Sign in to follow this  
Followers 0
niman

Full Zika Sequence From Microcephalic Fetal Brain - Bahia Brazil 2015

4 posts in this topic

LOCUS       KU527068               10808 bp    RNA     linear   VRL 11-FEB-2016
DEFINITION  Zika virus strain Bahia2015, complete genome.
ACCESSION   KU527068
VERSION     KU527068.1  GI:982894594
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10808)
  AUTHORS   Mlakar,J., Korva,M., Tul,N., Popovic,M., Poljsak-Prijatelj,M.,
            Mraz,J., Kolenc,M., Resman Rus,K., Vesnaver Vipotnik,T., Fabjan
            Vodusek,V., Vizjak,A., Pizem,J., Petrovec,M. and Avsic Zupanc,T.
  TITLE     Zika Virus Associated with Microcephaly
  JOURNAL   N. Engl. J. Med. (2016) In press
   PUBMED   26862926
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 10808)
  AUTHORS   Avsic Zupanc,T. and Korva,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JAN-2016) Institute of Microbiology and Immunology,
            University of Ljubljana, Faculty of Medicine, Vrazov trg 2,
            Ljubljana 1000, Slovenia
FEATURES             Location/Qualifiers
     source          1..10808
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="Bahia2015"
                     /isolation_source="fetus' brain autopsy"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="2015"
     CDS             108..10379
                     /note="contains structural and non-structural proteins"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AMB18850.1"
                     /db_xref="GI:982894595"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLEHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWADGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSVVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYIVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 agttgttgat ctgtgtgaat cagactgcga cagttcgagt ttgaagcgaa agctagcaac
       61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa
      121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga
      181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca
      241 ggatggtctt ggcaattcta gcctttttga gattcacggc aatcaagcca tcactgggtc
      301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca
      361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag
      421 gcgcagatac tagtgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg
      481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca
      541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac
      601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag
      661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc
      721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacta
      781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga
      841 ttagagtcga aaattggata ttcaggaacc ctggcttcgc gttagcagca gctgccatcg
      901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga
      961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta
     1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg
     1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg
     1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc
     1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa
     1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga
     1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc
     1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg
     1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa
     1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag
     1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggtccaca
     1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac
     1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg
     1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg
     1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa
     1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca
     1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga
     1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag
     2041 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga
     2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga
     2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg
     2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg
     2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat
     2341 cattgtttgg aggaatgtcc tggttctcac aaatcctcat tggaacgttg ctgatgtggt
     2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt
     2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga
     2521 aggagacgag atgcggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca
     2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg
     2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga gaacatcatg tggagatcag
     2701 tagaagggga gctcaacgca atcttggaag agaatggagt tcaactgacg gtcgttgtgg
     2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc
     2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata
     2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcgaacat agagcatgga
     2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg
     3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggga
     3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga
     3121 ggctgaagag ggcccatcta atcgagatga aaacatgtga atggccaaag tcccacacat
     3181 tgtgggcaga tggaatagaa gagagtgatc tgatcattcc caagtcttta gctgggccac
     3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg
     3301 aagagcttga aattcggttt gaggaatgcc cgggcactaa ggtccacgtg gaggaaacat
     3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat
     3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttccg ggctaaagat ggctgttggt
     3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcagtggtga
     3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca
     3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg
     3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa
     3721 ttttgatggg cgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc
     3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt
     3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct
     3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa
     3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga
     4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg
     4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca
     4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt
     4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc
     4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg
     4321 ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca
     4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc
     4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc
     4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag
     4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg
     4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt
     4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag
     4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag
     4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat
     4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg
     4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca
     4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt
     5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta
     5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga
     5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga
     5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag
     5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt
     5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc
     5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata
     5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa
     5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc
     5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga
     5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg
     5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg
     5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt
     5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg
     5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattttgg
     5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga
     6001 atcccaacaa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag
     6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc
     6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca
     6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg
     6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct
     6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca
     6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc
     6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag
     6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg
     6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg
     6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc
     6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg
     6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg
     6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc
     6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg
     6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc
     6961 taatgggaag gagagaggag ggagcaacca taggattctc aatggacatt gacctgcggc
     7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac
     7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag
     7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc
     7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc
     7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc
     7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg
     7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca
     7441 tagcagtagc agtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg
     7501 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga
     7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt
     7621 ctctaatcta catagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag
     7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct
     7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca
     7801 aggatggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt
     7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag
     7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa
     7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aacatagtcc
     8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt
     8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc
     8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt
     8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag
     8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag
     8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg
     8401 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg
     8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga
     8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg
     8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg
     8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga
     8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc
     8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag
     8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggttc
     8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg
     8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga
     9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg
     9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc
     9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag
     9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc
     9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcatcagca
     9301 ggttcgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg catagggcct
     9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag
     9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac
     9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata
     9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag
     9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag
     9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg
     9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact
     9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt
     9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag
     9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc
     9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg
    10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat
    10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc
    10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg
    10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca
    10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact
    10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag
    10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc
    10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg
    10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca
    10561 tgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg
    10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc
    10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc
    10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca
    10801 tgggtctt

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1840218402100%0.099%KU509998.1
1839018390100%0.099%KU321639.1
1839018390100%0.099%KJ776791.1
1837218372100%0.099%KU365779.1
1835718357100%0.099%KU501217.1
1835718357100%0.099%KU365780.1
1835418354100%0.099%KU647676.1
1835418354100%0.099%KU501216.1
1835418354100%0.099%KU365777.1
1833918339100%0.099%KU365778.1
1833918339100%0.099%KU312312.1
1833018330100%0.099%KU501215.1
177441774499%0.098%JN860885.1
176941769498%0.099%KF993678.1
1758517585100%0.098%EU545988.1
164111641199%0.095%HQ234499.1

Share this post


Link to post
Share on other sites
LOCUS       KU527068               10808 bp    RNA     linear   VRL 11-FEB-2016
DEFINITION  Zika virus strain Natal RGN, complete genome.
ACCESSION   KU527068
VERSION     KU527068.1  GI:982894594
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10808)
  AUTHORS   Mlakar,J., Korva,M., Tul,N., Popovic,M., Poljsak-Prijatelj,M.,
            Mraz,J., Kolenc,M., Resman Rus,K., Vesnaver Vipotnik,T., Fabjan
            Vodusek,V., Vizjak,A., Pizem,J., Petrovec,M. and Avsic Zupanc,T.
  TITLE     Zika Virus Associated with Microcephaly
  JOURNAL   N. Engl. J. Med. (2016) In press
   PUBMED   26862926
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 10808)
  AUTHORS   Avsic Zupanc,T. and Korva,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JAN-2016) Institute of Microbiology and Immunology,
            University of Ljubljana, Faculty of Medicine, Vrazov trg 2,
            Ljubljana 1000, Slovenia
FEATURES             Location/Qualifiers
     source          1..10808
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="Natal RGN"
                     /isolation_source="fetus' brain autopsy"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil: Rio Grande do Norte, Natal"
                     /collection_date="2015"
     CDS             108..10379
                     /note="contains structural and non-structural proteins"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AMB18850.1"
                     /db_xref="GI:982894595"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLEHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWADGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSVVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYIVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 agttgttgat ctgtgtgaat cagactgcga cagttcgagt ttgaagcgaa agctagcaac
       61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa
      121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga
      181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca
      241 ggatggtctt ggcaattcta gcctttttga gattcacggc aatcaagcca tcactgggtc
      301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca
      361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag
      421 gcgcagatac tagtgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg
      481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca
      541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac
      601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag
      661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc
      721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacta
      781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga
      841 ttagagtcga aaattggata ttcaggaacc ctggcttcgc gttagcagca gctgccatcg
      901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga
      961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta
     1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg
     1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg
     1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc
     1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa
     1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga
     1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc
     1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg
     1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa
     1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag
     1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggtccaca
     1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac
     1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg
     1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg
     1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa
     1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca
     1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga
     1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag
     2041 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga
     2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga
     2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg
     2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg
     2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat
     2341 cattgtttgg aggaatgtcc tggttctcac aaatcctcat tggaacgttg ctgatgtggt
     2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt
     2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga
     2521 aggagacgag atgcggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca
     2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg
     2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga gaacatcatg tggagatcag
     2701 tagaagggga gctcaacgca atcttggaag agaatggagt tcaactgacg gtcgttgtgg
     2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc
     2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata
     2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcgaacat agagcatgga
     2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg
     3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggga
     3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga
     3121 ggctgaagag ggcccatcta atcgagatga aaacatgtga atggccaaag tcccacacat
     3181 tgtgggcaga tggaatagaa gagagtgatc tgatcattcc caagtcttta gctgggccac
     3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg
     3301 aagagcttga aattcggttt gaggaatgcc cgggcactaa ggtccacgtg gaggaaacat
     3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat
     3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttccg ggctaaagat ggctgttggt
     3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcagtggtga
     3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca
     3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg
     3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa
     3721 ttttgatggg cgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc
     3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt
     3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct
     3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa
     3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga
     4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg
     4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca
     4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt
     4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc
     4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg
     4321 ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca
     4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc
     4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc
     4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag
     4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg
     4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt
     4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag
     4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag
     4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat
     4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg
     4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca
     4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt
     5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta
     5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga
     5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga
     5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag
     5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt
     5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc
     5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata
     5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa
     5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc
     5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga
     5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg
     5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg
     5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt
     5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg
     5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattttgg
     5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga
     6001 atcccaacaa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag
     6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc
     6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca
     6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg
     6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct
     6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca
     6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc
     6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag
     6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg
     6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg
     6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc
     6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg
     6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg
     6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc
     6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg
     6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc
     6961 taatgggaag gagagaggag ggagcaacca taggattctc aatggacatt gacctgcggc
     7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac
     7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag
     7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc
     7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc
     7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc
     7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg
     7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca
     7441 tagcagtagc agtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg
     7501 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga
     7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt
     7621 ctctaatcta catagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag
     7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct
     7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca
     7801 aggatggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt
     7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag
     7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa
     7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aacatagtcc
     8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt
     8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc
     8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt
     8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag
     8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag
     8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg
     8401 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg
     8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga
     8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg
     8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg
     8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga
     8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc
     8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag
     8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggttc
     8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg
     8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga
     9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg
     9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc
     9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag
     9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc
     9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcatcagca
     9301 ggttcgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg catagggcct
     9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag
     9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac
     9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata
     9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag
     9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag
     9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg
     9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact
     9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt
     9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag
     9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc
     9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg
    10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat
    10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc
    10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg
    10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca
    10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact
    10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag
    10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc
    10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg
    10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca
    10561 tgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg
    10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc
    10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc
    10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca
    10801 tgggtctt

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.