Sign in to follow this  
Followers 0
niman

Full Zika Sequence From December 2014 Haiti Outbreak

3 posts in this topic

LOCUS       KU509998               10676 bp    RNA     linear   VRL 02-FEB-2016
DEFINITION  Zika virus strain Haiti/1225/2014, complete genome.
ACCESSION   KU509998
VERSION     KU509998.1  GI:983657312
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus; Spondweni virus group.
REFERENCE   1  (bases 1 to 10676)
  AUTHORS   Lednicky,J.A., Morris,J.G. Jr., Beau De Rochars,V.M., Elbadry,M.A.,
            Okech,B.A. and Loeb,J.C.
  TITLE     Zika virus from a Haitian, December 2014
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10676)
  AUTHORS   Lednicky,J.A., Morris,J.G. Jr., Beau De Rochars,V.M., Elbadry,M.A.,
            Okech,B.A. and Loeb,J.C.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JAN-2016) Environmental and Global Health, University
            of Florida - Gainesville, 1225 Center Drive, Room 4155,
            Gainesville, FL 32610, USA
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10676
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="Haiti/1225/2014"
                     /isolation_source="plasma"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Haiti"
                     /collection_date="12-Dec-2014"
                     /note="genotype: Asian"
     5'UTR           1..105
     CDS             106..10377
                     /note="contains structural and non-structural proteins"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AMB37295.1"
                     /db_xref="GI:983657313"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SHFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDYSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATMGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLMAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
     mat_peptide     106..480
                     /product="capsid protein"
     mat_peptide     481..750
                     /product="propeptide"
     mat_peptide     751..975
                     /product="membrane protein"
     mat_peptide     2491..3576
                     /product="NS1"
     mat_peptide     3577..4230
                     /product="NS2A"
     mat_peptide     4231..4662
                     /product="NS2B"
     mat_peptide     4663..6471
                     /product="NS3"
     mat_peptide     6472..6912
                     /product="NS4A"
     mat_peptide     6913..8418
                     /product="NS4B"
     mat_peptide     8419..10374
                     /product="NS5"
     3'UTR           10378..10676
ORIGIN      
        1 gttgttactg ttgctgactc agactgcgac agttcgagtt tgaagcgaaa gctagcaaca
       61 gtatcaacag gttttatttg gatttggaaa cgagagtttc tggtcatgaa aaacccaaaa
      121 aagaaatccg gaggattccg gattgtcaat atgctaaaac gcggagtagc ccgtgtgagc
      181 ccctttgggg gcttgaagag gctgccagcc ggacttctgc tgggtcatgg gcccatcagg
      241 atggtcttgg caattctagc ctttttgaga ttcacggcaa tcaagccatc actgggtctc
      301 atcaatagat ggggttcagt ggggaaaaaa gaggctatgg aaataataaa gaagttcaag
      361 aaagatctgg ctgccatgct gagaataatc aatgctagga aggagaagaa gagacgaggc
      421 gcagatacta gtgtcggaat tgttggcctc ctgctgacca cagctatggc agcggaggtc
      481 actagacgtg ggagtgcata ctatatgtac ttggacagaa acgatgctgg ggaggccata
      541 tcttttccaa ccacattggg gatgaataag tgttatatac agatcatgga tcttggacac
      601 atgtgtgatg ccaccatgag ctatgaatgc cctatgctgg atgagggggt ggaaccagat
      661 gacgtcgatt gttggtgcaa cacgacgtca acttgggttg tgtacggaac ctgccatcac
      721 aaaaaaggtg aagcacggag atctagaaga gctgtgacgc tcccctccca ttccactagg
      781 aagctgcaaa cgcggtcgca aacctggttg gaatcaagag aatacacaaa gcacttgatt
      841 agagtcgaaa attggatatt caggaaccct ggcttcgcgt tagcagcagc tgccatcgct
      901 tggcttttgg gaagctcaac gagccaaaaa gtcatatact tggtcatgat actgctgatt
      961 gccccggcat acagcatcag gtgcatagga gtcagcaata gggactttgt ggaaggtatg
     1021 tcaggtggga cttgggttga tgttgtcttg gaacatggag gttgtgtcac cgtaatggca
     1081 caggacaaac cgactgtcga catagagctg gttacaacaa cagtcagcaa catggcggag
     1141 gtaagatcct actgctatga ggcatcaata tcagacatgg cttcggacag ccgctgccca
     1201 acacaaggtg aagcctacct tgacaagcaa tcagacactc aatatgtctg caaaagaacg
     1261 ttagtggaca gaggctgggg aaatggatgt ggactttttg gcaaagggag tctggtgaca
     1321 tgcgctaagt ttgcatgctc caagaaaatg accgggaaga gcatccagcc agagaatctg
     1381 gagtaccgga taatgctgtc agttcatggc tcccagcaca gtgggatgat cgttaatgac
     1441 acaggacatg aaactgatga gaatagagcg aaggttgaga taacgcccaa ttcaccaaga
     1501 gccgaagcca ccctgggggg ttttggaagc ctaggacttg attgtgaacc gaggacaggc
     1561 cttgactttt cagatttgta ttacttgact atgaataaca agcactggtt ggttcacaag
     1621 gagtggttcc acgacattcc attaccttgg cacgctgggg cagacaccgg aactccacac
     1681 tggaacaaca aagaagcact ggtagagttc aaggacgcac atgccaaaag gcaaactgtc
     1741 gtggttctag ggagtcaaga aggagcagtt cacacggccc ttgctggagc tctggaggct
     1801 gagatggatg gtgcaaaggg aaggctgtcc tctggccact tgaaatgtcg cctgaaaatg
     1861 gataaactta gattgaaggg cgtgtcatac tccttgtgta ccgcagcgtt cacattcacc
     1921 aagatcccgg ctgaaacact gcacgggaca gtcacagtgg aggtacagta cgcagggaca
     1981 gatggacctt gcaaggttcc agctcagatg gcggtggaca tgcaaactct gaccccagtt
     2041 gggaggttga taaccgctaa ccccgtaatc actgaaagca ctgagaactc taagatgatg
     2101 ctggaacttg atccaccatt tggggactct tacattgtca taggagtcgg ggagaagaag
     2161 atcacccacc actggcacag gagtggcagc accattggaa aagcatttga agccactgtg
     2221 agaggtgcca agagaatggc agtcttggga gacacagcct gggactttgg atcagttgga
     2281 ggcgctctca actcattggg caagggcatc catcaaattt ttggagcagc tttcaaatca
     2341 ttgtttggag gaatgtcctg gttctcacaa attctcattg gaacgttgct gatgtggttg
     2401 ggtctgaaca caaagaatgg atctatttcc cttatgtgct tggccttagg gggagtgttg
     2461 atcttcttat ccacagccgt ctctgctgat gtggggtgct cggtggactt ctcaaagaag
     2521 gagacgagat gcggtacagg ggtgttcgtc tataacgacg ttgaagcctg gagggacagg
     2581 tacaagtacc atcctgactc cccccgtaga ttggcagcag cagtcaagca agcctgggaa
     2641 gatggtatct gcgggatctc ctctgtttca agaatggaaa acatcatgtg gagatcagta
     2701 gaaggggagc tcaacgcaat cctggaagag aatggagttc aactgacggt cgttgtggga
     2761 tctgtaaaaa accccatgtg gagaggtcca cagagattgc ccgtgcctgt gaacgagctg
     2821 ccccacggct ggaaggcttg ggggaaatcg cacttcgtca gagcagcaaa gacaaataac
     2881 agctttgtcg tggatggtga cacactgaag gaatgcccac tcaaacatag agcatggaac
     2941 agctttcttg tggaggatca tgggttcggg gtatttcaca ctagtgtctg gctcaaggtt
     3001 agagaagatt attcattaga gtgtgatcca gccgttattg gaacagctgt taagggaaag
     3061 gaggctgtac acagtgatct aggctactgg attgagagtg agaagaatga cacatggagg
     3121 ctgaagaggg cccatctgat cgagatgaaa acatgtgaat ggccaaagtc ccacacattg
     3181 tggacagatg gaatagaaga gagtgatctg atcataccca agtctttagc tgggccactc
     3241 agccatcaca ataccagaga gggctacagg acccaaatga aagggccatg gcacagtgaa
     3301 gagcttgaaa ttcggtttga ggaatgccca ggcactaagg tccacgtgga ggaaacatgt
     3361 ggaacaagag gaccatctct gagatcaacc actgcaagcg gaagggtgat cgaggaatgg
     3421 tgctgcaggg agtgcacaat gcccccactg tcgttccggg ctaaagatgg ctgttggtat
     3481 ggaatggaga taaggcccag gaaagaacca gaaagcaact tagtaaggtc aatggtgact
     3541 gcaggatcaa ctgatcacat ggatcacttc tcccttggag tgcttgtgat tctgctcatg
     3601 gtgcaggaag ggctgaagaa gagaatgacc acaaagatca tcataagcac atcaatggca
     3661 gtgctggtag ctatgatcct gggaggattt tcaatgagtg acctggctaa gcttgcaatt
     3721 ttgatgggtg ccaccttcgc ggaaatgaac actggaggag atgtagctca tctggcgctg
     3781 atagcggcat tcaaagtcag accagcgttg ctggtatctt tcatcttcag agctaattgg
     3841 acaccccgtg aaagcatgct gctggccttg gcctcgtgtc ttttgcaaac tgcgatctcc
     3901 gccttggaag gcgacctgat ggttctcatc aatggttttg ctttggcctg gttggcaata
     3961 cgagcgatgg ttgttccacg cactgataac atcaccttgg caatcctggc tgctctgaca
     4021 ccactggccc ggggcacact gcttgtggcg tggagagcag gccttgctac ttgcgggggg
     4081 tttatgctcc tctctctgaa gggaaaaggc agtgtgaaga agaacttacc atttgtcatg
     4141 gccctgggac taaccgctgt gaggctggtc gaccccatca acgtggtggg gctgctgttg
     4201 ctcacaagga gtgggaagcg gagctggccc cctagcgaag tactcacagc tgttggcctg
     4261 atatgcgcat tggctggagg gttcgccaag gcagatatag agatggctgg gcccatggcc
     4321 gcggtcggtc tgctaattgt cagttacgtg gtctcaggaa agagtgtgga catgtacatt
     4381 gaaagagcag gtgacatcac atgggaaaaa gatgcggaag tcactggaaa cagtccccgg
     4441 ctcgatgtgg cgctagatga gagtggtgat ttctccctgg tggaggatga cggtcccccc
     4501 atgagagaga tcatactcaa ggtggtcctg atgaccatct gtggcatgaa cccaatagcc
     4561 ataccctttg cagctggagc gtggtacgta tacgtgaaga ctggaaaaag gagtggtgct
     4621 ctatgggatg tgcctgctcc caaggaagta aaaaaggggg agaccacaga tggagtgtac
     4681 agagtaatga ctcgtagact gctaggttca acacaagttg gagtgggagt tatgcaagag
     4741 ggggtctttc acactatgtg gcacgtcaca aaaggatccg cgctgagaag cggtgaaggg
     4801 agacttgatc catactgggg agatgtcaag caggatctgg tgtcatactg tggtccatgg
     4861 aagctagatg ccgcctggga cgggcacagc gaggtgcagc tcttggccgt gccccccgga
     4921 gagagagcga ggaacatcca gactctgccc ggaatattta agacaaagga tggggacatt
     4981 ggagcggttg cgctggatta cccagcagga acttcaggat ctccaatcct agacaagtgt
     5041 gggagagtga taggacttta tggcaatggg gtcgtgatca aaaatgggag ttatgttagt
     5101 gccatcaccc aagggaggag ggaggaagag actcctgttg agtgcttcga gccttcgatg
     5161 ctgaagaaga agcagctaac tgtcttagac ttgcatcctg gagctgggaa aaccaggaga
     5221 gttcttcctg aaatagtccg tgaagccata aaaacaagac tccgtactgt gatcttagct
     5281 ccaaccaggg ttgtcgctgc tgaaatggag gaagccctta gagggcttcc agtgcgttat
     5341 atgacaacag cagtcaatgt cacccactct ggaacagaaa tcgtcgactt aatgtgccat
     5401 gccaccttca cttcacgtct actacagcca atcagagtcc ccaactataa tctgtatatt
     5461 atggatgagg cccacttcac agatccctca agtatagcag caagaggata catttcaaca
     5521 agggttgaga tgggcgaggc ggctgccatc ttcatgaccg ccacgccacc aggaacccgt
     5581 gacgcatttc cggactccaa ctcaccaatt atggacaccg aagtggaagt cccagagaga
     5641 gcctggagct caggctttga ttgggtgacg gattattctg gaaaaacagt ttggtttgtt
     5701 ccaagcgtga ggaacggcaa tgagatcgca gcttgtctga caaaggctgg aaaacgggtc
     5761 atacagctca gcagaaagac ttttgagaca gagttccaga aaacaaaaca tcaagagtgg
     5821 gactttgtcg tgacaactga catttcagag atgggcgcca actttaaagc tgaccgtgtc
     5881 atagattcca ggagatgcct aaagccggtc atacttgatg gcgagagagt cattctggct
     5941 ggacccatgc ctgtcacaca tgccagcgct gcccagagga gggggcgcat aggcaggaat
     6001 cccaacaaac ctggagatga gtatctgtat ggaggtgggt gcgcagagac tgacgaagac
     6061 catgcacact ggcttgaagc aagaatgctc cttgacaata tttacctcca agatggcctc
     6121 atagcctcgc tctatcgacc tgaggccgac aaagtagcag ccattgaggg agagttcaag
     6181 cttaggacgg agcaaaggaa gacctttgtg gaactcatga aaagaggaga tcttcctgtt
     6241 tggctggcct atcaggttgc atctgccgga ataacctaca cagatagaag atggtgcttt
     6301 gatggcacga ccaacaacac cataatggaa gacagtgtgc cggcagaggt gtggaccaga
     6361 cacggagaga aaagagtgct caaaccgagg tggatggacg ccagagtttg ttcagatcat
     6421 gcggccctga agtcattcaa ggagtttgcc gctgggaaaa gaggagcggc ttttggagtg
     6481 atggaagccc tgggaacact gccaggacac atgacagaga gattccagga agccattgac
     6541 aacctcgctg tgctcatgcg ggcagagact ggaagcaggc cttacaaagc cgcggcggcc
     6601 caattgccgg agaccctaga gaccattatg cttttggggt tgctgggaac agtctcgctg
     6661 ggaatctttt tcgtcttgat gaggaacaag ggcataggga agatgggctt tggaatggtg
     6721 actcttgggg ccagcgcatg gctcatgtgg ctctcggaaa ttgagccagc cagaattgca
     6781 tgtgtcctca ttgttgtgtt cctattgctg gtggtgctca tacctgagcc agaaaagcaa
     6841 agatctcccc aggacaacca aatggcaatc atcatcatgg tagcagtagg tcttctgggc
     6901 ttgattaccg ccaatgaact cggatggttg gagagaacaa agagtgacct aagccatcta
     6961 atgggaagga gagaggaggg ggcaaccatg ggattctcaa tggacattga cctgcggcca
     7021 gcctcagctt gggccatcta tgctgccttg acaactttca ttaccccagc cgtccaacat
     7081 gcagtgacca cttcatacaa caactactcc ttaatggcga tggccacgca agctggagtg
     7141 ttgtttggta tgggcaaagg gatgccattc tacgcatggg actttggagt cccgctgcta
     7201 atgataggtt gctactcaca attaacgccc ctgaccctaa tagtggccat cattttgctc
     7261 gtggcgcact acatgtactt gatcccaggg ctgcaggcag cagctgcgcg tgctgcccag
     7321 aagagaacgg cagctggcat catgaagaac cctgttgtgg atggaatagt ggtgactgac
     7381 attgacacaa tgacaattga cccccaagtg gagaaaaaga tgggacaggt gctactcatg
     7441 gcagtagccg tctccagcgc catactgtcg cggaccgcct gggggtgggg ggaggctggg
     7501 gccctgatca cagccgcaac ttccactttg tgggaaggct ctccgaacaa gtactggaac
     7561 tcctctacag ccacttcact gtgtaacatt tttaggggaa gttacttggc tggagcttct
     7621 ctaatctaca cagtaacaag aaacgctggc ttggtcaaga gacgtggggg tggaacagga
     7681 gagaccctgg gagagaaatg gaaggcccgc ttgaaccaga tgtcggccct ggagttctac
     7741 tcctacaaaa agtcaggcat caccgaggtg tgcagagaag aggcccgccg cgccctcaag
     7801 gacggtgtgg caacgggagg ccatgctgtg tcccgaggaa gtgcaaagct gagatggttg
     7861 gtggagcggg gatacctgca gccctatgga aaggtcattg atcttggatg tggcagaggg
     7921 ggctggagtt actacgccgc caccatccgc aaagttcaag aagtgaaagg atacacaaaa
     7981 ggaggccctg gtcatgaaga acccgtgttg gtgcaaagct atgggtggaa catagtccgt
     8041 cttaagagtg gggtggacgt ctttcatatg gcggctgagc cgtgtgacac gttgctgtgt
     8101 gacataggtg agtcatcatc tagtcctgaa gtggaagaag cacggacgct cagagtcctc
     8161 tccatggtgg gggattggct tgaaaaaaga ccaggagcct tttgtataaa agtgttgtgc
     8221 ccatacacca gcactatgat ggaaaccctg gagcgactgc agcgtaggta tgggggagga
     8281 ctggtcagag tgccactctc ccgcaactct acacatgaga tgtactgggt ctctggagcg
     8341 aaaagcaaca ccataaaaag tgtgtccacc acgagccagc tcctcttggg gcgcatggac
     8401 gggcctagga ggccagtgaa atatgaggag gatgtgaatc tcggctctgg cacgcgggct
     8461 gtggtaagct gcgctgaagc tcccaacatg aagatcattg gtaaccgcat tgaaaggatc
     8521 cgcagtgagc acgcggaaac gtggttcttt gacgagaacc acccatatag gacatgggct
     8581 taccatggaa gctatgaggc ccccacacaa gggtcagcgt cctctctaat aaacggggtt
     8641 gtcaggctcc tgtcaaaacc ctgggatgtg gtgactggag tcacaggaat agccatgacc
     8701 gacaccacac cgtatggtca gcaaagagtt ttcaaggaaa aagtggacac tagggtgcca
     8761 gacccccaag aaggcactcg tcaggttatg agcatggtct cttcctggtt gtggaaagag
     8821 ctaggcaaac acaaacggcc acgagtctgt accaaagaag agttcatcaa caaggttcgt
     8881 agcaatgcag cattaggggc aatatttgaa gaggaaaaag agtggaagac tgcagtggaa
     8941 gctgtgaacg atccaaggtt ctgggctcta gtggacaagg aaagagagca ccacctgaga
     9001 ggagagtgcc agagttgtgt gtacaacatg atgggaaaaa gagaaaagaa acaaggggaa
     9061 tttggaaagg ccaagggcag ccgcgccatc tggtatatgt ggctaggggc tagatttcta
     9121 gagttcgaag cccttggatt cttgaacgag gatcactgga tggggagaga gaactcagga
     9181 ggtggtgttg aagggctggg attacaaaga ctcggatatg tcctagaaga gatgagtcgc
     9241 ataccaggag gaaggatgta tgcagatgac actgctggct gggacacccg catcagcagg
     9301 tttgatctgg agaatgaagc tctaatcacc aaccaaatgg agaaagggca cagggccttg
     9361 gcattggcca taatcaagta cacataccaa aacaaagtgg taaaggtcct tagaccagct
     9421 gaaaaaggga agacagttat ggacattatt tcgagacaag accaaagggg gagcggacaa
     9481 gttgtcactt acgctcttaa cacatttacc aacctagtgg tgcaactcat tcggaatatg
     9541 gaggctgagg aagttctaga gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg
     9601 accaactggt tgcagagcaa cggatgggat aggctcaaac gaatggcagt cagtggagat
     9661 gattgcgttg tgaagccaat tgatgatagg tttgcacatg ccctcaggtt cttgaatgat
     9721 atgggaaaag ttaggaagga cacacaagag tggaaaccct caactggatg ggacaactgg
     9781 gaagaagttc cgttttgctc ccaccacttc aacaagctcc atctcaagga cgggaggtcc
     9841 attgtggttc cctgccgcca ccaagatgaa ctgattggcc gggcccgcgt ctctccaggg
     9901 gcgggatgga gcatccggga gactgcttgc ctagcaaaat catatgcgca aatgtggcag
     9961 ctcctttatt tccacagaag ggacctccga ctgatggcca atgccatttg ttcatctgtg
    10021 ccagttgact gggttccaac tgggagaact acctggtcaa tccatggaaa gggagaatgg
    10081 atgaccactg aagacatgct tgtggtgtgg aacagagtgt ggattgagga gaacgaccac
    10141 atggaagaca agaccccagt tacgaaatgg acagacattc cctatttggg aaaaagggaa
    10201 gacttgtggt gtggatctct catagggcac agaccgcgca ccacctgggc tgagaacatt
    10261 aaaaacacag tcaacatggt gcgcaggatc ataggtgatg aagaaaagta catggactac
    10321 ctatccaccc aagttcgcta cttgggtgaa gaagggtcta cacctggagt gctgtaagca
    10381 ccaatcttaa tgttgtcagg cctgctagtc agccacagct tggggaaagc tgtgcagcct
    10441 gtgacccccc caggagaagc tgggaaacca agcctatagt caggccgaga acgccatggc
    10501 acggaagaag ccatgctgcc tgtgagcccc tcagaggaca ctgagtcaaa aaaccccacg
    10561 cgcttggagg cgcaggatgg gaaaagaagg tggcgacctt ccccaccctt caatctgggg
    10621 cctgaactgg agatcagctg tggatctcca gaagagggac tagtggttag aggaga

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1923019230100%0.099%KU321639.1
190981909899%0.099%KU365779.1
190891908999%0.099%KU365780.1
190801908099%0.099%KU365777.1
190641906499%0.099%KU365778.1
190571905799%0.099%KJ776791.1
185651856597%0.099%KU312312.1
177981779896%0.098%JN860885.1
177511775194%0.099%KF993678.1
176431764396%0.098%EU545988.1
164661646696%0.096%HQ234499.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.