Sign in to follow this  
Followers 0
niman

Full Zika Sequence From November 2015 Guatemala Outbreak

5 posts in this topic

LOCUS       KU501217               10272 bp    RNA     linear   VRL 01-FEB-2016
DEFINITION  Zika virus strain 8375 polyprotein gene, complete cds.
ACCESSION   KU501217
VERSION     KU501217.1  GI:984874585
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus; Spondweni virus group.
REFERENCE   1  (bases 1 to 10272)
  AUTHORS   Lanciotti,R.S., Lambert,A.J., Holodniy,M., Saavedra,S. and del
            Carmen Castillo Signor,L.
  TITLE     Phylogeny of Zika Virus in Western Hemisphere, 2015
  JOURNAL   Emerging Infect. Dis. (2016) In press
  REMARK    Publication Status: Available-Online prior to print
            DOI: 10.3201/eid2205.160065
REFERENCE   2  (bases 1 to 10272)
  AUTHORS   Lanciotti,R.S. and del Carmen Castillo Signor,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JAN-2016) Diagnostic & Reference Laboratory,
            Arbovirus Diseases Branch, Centers for Disease Control &
            Prevention, 3150 Rampart Road, Fort Collins, CO 80521, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. V7
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10272
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="8375"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Guatemala"
                     /collection_date="01-Nov-2015"
     CDS             1..10272
                     /note="C-prM/M-E-NS1-NS2a-NS2b-NS3-NS4A-NS4B-NS5"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AMC13913.1"
                     /db_xref="GI:984874586"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEIRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRAPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIL
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLERRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSCIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 atgaaaaacc caaaaaagaa atccggagga ttccggattg tcaatatgct aaaacgcgga
       61 gtagcccgtg tgagcccctt tgggggcttg aagaggctgc cagccggact tctgctgggt
      121 catgggccca tcaggatggt cttggcgatt ctagcctttt tgagattcac ggcaatcaag
      181 ccatcactgg gtctcatcaa tagatggggt tcagtgggga aaaaagaggc tatggaaata
      241 ataaagaagt tcaagaaaga tctggctgcc atgctgagaa taatcaatgc taggaaggag
      301 aagaagagac gaggcgcaga tactagtgtc ggaattgttg gcctcctgct gaccacagct
      361 atggcagcgg aggtcactag acgtgggagt gcatactata tgtacttgga cagaaacgat
      421 gctggggagg ccatatcttt tccaaccaca ttggggatga ataagtgtta tatacagatc
      481 atggatcttg gacacatgtg tgatgccacc atgagctatg aatgccctat gctggatgag
      541 ggggtggaac cagatgacgt cgattgttgg tgcaacacga cgtcaacttg ggttgtgtac
      601 ggaacctgcc atcacaaaaa aggtgaagca cggagatcta gaagagctgt gacgctcccc
      661 tcccattcca ctaggaagct gcaaacgcgg tcgcaaacct ggttggaatc aagagaatac
      721 acaaagcact tgattagagt cgaaaattgg atattcagga accctggctt cgcgttagca
      781 gcagctgcca tcgcttggct tttgggaagc tcaacgagcc aaaaagtcat atacttggtc
      841 atgatactgc tgattgcccc ggcatacagc atcaggtgca taggagtcag caatagggac
      901 tttgtggaag gtatgtcagg tgggacttgg gttgatgttg tcttggaaca tggaggttgt
      961 gtcaccgtaa tggcacagga caaaccgact gtcgacatag agctggttac aacaacagtc
     1021 agcaacatgg cggagataag atcctactgc tatgaggcat caatatcaga catggcttcg
     1081 gacagccgct gcccaacaca aggtgaagcc taccttgaca agcaatcaga cactcaatat
     1141 gtctgcaaaa gaacgttagt ggacagaggc tggggaaatg gatgtggact ttttggcaaa
     1201 gggagcctgg tgacatgcgc taagtttgca tgctccaaga aaatgaccgg gaagagcatc
     1261 cagccagaga atctggagta ccggataatg ctgtcagttc atggctccca gcacagtggg
     1321 atgatcgtta atgacacagg acatgaaact gatgagaata gagcgaaggt tgagataacg
     1381 cccaattcac caagagccga agccaccctg gggggttttg gaagcctagg acttgattgt
     1441 gaaccgagga caggccttga cttttcagat ttgtattact tgactatgaa taacaagcac
     1501 tggttggttc acaaggagtg gttccacgac attccattac cttggcacgc tggggcagac
     1561 accggaactc cacactggaa caacaaagaa gcactggtgg agttcaagga cgcacatgcc
     1621 aaaaggcaaa ctgtcgtggt tctagggagt caagaaggag cagttcacac ggcccttgct
     1681 ggagctctgg aggctgagat ggatggtgca aagggaaggc tgtcctctgg ccacttgaaa
     1741 tgtcgcctga aaatggataa acttagattg aagggcgtgt catactcctt gtgtaccgca
     1801 gcgttcacat tcaccaagat cccggctgaa acactgcacg ggacagtcac agtggaggta
     1861 cagtacgcag ggacagatgg accttgcaag gttccagctc agatggcggt ggacatgcaa
     1921 actctgaccc cagttgggag gttgataacc gctaaccccg taatcactga aagcactgag
     1981 aactctaaga tgatgctgga acttgatcca ccatttgggg actcttacat tgtcatagga
     2041 gtcggggaga agaagatcac ccaccactgg cacaggagtg gcagcaccat tggaaaagca
     2101 tttgaagcca ctgtgagagg tgccaagaga atggcagtct tgggagacac agcctgggac
     2161 tttggatcag ttggaggcgc tctcaactca ttgggcaagg gcatccatca aatttttgga
     2221 gctgctttca aatcattgtt tggaggaatg tcctggttct cacaaattct cattggaacg
     2281 ttgctgatgt ggttgggtct gaacacaaag aatggatcta tttcccttat gtgcttggcc
     2341 ttagggggag tgttgatctt cttatccaca gccgtctctg ctgatgtggg gtgctcggtg
     2401 gacttctcaa agaaggagac gagatgcggt acaggggtgt tcgtctataa cgacgttgaa
     2461 gcctggaggg acaggtacaa gtaccatcct gactcccccc gtagattggc agcagcagtc
     2521 aagcaagcct gggaagatgg tatctgcggg atctcctctg tttcaagaat ggaaaacatc
     2581 atgtggagat cagtagaagg ggagctcaac gcaatcctgg aagagaatgg agttcaactg
     2641 acggtcgttg tgggatctgt aaaaaacccc atgtggagag ctccacagag attgcccgtg
     2701 cctgtgaacg agctgcccca cggctggaag gcttggggga aatcgtactt cgtcagagca
     2761 gcaaagacaa ataacagctt tgtcgtggat ggtgacacac tgaaggaatg cccactcaaa
     2821 catagagcat ggaacagctt tcttgtggag gatcatgggt tcggggtatt tcacactagt
     2881 gtctggctca aggttagaga agattattca ttagagtgtg atccagccgt tattggaaca
     2941 gctgttaagg gaaaggaggc tgtacacagt gatctaggct actggattga gagtgagaag
     3001 aatgacacat ggaggctgaa gagggcccat ctgatcgaga tgaaaacatg tgaatggcca
     3061 aagtcccaca cattgtggac agatggaata gaagagagtg atctgatcat acccaagtct
     3121 ttagctgggc cactcagcca tcacaatacc agagagggct acaggaccca aatgaaaggg
     3181 ccatggcaca gtgaagagct tgaaattcgg tttgaggaat gcccaggcac taaggtccac
     3241 gtggaggaaa catgtggaac aagaggacca tctctgagat caaccactgc aagcggaagg
     3301 gtgatcgagg aatggtgctg cagggagtgc acaatgcccc cactgtcgtt ccgggctaaa
     3361 gatggctgtt ggtatggaat ggagataagg cccaggaaag aaccagaaag caacttagta
     3421 aggtcaatgg tgactgcagg atcaactgat cacatggatc acttctccct tggagtgctt
     3481 gtgattctgc tcatggtgca ggaagggcta aagaagagaa tgaccacaaa gatcatcata
     3541 agcacatcaa tggcagtgct ggtagctatg atcctgggag gattttcaat gagtgacctg
     3601 gctaagcttg caattttgat gggtgccacc ttcgcggaaa tgaacactgg aggagatgta
     3661 gctcatctgg cgctgatagc ggcattcaaa gtcagaccag cgttgctggt atctttcatc
     3721 ttcagagcta attggacacc ccgtgaaagc atgctactgg ccttggcctc gtgtcttttg
     3781 caaactgcga tctccgcctt ggaaggcgac ctgatggttc tcatcaatgg ttttgctttg
     3841 gcctggttgg caatacgagc gatggttgtt ccacgcactg ataacatcac cttggcaatc
     3901 ctggctgctc tgacaccact ggcccggggc acactgcttg tggcgtggag agcaggcctt
     3961 gctacttgcg gggggtttat gctcctctct ctgaagggaa aaggcagtgt gaagaagaac
     4021 ttaccatttg tcatggccct gggactaacc gctgtgaggc tggtcgaccc catcaacgtg
     4081 gtgggactgc tgttgctcac aaggagtggg aagcggagct ggccccctag cgaagtactc
     4141 acagctgttg gcctgatatg cgcattggct ggagggttcg ccaaggcaga tatagagatg
     4201 gctgggccca tggccgcggt cggtctgcta attgtcagtt acgtggtctc aggaaagagt
     4261 gtggacatgt acattgaaag agcaggtgac atcacatggg aaaaagatgc ggaagtcact
     4321 ggaaacagtc cccggctcga tgtggcgcta gatgagagtg gtgatttctc cctggtggag
     4381 gatgacggtc cccccatgag agagatcata ctcaaggtgg tcctgatgac catctgtggc
     4441 atgaacccaa tagccatacc ctttgcagct ggagcgtggt acgtatacgt gaagactgga
     4501 aaaaggagtg gtgctctatg ggatgtgcct gctcccaagg aagtaaaaaa gggggagacc
     4561 acagatggag tgtacagagt aatgactcgt agactgctag gttcaacaca agttggagtg
     4621 ggagttatgc aagagggggt ctttcacact atgtggcacg tcacaaaagg atccgcactg
     4681 agaagcggtg aagggagact tgatccatac tggggagatg tcaagcagga tctggtgtca
     4741 tactgtggtc catggaagct agatgccgcc tgggacgggc acagcgaggt gcagctcttg
     4801 gccgtgcccc ccggagagag agcgaggaac atccagactc tgcccggaat atttaagaca
     4861 aaggatgggg acattggagc ggttgcgctg gattacccag caggaacttc aggatctcca
     4921 atcctagaca agtgtgggag agtgatagga ctttatggca atggggtcgt gatcaaaaat
     4981 gggagttatg ttagtgccat cacccaaggg aggagggagg aagagactcc tgttgagtgc
     5041 ttcgagcctt cgatgctgaa gaagaagcag ctaactgtct tagacttaca tcctggagct
     5101 gggaaaacca ggagagttct tcctgaaata gtccgtgaag ccataaaaac aagactccgt
     5161 actgtgatct tagctccaac cagggttgtc gctgctgaaa tggaggaggc ccttagaggg
     5221 cttccagtgc gttatatgac aacagcagtc aatgtcaccc actctggaac agaaatcgtc
     5281 gacttaatgt gccatgccac cttcacttca cgtctactac agccaatcag agtccccaac
     5341 tataatctgt atattatgga tgaggcccac ttcacagatc cctcaagtat agcagcaaga
     5401 ggatacattt caacaagggt tgagatgggc gaggcggctg ccatcttcat gaccgccacg
     5461 ccaccaggaa cccgtgacgc atttccggac tccaactcac caattatgga caccgaagtg
     5521 gaagtcccag agagagcctg gagctcaggc tttgattggg tgacggatca ttctggaaaa
     5581 acagtttggt ttgttccaag cgtgaggaac ggcaatgaga tcgcagcttg tctgacaaag
     5641 gctggaaaac gggtcataca gctcagcaga aagacttttg agacagagtt ccagaaaaca
     5701 aaacatcaag agtgggactt tgtcgtgaca actgacattt cagagatggg cgccaacttt
     5761 aaagctgacc gtgtcataga ttccaggaga tgcctaaagc cggtcatact tgatggcgag
     5821 agagtcattc tggctggacc catgcctgtc acacatgcca gcgctgccca gaggaggggg
     5881 cgcataggca ggaatcccaa caaacctgga gatgagtatc tgtatggagg tgggtgcgca
     5941 gagactgacg aagaccatgc acactggctt gaagcaagaa tgctccttga caatatttac
     6001 ctccaagatg gcctcatagc ctcgctctat cgacctgagg ccgacaaagt agcagccatt
     6061 gagggagagt tcaagcttag gacggagcaa aggaagacct ttgtggaact catgaaaaga
     6121 ggagatcttc ctgtttggct ggcctatcag gttgcatctg ccggaataac ctacacagat
     6181 agaagatggt gctttgatgg cacgaccaac aacaccatac tggaagacag tgtgccggca
     6241 gaggtgtgga ccagacacgg agagaaaaga gtgctcaaac cgaggtggat ggacgccaga
     6301 gtttgttcag atcatgcggc cctgaagtca ttcaaggagt ttgccgctgg gaaaagagga
     6361 gcggcttttg gagtgatgga agccttggga acactgccag gacacatgac agagagattc
     6421 caggaagcca ttgacaacct cgctgtgctc atgcgggcag agactggaag caggccttac
     6481 aaagccgcgg cggcccaatt gccggagacc ctagagacca ttatgctttt ggggttgctg
     6541 ggaacagtct cgctgggaat ctttttcgtc ttgatgagga acaagggcat agggaagatg
     6601 ggctttggaa tggtgaccct tggggccagt gcatggctca tgtggctctc ggaaattgag
     6661 ccagccagaa ttgcatgtgt cctcattgtt gtgttcctat tgctggtggt gctcatacct
     6721 gagccagaaa agcaaagatc tccccaggac aaccaaatgg caatcatcat catggtagca
     6781 gtaggtcttc tgggcttgat taccgccaat gaactcggat ggttggagag aacaaagagt
     6841 gacctaagcc atctaatggg aaggagagag gagggagcaa ccataggatt ctcaatggac
     6901 attgacctgc ggccagcctc agcttgggcc atctatgctg ccttgacaac tttcattacc
     6961 ccagccgtcc aacatgcagt gaccacttca tacaacaact actccttaat ggcgatggcc
     7021 acgcaagctg gagtgttgtt tggtatgggc aaagggatgc cattctacgc atgggacttt
     7081 ggagtcccgc tgctaatgat aggttgctac tcacaattaa cacccctgac cctaatagtg
     7141 gccatcattt tgctcgtggc gcactacatg tacttgatcc cagggctgca ggcagcagct
     7201 gcgcgtgctg cccagaagag aacggcagct ggcatcatga agaaccctgt tgtggatgga
     7261 atagtggtga ctgacattga cacaatgaca attgaccccc aagtggagaa aaagatggga
     7321 caggtgctac tcatagcagt agccgtctcc agcgccatac tgtcgcggac cgcctggggg
     7381 tggggggagg ctggggccct gatcacagcc gcaacttcca ctttgtggga aggctctccg
     7441 aacaagtact ggaactcctc tacagccact tcactgtgta acatttttag gggaagttac
     7501 ttggctggag cttctctaat ctacacagta acaagaaacg ctggcttggt caagagacgt
     7561 gggggtggaa caggagagac cctgggagag aaatggaagg cccgcttgaa ccagatgtcg
     7621 gccctggagt tctactccta caaaaagtca ggcatcactg aggtgtgcag agaagaggcc
     7681 cgccgcgccc tcaaggacgg tgtggcaacg ggaggccatg ctgtgtcccg aggaagtgca
     7741 aagctgagat ggttggtgga gcggggatac ctgcagccct atggaaaggt cattgatctt
     7801 ggatgtggca gagggggctg gagttactac gccgccacca tccgcaaagt tcaagaagtg
     7861 aaaggataca caaaaggagg ccctggtcat gaagaacccg tgttggtgca aagctatggg
     7921 tggaacatag tccgtcttaa gagtggggtg gacgtctttc atatggcggc tgagccgtgt
     7981 gacacgttgc tgtgtgacat aggcgagtca tcatctagtc ctgaagtgga agaagcacgg
     8041 acgctcagag tcctctccat ggtgggggat tggcttgaaa gaagaccagg agccttttgt
     8101 ataaaagtgt tgtgcccata caccagcact atgatggaaa ccctggagcg actgcagcgt
     8161 aggtatgggg gaggactggt cagagtgcca ctctcccgca actctacaca tgagatgtac
     8221 tgggtctctg gagcgaaaag caacaccata aaaagtgtgt ccaccacgag ccagctcctc
     8281 ttggggcgca tggacgggcc taggaggcca gtgaaatatg aggaggatgt gaatctcggc
     8341 tctggcacgc gggctgtggt aagctgcgct gaagctccca acatgaagat cattggtaac
     8401 cgcattgaaa ggatccgcag tgagcacgcg gaaacgtggt tctttgacga gaaccaccca
     8461 tataggacat gggcttacca tggaagctat gaggccccca cacaagggtc agcgtcctct
     8521 ctaataaacg gggttgtcag gctcctgtca aaaccctggg atgtggtgac tggagtcaca
     8581 ggaatagcca tgaccgacac cacaccgtat ggtcagcaaa gagttttcaa ggaaaaagtg
     8641 gacactaggg tgccagaccc ccaagaaggc actcgtcagg ttatgagcat ggtctcttcc
     8701 tggttgtgga aagagctagg caaacacaaa cggccacgag tctgtaccaa agaagagttc
     8761 atcaacaagg ttcgtagcaa tgcagcatta ggggcaatat ttgaagagga aaaagagtgg
     8821 aagactgcag tggaagctgt gaacgatcca aggttctggg ctctagtgga caaggaaaga
     8881 gagcaccacc tgagaggaga gtgccagagt tgtgtgtaca acatgatggg aaaaagagaa
     8941 aagaaacaag gggaatttgg aaaggccaag ggcagccgcg ccatctggta tatgtggcta
     9001 ggggctagat ttctagagtt cgaagccctt ggattcttga acgaggatca ctggatgggg
     9061 agagagaact caggaggtgg tgttgaaggg ctgggattac aaagactcgg atatgtccta
     9121 gaagagatga gttgcatacc aggaggaagg atgtatgcag atgacactgc tggctgggac
     9181 acccgcatca gcaggtttga tctggagaat gaagctctaa tcaccaacca aatggagaaa
     9241 gggcacaggg ccttggcatt ggccataatc aagtacacat accaaaacaa agtggtaaag
     9301 gtccttagac cagctgaaaa agggaaaaca gttatggaca ttatttcaag acaagaccaa
     9361 agggggagcg gacaagttgt cacttacgct cttaacacat ttaccaacct agtggtgcaa
     9421 ctcattcgga atatggaggc tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg
     9481 aggtcagaga aagtgaccaa ctggttgcag agcaacggat gggataggct caaacgaatg
     9541 gcagtcagtg gagatgattg cgttgtgaag ccaattgatg ataggtttgc acatgccctc
     9601 aggttcttga atgatatggg aaaagttagg aaggacacac aagagtggaa accctcaact
     9661 ggatgggaca actgggaaga agttccgttt tgctcccacc acttcaacaa gctccatctc
     9721 aaggacggga ggtccattgt ggttccctgc cgccaccaag atgaactgat tggccgggcc
     9781 cgcgtctctc caggggcggg atggagcatc cgggagactg cttgcctagc aaaatcatat
     9841 gcgcaaatgt ggcagctcct ttatttccac agaagggacc tccgactgat ggccaatgcc
     9901 atttgttcat ctgtgccagt tgactgggtt ccaactggga gaactacctg gtcaatccat
     9961 ggaaagggag aatggatgac cactgaagac atgcttgtgg tgtggaacag agtgtggatt
    10021 gaggagaacg accacatgga agacaagacc ccagttacga aatggacaga cattccctat
    10081 ttgggaaaaa gggaagactt gtggtgtgga tctctcatag ggcacagacc gcgcaccacc
    10141 tgggctgaga acattaaaaa cacagtcaac atggtgcgca ggatcatagg tgatgaagaa
    10201 aagtacatgg actacctatc cacccaagtt cgctacttgg gtgaagaagg gtctacacct
    10261 ggagtgctgt aa

Share this post


Link to post
Share on other sites

Volume 22, Number 5—May 2016

Letter

Phylogeny of Zika Virus in Western Hemisphere, 2015

Robert S. LanciottiComments to Author , Amy J. Lambert, Mark Holodniy, Sonia Saavedra, and Leticia del Carmen Castillo Signor
Author affiliations: Centers for Disease Control and Prevention, Fort Collins, Colorado, USA (R.S. Lanciotti, A.J. Lambert)Department of Veterans Affairs, Palo Alto, California, USA (M. Holodniy)VA Caribbean Health Care System, San Juan, Puerto Rico, USA (S. Saavedra)Laboratorio Nacional de Salud Guatemala, Villa Nueva, Guatemala (L. del Carmen Castillo Signor)

Main Article

Figure

Phylogenetic tree of Zika virus isolates identified from Guatemala and Puerto Rico in December 2015 (indicated in boldface) compared with reference isolates obtained from GenBank. The isolates from Guatemala and Puerto Rico grouped with other Asian genotype viruses. The tree was derived by neighbor-joining methods (bootstrapped 1,000 times) using complete-genome sequences. Location, year identified, and GenBank strain identification for the viruses used in tree construction are shown. Scale bar

Figure. Phylogenetic tree of Zika virus isolates identified from Guatemala and Puerto Rico in December 2015 (indicated in boldface) compared with reference isolates obtained from GenBank. The isolates from Guatemala and Puerto Rico grouped with other Asian genotype viruses. The tree was derived by neighbor-joining methods (bootstrapped 1,000 times) using complete-genome sequences. Location, year identified, and GenBank strain identification for the viruses used in tree construction are shown. Scale bar indicates number of nucleotide substitutions per site. GenBank accession nos.: KU321639 (Brazil 2015 SPH2015), KJ776791 (French Polynesia H/PF/2013), KF383115 (Central African Republic ARB1362), KF383116 (Senegal 1968 ArD7117), KF383117 (Senegal 1997 ArD128000), KF383118 (Senegal 2001 ArD157995), KF383119 (Senegal 2001 ArD158084), KF268948 (CAR 1979 ARB13565), KF268949 (CAR 1980 ARB15076), KF268950 (CAR 1976 ARB7701), EU545988 (Yap 2007), KF993678 (Thailand 2013 PLCal_ZV), JN860885 (Cambodia 2010 FSS13025), HQ234499 (Malaysia 1966 P6-740), HQ234501 (Senegal 1984 ArD41519), HQ234500 (Nigeria 1968 IbH 30656), LC002520 (Uganda 1947 MR766), KU501215 (Puerto Rico PRVABC59), KU501216 (Guatemala 8375), and KU501217 (Guatemala 103344).

Share this post


Link to post
Share on other sites
equences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1839318393100%0.099%KJ776791.1
1838418384100%0.099%KU365779.1
1838418384100%0.099%KU321639.1
1837218372100%0.099%KU365780.1
1836618366100%0.099%KU365777.1
1835418354100%0.099%KU365778.1
1835418354100%0.099%KU312312.1
177621776299%0.098%JN860885.1
177061770698%0.099%KF993678.1
1759817598100%0.098%EU545988.1
164291642999%0.095%HQ234499.1

Share this post


Link to post
Share on other sites

Update

Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1852518525100%0.0100%KU501217.1
1852018520100%0.099%KU501216.1
1839918399100%0.099%KU509998.1
1839318393100%0.099%KJ776791.1
1838418384100%0.099%KU365779.1
1838418384100%0.099%KU321639.1
1837218372100%0.099%KU365780.1
1836618366100%0.099%KU365777.1
1835718357100%0.099%KU647676.1
1835418354100%0.099%KU365778.1
1835418354100%0.099%KU312312.1
1834518345100%0.099%KU501215.1
177621776299%0.098%JN860885.1
177061770698%0.099%KF993678.1
1759817598100%0.098%EU545988.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.