Sign in to follow this  
Followers 0
niman

Zika Sequence From October 2015 Queretaro Mexico

9 posts in this topic

LOCUS       KU556802                 749 bp    RNA     linear   VRL 02-FEB-2016
DEFINITION  Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds.
ACCESSION   KU556802
VERSION     KU556802.1  GI:984943318
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus; Spondweni virus group.
REFERENCE   1  (bases 1 to 749)
  AUTHORS   Diaz-Quinonez,J.A., Vazquez-Pichardo,M., Nunez-Leon,A.,
            Torres-Rodriguez,M.L., Escobar-Escamilla,N., Wong-Arambula,C.,
            Torres-Longoria,B., Lopez-Martinez,I., Ruiz-Matus,C.,
            Kuri-Morales,P.A. and Ramirez-Gonzalez,J.E.
  TITLE     Identification of Zika Virus in Mexico
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 749)
  AUTHORS   Vazquez-Pichardo,M., Nunez-Leon,A., Torres-Rodriguez,M.L.,
            Rosales-Jimenez,C., Torres-Olmos,Y.A., Perez-Meza,R.,
            Aparicio-Antonio,A.M., Herrera-Bautista,R.M., Wong-Arambula,C.,
            Rodriguez-Maldonado,A.P., Escobar-Escamilla,N., Torres-Longoria,B.,
            Lopez-Martinez,I., Ramirez-Gonzalez,J.E. and Diaz-Quinonez,J.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JAN-2016) Biologia Molecular y Validacion de
            Tecnicas, Instituto de Diagnostico y Referencia Epidemiologicos
            (InDRE), Francisco de P. Miranda 177 Col. Lomas de Plateros,
            Mexico, DF 01480, Mexico
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..749
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="MEX/InDRE/14/2015"
                     /isolation_source="serum"
                     /host="Homo sapiens; 26 years old male"
                     /db_xref="taxon:64320"
                     /country="Mexico: Queretaro"
                     /collection_date="22-Oct-2015"
     CDS             <1..>749
                     /codon_start=1
                     /product="NS5 protein"
                     /protein_id="AMC39589.1"
                     /db_xref="GI:984943319"
                     /translation="FEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGR
                     MYADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKG
                     KTVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVT
                     NWLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDN
                     WEEVPFCSHHFNKLHLKDGRSIVVPCRHQDEL"
ORIGIN      
        1 ttcgaagccc ttggattctt gaacgaggat cactggatgg ggagagagaa ctcaggaggt
       61 ggtgttgaag ggctgggatt acaaagactc ggatatgtcc tagaagagat gagtcgcata
      121 ccaggaggaa ggatgtatgc agatgacact gctggctggg acacccgcat cagcaggttt
      181 gatctggaga atgaagctct aatcaccaac caaatggaga aagggcacag ggccttggca
      241 ttggccataa tcaagtacac ataccaaaac aaagtggtaa aggtccttag accagctgaa
      301 aaagggaaaa cagttatgga cattatttcg agacaagacc aaagggggag cggacaagtt
      361 gtcacttacg ctcttaacac atttaccaac ctagtggtgc aactcattcg gaatatggag
      421 gctgaggaag ttctagagat gcaagacttg tggctgctgc ggaggtcaga gaaagtgacc
      481 aactggttgc agagcaacgg atgggatagg ctcaaacgaa tggcagtcag tggagatgat
      541 tgcgttgtga agccaattga tgataggttt gcacatgccc tcaggttctt gaatgatatg
      601 ggaaaagtta ggaaggacac acaagagtgg aaaccctcaa ctggatggga caactgggaa
      661 gaagttccgt tttgctccca ccacttcaac aagctccatc tcaaggacgg gaggtccatt
      721 gtggttccct gccgccacca agatgaact

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
13781378100%0.099%KU321639.1
13781378100%0.099%KM078936.1
13781378100%0.099%KJ776791.1
13751375100%0.099%KM078961.1
13731373100%0.099%KU365780.1
13731373100%0.099%KU365779.1
13731373100%0.099%KU365777.1
13731373100%0.099%KM078930.1
13691369100%0.099%KM078971.1
13691369100%0.099%KM078970.1
13691369100%0.099%KM078933.1
13671367100%0.099%KU365778.1
13671367100%0.099%KU312312.1
13671367100%0.099%KM078929.1
13511351100%0.099%KF993678.1
1347134797%0.099%KJ873160.1
13171317100%0.098%JN860885.1
13121312100%0.098%EU545988.1
1266126691%0.099%KJ873161.1
1140114099%0.094%HQ234499.1
1051105177%0.099%KM851039.1
1013101377%0.098%KM851038.1

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
13521352100%0.0100%KU556802.1
13521352100%0.0100%KU647676.1
13461346100%0.099%KU509998.1
13461346100%0.099%KU321639.1
13461346100%0.099%KM078936.1
13461346100%0.099%KJ776791.1
13441344100%0.099%KM078961.1
13421342100%0.099%KU501217.1
13421342100%0.099%KU501216.1
13421342100%0.099%KU501215.1
13421342100%0.099%KU365780.1
13421342100%0.099%KU365779.1
13421342100%0.099%KU365777.1
13421342100%0.099%KM078930.1
13391339100%0.099%KM078971.1
13391339100%0.099%KM078970.1
13391339100%0.099%KM078933.1
13371337100%0.099%KU365778.1
13371337100%0.099%KU312312.1
13371337100%0.099%KM078929.1
13241324100%0.099%KF993678.1
1315131597%0.099%KJ873160.1
12971297100%0.098%JN860885.1
12921292100%0.098%EU545988.1
1236123691%0.099%KJ873161.1

Share this post


Link to post
Share on other sites
LOCUS       KU686218                1275 bp    RNA     linear   VRL 09-FEB-2016
DEFINITION  Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds.
ACCESSION   KU686218
VERSION     KU686218.1  GI:987894543
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus; Spondweni virus group.
REFERENCE   1  (bases 1 to 1275)
  AUTHORS   Diaz-Quinonez,J.A., Vazquez-Pichardo,M., Nunez-Leon,A.,
            Torres-Rodriguez,M.L., Garces-Ayala,F., Mendieta-Condado,E.R.,
            Escobar-Escamilla,N., Torres-Longoria,B., Lopez-Martinez,I.,
            Ruiz-Matus,C., Kuri-Morales,P.A. and Ramirez-Gonzalez,J.E.
  TITLE     Identification of Zika Virus in Mexico
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1275)
  AUTHORS   Vazquez-Pichardo,M., Nunez-Leon,A., Torres-Rodriguez,M.L.,
            Rosales-Jimenez,C., Torres-Olmos,Y.A., Perez-Meza,R.,
            Aparicio-Antonio,A.M., Herrera-Bautista,R.M., Ortiz-Alcantara,J.M.,
            Gonzalez-Duran,E., Garces-Ayala,F., Mendieta-Condado,E.R.,
            Escobar-Escamilla,N., Torres-Longoria,B., Lopez-Martinez,I.,
            Ramirez-Gonzalez,J.E. and Diaz-Quinonez,J.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-FEB-2016) Biologia Molecular y Validacion de
            Tecnicas, Instituto de Diagnostico y Referencia Epidemiologicos
            (InDRE), Francisco de P. Miranda 177 Col. Lomas de Plateros,
            Mexico, DF 01480, Mexico
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: TMAP v. 4.2.18
            Coverage              :: 760X
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1275
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="MEX/InDRE/14/2015"
                     /isolation_source="serum"
                     /host="Homo sapiens; 26 years old male"
                     /db_xref="taxon:64320"
                     /country="Mexico: Queretaro"
                     /collection_date="22-Oct-2015"
     CDS             99..>1275
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AME17087.1"
                     /db_xref="GI:987894544"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGAETSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASPSRCPTQAAAYLDKQSDTQYVCKRTLVDSDWG
                     "
     mat_peptide     474..743
                     /product="propeptide"
     mat_peptide     744..968
                     /product="membrane protein"
     mat_peptide     969..1274
                     /product="envelope protein"
ORIGIN      
        1 ctgttgctgc ttcagactgc gacagttcga gtttgaagcg aaagctagca acagtatcaa
       61 caggttttat ttggatttgg aaacgagagt ttctggtcat gaaaaaccca aaaaagaaat
      121 ccggaggatt ccggattgtc aatatgctaa aacgcggagt agcccgtgtg agcccctttg
      181 ggggcttgaa gaggctgcca gccggacttc tgctgggtca tgggcccatc aggatggtct
      241 tggcgattct agcctttttg agattcacgg caatcaagcc atcactgggt ctcatcaata
      301 gatggggttc agtggggaaa aaagaggcta tggaaataat aaagaagttc aagaaagatc
      361 tggctgccat gctgagaata atcaatgcta ggaaggagaa gaagagacga ggcgcagaaa
      421 ctagtgtcgg aattgttggc ctcctgctga ccacagctat ggcagcggag gtcactagac
      481 gtgggagtgc atactatatg tacttggaca gaaacgatgc tggggaggcc atatcttttc
      541 caaccacatt ggggatgaat aagtgttata tacagatcat ggatcttgga cacatgtgtg
      601 atgccaccat gagctatgaa tgccctatgc tggatgaggg ggtggaacca gatgacgtcg
      661 attgttggtg caacacgacg tcaacttggg ttgtgtacgg aacctgccat cacaaaaaag
      721 gtgaagcacg gagatctaga agagccgtga cgctcccctc ccattccact aggaagctgc
      781 aaacgcggtc gcaaacctgg ttggaatcaa gagaatacac aaagcacttg attagagtcg
      841 aaaattggat attcaggaac cctggtttcg ctttagcagc agctgccatc gcgtggcttt
      901 tgggaagctc aacgagccaa aaagtcatat acttggtcat gatactgctg attgccccgg
      961 catacagcat caggtgcata ggagtcagca atagggactt tgtggaaggt atgtcaggtg
     1021 ggacttgggt tgatgttgtc ttggaacatg gaggttgtgt caccgtaatg gcacaggaca
     1081 aaccgactgt cgacatagag ctggttacaa caacagtcag caacatggcg gaggtaagat
     1141 cctactgcta tgaggcatca atatcagaca tggcttcgcc cagccgctgc ccaacacaag
     1201 ccgctgccta ccttgacaag caatcagaca ctcaatatgt ctgcaaaaga acgttagtgg
     1261 acagcgactg gggtt

Share this post


Link to post
Share on other sites

On October 21, 2015, we identified an imported case of ZIKV infection in the central state of Querétaro, Mexico. The patient, a 26-year-old man, had visited Santa Martha, Colombia, during the previous 12 days. 

Share this post


Link to post
Share on other sites

Match update

Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
12211221100%0.0100%KU497555.1
12211221100%0.0100%KU232299.1
12211221100%0.0100%KU232298.1
12211221100%0.0100%KU232296.1
12211221100%0.0100%KU232295.1
12211221100%0.0100%KU232294.1
12211221100%0.0100%KU232290.1
12211221100%0.0100%KU232289.1
12211221100%0.0100%KU232288.1
12211221100%0.0100%KU556802.1
12211221100%0.0100%KU647676.1
12181218100%0.099%KU232300.1
12161216100%0.099%KU232293.1
12161216100%0.099%KU232292.1
12161216100%0.099%KU509998.1
12161216100%0.099%KU321639.1
12161216100%0.099%KM078936.1
12161216100%0.099%KJ873160.1
12161216100%0.099%KJ776791.1
12121212100%0.099%KM078961.1
12101210100%0.099%KU740184.1
12101210100%0.099%KU707826.1
12101210100%0.099%KU527068.1
12101210100%0.099%KU232297.1
12101210100%0.099%KU501217.1
12101210100%0.099%KU501216.1
12101210100%0.099%KU501215.1
12101210100%0.099%KU365780.1
12101210100%0.099%KU365779.1
12101210100%0.099%KU365777.1
12101210100%0.099%KM078930.1
12061206100%0.099%KM078971.1
12061206100%0.099%KM078970.1
12061206100%0.099%KM078933.1
12051205100%0.099%KU232291.1
12051205100%0.099%KU365778.1
12051205100%0.099%KU312312.1
12051205100%0.099%KM078929.1
11941194100%0.099%KF993678.1
11881188100%0.099%KU744693.1
11821182100%0.099%KU681081.3
11821182100%0.099%KU179098.1
11551155100%0.098%JN860885.1
11491149100%0.098%EU545988.1
11381138100%0.098%KU681082.3
1134113493%0.099%KJ873161.1
10161016100%0.094%HQ234499.1
92092077%0.099%KM851039.1
89389377%0.098%KM851038.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.