatg
    10081 gatgaccact gaagacatgc ttgtggtgtg gaacagagtg tggattgagg agaacgacca
    10141 catggaagac aagaccccag ttacgaaatg gacagacatt ccctatttgg gaaaaaggga
    10201 agacttgtgg tgtggatctc tcatagggca cagaccgcgc accacctggg ctgagaacat
    10261 taaaaacaca gtcaacatgg tgcgcaggat cataggtgat gaagaaaagt acatggacta
    10321 cctatccacc caagttcgct acttgggtga agaagggtct acacctggag tgctgtaagc
    10381 accaatctta atgttgtcag gcctgctagt cagccacagc ttggggaaag ctgtgcagcc
    10441 tgtgaccccc ccaggagaag ctgggaaacc aagcctatag tcaggccgag aacgccatgg
    10501 cacggaagaa gccatgctgc ctgtgagccc ctcagaggac actgagtcaa aaaaccccac
    10561 gcgcttggag gcgcaggatg ggaaaagaag gtggcgacct tccccaccct tcaatctggg
    10621 gcctgaactg gagatcagct gtggatctcc agaagaggga ctagtggtta gagga

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.