niman Posted February 15, 2016 Report Share Posted February 15, 2016 LOCUS KU232301 692 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 072ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232301 VERSION KU232301.1 GI:987895001 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 692) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 Link to comment Share on other sites More sharing options...
niman Posted February 15, 2016 Author Report Share Posted February 15, 2016 LOCUS KU232301 692 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 072ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232301 VERSION KU232301.1 GI:987895001 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 692) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 692) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (04-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..692 /organism="Zika virus" /mol_type="genomic RNA" /isolate="072ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>692 /codon_start=2 /product="NS5 protein" /protein_id="AME17086.1" /db_xref="GI:987895002" /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW EEVPFCSHHFNK" ORIGIN 1 tgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg 61 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc 121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga 181 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt 241 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa 301 agggaaaaca gtyatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt 361 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc 421 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa 481 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg 541 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg 601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga 661 agttccgttt tgctcccacc acttcaacaa gc Link to comment Share on other sites More sharing options...
niman Posted February 15, 2016 Author Report Share Posted February 15, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1243124399%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1243124399%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1240124099%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1240124099%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1240124099%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1240124099%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1236123699%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1234123499%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1234123499%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1234123499%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1234123499%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1234123499%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1234123499%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1234123499%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1232123299%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1232123299%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1232123299%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1231123199%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1231123199%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1231123199%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds1222122299%0.099%KF993678.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1214121497%0.099%KJ873160.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds1189118999%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1186118699%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1135113591%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds10741074100%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds93093076%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds90290276%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
niman Posted February 15, 2016 Author Report Share Posted February 15, 2016 Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cdsGenBank: KU232300.1FASTA GraphicsGo to:LOCUS KU232300 692 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232300 VERSION KU232300.1 GI:987894999 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 692) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 692) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (04-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..692 /organism="Zika virus" /mol_type="genomic RNA" /isolate="067ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>692 /codon_start=2 /product="NS5 protein" /protein_id="AME17085.1" /db_xref="GI:987895000" /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW EEVPFCSHHFNK" ORIGIN 1 tgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg 61 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc 121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga 181 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt 241 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa 301 agggaaaaca gtyatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt 361 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc 421 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa 481 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg 541 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg 601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga 661 agttccgttt tgctcccacc acttcaacaa gc Link to comment Share on other sites More sharing options...
niman Posted February 15, 2016 Author Report Share Posted February 15, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1243124399%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1243124399%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1240124099%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1240124099%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1240124099%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1240124099%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1236123699%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1234123499%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1234123499%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1234123499%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1234123499%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1234123499%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1234123499%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1234123499%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1232123299%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1232123299%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1232123299%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1231123199%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1231123199%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1231123199%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds1222122299%0.099%KF993678.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1214121497%0.099%KJ873160.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds1189118999%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1186118699%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1135113591%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds10741074100%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds93093076%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds90290276%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
niman Posted February 15, 2016 Author Report Share Posted February 15, 2016 LOCUS KU232299 661 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232299 VERSION KU232299.1 GI:987894997 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 661) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 661) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..661 /organism="Zika virus" /mol_type="genomic RNA" /isolate="015ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>661 /codon_start=2 /product="NS5 protein" /protein_id="AME17084.1" /db_xref="GI:987894998" /translation="LNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDT AGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDI ISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSN GWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPF CS" ORIGIN 1 cttgaacgag gatcactgga tggggagaga gaactcagga ggtggtgttg aagggctggg 61 attacaaaga ctcggatatg tcctagaaga gatgagtcgc ataccaggag gaaggatgta 121 tgcagatgac actgctggct gggacacccg catcagcagg tttgatctgg agaatgaagc 181 tctaatcacc aaccaaatgg agaaagggca cagggccttg gcattggcca taatcaagta 241 cacataccaa aacaaagtgg taaaggtcct tagaccagct gaaaaaggga aaacagttat 301 ggacattatt tcgagacaag accaaagggg gagcggacaa gttgtcactt acgctcttaa 361 cacatttacc aacctagtgg tgcaactcat tcggaatatg gaggctgagg aagttctaga 421 gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg accaactggt tgcagagcaa 481 cggatgggat aggctcaaac gaatggcagt cagtggagat gattgcgttg tgaagccaat 541 tgatgatagg tttgcacatg ccctcaggtt cttgaatgat atgggaaaag ttaggaagga 601 cacacaagag tggaaaccct caactggatg ggacaactgg gaagaagttc cgttttgctc 661 c Link to comment Share on other sites More sharing options...
niman Posted February 15, 2016 Author Report Share Posted February 15, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds11931193100%0.0100%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds11931193100%0.0100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome11871187100%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome11871187100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds11871187100%0.099%KM078936.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds11871187100%0.099%KJ873160.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds11871187100%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds11861186100%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds11841184100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds11841184100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome11841184100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds11841184100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds11841184100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds11841184100%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds11841184100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds11801180100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds11801180100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds11801180100%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds11781178100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds11781178100%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds11781178100%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds11691169100%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds11391139100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds11331133100%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1108110893%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds10251025100%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds90290277%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds88188177%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 LOCUS KU232298 678 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232298 VERSION KU232298.1 GI:987894995 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 678) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 678) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..678 /organism="Zika virus" /mol_type="genomic RNA" /isolate="050ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>678 /codon_start=2 /product="NS5 protein" /protein_id="AME17083.1" /db_xref="GI:987894996" /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA DDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTV MDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWL QSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEE VPFCSHH" ORIGIN 1 ccttggattc ttgaacgagg atcactggat ggggagagag aactcaggag gtggtgttga 61 agggctggga ttacaaagac tcggatatgt cctagaagag atgagtcgca taccaggagg 121 aaggatgtat gcagatgaca ctgctggctg ggacacccgc atcagcaggt ttgatctgga 181 gaatgaagct ctaatcacca accaaatgga gaaagggcac agggccttgg cattggccat 241 aatcaagtac acataccaaa acaaagtggt aaaggtcctt agaccagctg aaaaagggaa 301 aacagttatg gacattattt cgagacaaga ccaaaggggg agcggacaag ttgtcactta 361 cgctcttaac acatttacca acctagtggt gcaactcatt cggaatatgg aggctgagga 421 agttctagag atgcaagact tgtggctgct gcggaggtca gagaaagtga ccaactggtt 481 gcagagcaac ggatgggata ggctcaaacg aatggcagtc agtggagatg attgcgttgt 541 gaagccaatt gatgataggt ttgcacatgc cctcaggttc ttgaatgata tgggaaaagt 601 taggaaggac acacaagagt ggaaaccctc aactggatgg gacaactggg aagaagttcc 661 gttttgctcc caccattthttp://www.ncbi.nlm.nih.gov/nuccore/KU232298.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds12181218100%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds12181218100%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome12141214100%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome12141214100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds12141214100%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds12141214100%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds12111211100%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds12091209100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds12091209100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome12091209100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds12091209100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds12091209100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds12091209100%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds12091209100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds12071207100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds12071207100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds12071207100%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds12051205100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds12051205100%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds12051205100%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1198119898%0.099%KJ873160.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds11961196100%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds11641164100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds11601160100%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1119111992%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds10471047100%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds91391376%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89089076%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 LOCUS KU232297 693 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232297 VERSION KU232297.1 GI:987894993 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 693) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 693) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..693 /organism="Zika virus" /mol_type="genomic RNA" /isolate="049ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>693 /codon_start=2 /product="NS5 protein" /protein_id="AME17082.1" /db_xref="GI:987894994" /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW EEVPFCSHHFNK" ORIGIN 1 tgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg 61 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc 121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga 181 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt 241 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa 301 agggaaaaca gtcatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt 361 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc 421 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa 481 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg 541 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg 601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga 661 ggttccgttt tgctcccacc atttcaacaa gcahttp://www.ncbi.nlm.nih.gov/nuccore/KU232297.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1232123299%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1232123299%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1229122999%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1229122999%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1229122999%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1229122999%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1225122599%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1223122399%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1223122399%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1223122399%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1223122399%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1223122399%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1223122399%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1223122399%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1222122299%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1222122299%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1222122299%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1220122099%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1220122099%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1220122099%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds1211121199%0.099%KF993678.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1204120497%0.099%KJ873160.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds1178117899%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1175117599%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1124112491%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1063106399%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds91991976%0.098%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89289276%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 LOCUS KU232296 676 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232296 VERSION KU232296.1 GI:987894991 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 676) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 676) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..676 /organism="Zika virus" /mol_type="genomic RNA" /isolate="045ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>676 /codon_start=3 /product="NS5 protein" /protein_id="AME17081.1" /db_xref="GI:987894992" /translation="GFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYAD DTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVM DIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQ SNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEV PFCSHH" ORIGIN 1 ttggattctt gaacgaggat cactggatgg ggagagagaa ctcaggaggt ggtgttgaag 61 ggctgggatt acaaagactc ggatatgtcc tagaagagat gagtcgcata ccaggaggaa 121 ggatgtatgc agatgacact gctggctggg acacccgcat cagcaggttt gatctggaga 181 atgaagctct aatcaccaac caaatggaga aagggcacag ggccttggca ttggccataa 241 tcaagtacac ataccaaaac aaagtggtaa aggtccttag accagctgaa aaagggaaaa 301 cagttatgga cattatttcg agacaagacc aaagggggag cggacaagtt gtcacttacg 361 ctcttaacac atttaccaac ctagtggtgc aactcattcg gaatatggag gctgaggaag 421 ttctagagat gcaagacttg tggctgctgc ggaggtcaga gaaagtgacc aactggttgc 481 agagcaacgg atgggatagg ctcaaacgaa tggcagtcag tggagatgat tgcgttgtga 541 agccaattga tgataggttt gcacatgccc tcaggttctt gaatgatatg ggaaaagtta 601 ggaaggacac acaagagtgg aaaccctcaa ctggatggga caactgggaa gaagttccgt 661 tttgctccca ccattt Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1243124399%0.0100%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1243124399%0.0100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1238123899%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1238123899%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1238123899%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1238123899%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1234123499%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1232123299%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1232123299%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1232123299%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1232123299%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1232123299%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1232123299%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1232123299%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1229122999%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1229122999%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1229122999%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1227122799%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1227122799%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1227122799%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1225122598%0.099%KJ873160.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds1216121699%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds1177117799%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1171117199%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1144114492%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1033103399%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92992976%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds90290276%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 LOCUS KU232295 672 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232295 VERSION KU232295.1 GI:987894989 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 672) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 672) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..672 /organism="Zika virus" /mol_type="genomic RNA" /isolate="068ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>672 /codon_start=1 /product="NS5 protein" /protein_id="AME17080.1" /db_xref="GI:987894990" /translation="GFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYAD DTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVM DIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQ SNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEV PFCSHH" ORIGIN 1 ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg tgttgaaggg 61 ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc aggaggaagg 121 atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga tctggagaat 181 gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt ggccataatc 241 aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa agggaaaaca 301 gttatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt cacttacgct 361 cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc tgaggaagtt 421 ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa ctggttgcag 481 agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg cgttgtgaag 541 ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg aaaagttagg 601 aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga agttccgttt 661 tgctcccacc at Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1240124099%0.0100%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1240124099%0.0100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1234123499%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1234123499%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1234123499%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1234123499%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1230123099%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1229122999%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1229122999%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1229122999%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1229122999%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1229122999%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1229122999%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1229122999%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1225122599%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1225122599%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1225122599%0.099%KM078933.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1225122599%0.099%KJ873160.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1223122399%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1223122399%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1223122399%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds1212121299%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds1173117399%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1168116899%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1144114492%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1029102999%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92992977%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds90290277%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 LOCUS KU232294 679 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232294 VERSION KU232294.1 GI:987894987 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 679) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 679) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..679 /organism="Zika virus" /mol_type="genomic RNA" /isolate="061ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>679 /codon_start=3 /product="NS5 protein" /protein_id="AME17079.1" /db_xref="GI:987894988" /translation="ALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMY ADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKT VMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNW LQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWE EVPFCSH" ORIGIN 1 aagcccttgg attcttgaac gaggatcact ggatggggag agagaactca ggaggtggtg 61 ttgaagggct gggattacaa agactcggat atgtcctaga agagatgagt cgcataccag 121 gaggaaggat gtatgcagat gacactgctg gctgggacac ccgcatcagc aggtttgatc 181 tggagaatga agctctaatc accaaccaaa tggagaaagg gcacagggcc ttggcattgg 241 ccataatcaa gtacacatac caaaacaaag tggtaaaggt ccttagacca gctgaaaaag 301 ggaaaacagt tatggacatt atttcgagac aagaccaaag ggggagcgga caagttgtca 361 cttacgctct taacacattt accaacctag tggtgcaact cattcggaat atggaggctg 421 aggaagttct agagatgcaa gacttgtggc tgctgcggag gtcagagaaa gtgaccaact 481 ggttgcagag caacggatgg gataggctca aacgaatggc agtcagtgga gatgattgcg 541 ttgtgaagcc aattgatgat aggtttgcac atgccctcag gttcttgaat gatatgggaa 601 aagttaggaa ggacacacaa gagtggaaac cctcaactgg atgggacaac tgggaagaag 661 ttccgttttg ctcccacca Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds12541254100%0.0100%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds12541254100%0.0100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome12491249100%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome12491249100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds12491249100%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds12491249100%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds12451245100%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds12431243100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds12431243100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome12431243100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds12431243100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds12431243100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds12431243100%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds12431243100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds12401240100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds12401240100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds12401240100%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds12381238100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds12381238100%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds12381238100%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds12271227100%0.099%KF993678.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1225122598%0.099%KJ873160.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds11881188100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds11821182100%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1144114491%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1044104499%0.095%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92992976%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds90290276%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 LOCUS KU232293 679 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232293 VERSION KU232293.1 GI:987894985 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 679) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 679) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..679 /organism="Zika virus" /mol_type="genomic RNA" /isolate="057ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>679 /codon_start=3 /product="NS5 protein" /protein_id="AME17078.1" /db_xref="GI:987894986" /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA DDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTV MDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWL QSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEE VPFCSHH" ORIGIN 1 cccttggatt cttgaacgag gatcactgga tggggagaga gaactcagga ggtggtgttg 61 aagggctggg attacaaaga ctcggatatg tcctagaaga gatgagtcgc ataccaggag 121 gaaggatgta tgcagatgac actgctggct gggacacccg catcagcagg tttgatctgg 181 agaatgaagc cctaatcacc aaccaaatgg agaaagggca cagggccttg gcattggcca 241 taatcaagta cacataccaa aacaaagtgg taaaggtcct tagaccagct gaaaaaggga 301 aaacagttat ggacattatt tcgagacaag accaaagggg gagcggacaa gttgtcactt 361 acgctcttaa cacatttacc aacctagtgg tgcaactcat tcggaatatg gaggctgagg 421 aagttctaga gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg accaactggt 481 tgcagagcaa cggatgggat aggctcaaac gaatggcagt cagtggagat gattgcgttg 541 tgaagccaat tgatgatagg tttgcacatg ccctcaggtt cttgaatgat atgggaaaag 601 ttaggaagga cacacaagag tggaaaccct caactggatg ggacaactgg gaagaagttc 661 cgttttgctc ccaccattt Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1243124399%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1243124399%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1238123899%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1238123899%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1238123899%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1238123899%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1234123499%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1232123299%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1232123299%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1232123299%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1232123299%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1232123299%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1232123299%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1232123299%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1229122999%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1229122999%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1229122999%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1227122799%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1227122799%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1227122799%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1219121998%0.099%KJ873160.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds1216121699%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds1177117799%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1171117199%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1138113891%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1033103399%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92492476%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89689676%0.098%KM851038. Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 LOCUS KU232292 682 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232292 VERSION KU232292.1 GI:987894983 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 682) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 682) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..682 /organism="Zika virus" /mol_type="genomic RNA" /isolate="054ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>682 /codon_start=3 /product="NS5 protein" /protein_id="AME17077.1" /db_xref="GI:987894984" /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW EEVPFCSH" ORIGIN 1 ttgaagccct tggattcttg aacgaggatc actggatggg gagagagaac tcaggaggtg 61 gtgttgaagg gctgggatta caaagactcg gatatgtcct agaagagatg agtcgcatac 121 caggaggaag gatgtatgca gatgacactg ctggctggga cacccgcatc agcaggtttg 181 atctggagaa tgaagctcta atcaccaacc aaatggagaa agggcacagg gccttggcat 241 tggccataat caagtacaca taccaaaaca aagtggtaaa ggtccttaga ccagctgaaa 301 aagggaaaac agttatggac attatttcga gacaagacca aagggggagc ggacaagttg 361 tcacttacgc tcttaacaca tttaccaacc tagtggtgca actcattcgg aatatggagg 421 ctgaggaagt tctagagatg caagacttgt ggctgctgcg gaggtcagag aaagtgacca 481 actggttgca gagcaacgga tgggataggc tcaaacgaat ggcagtcagt ggagatgatt 541 gcgtcgtgaa gccaattgat gataggtttg cacatgccct caggttcttg aatgatatgg 601 gaaaagttag gaaggacaca caagagtgga aaccctcaac tggatgggac aactgggaag 661 aagttccgtt ttgctcccac ca Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1251125199%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1251125199%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1245124599%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1245124599%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1245124599%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1245124599%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1242124299%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1240124099%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1240124099%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1240124099%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1240124099%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1240124099%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1240124099%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1240124099%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1236123699%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1236123699%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1236123699%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1234123499%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1234123499%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1234123499%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds1223122399%0.099%KF993678.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1219121997%0.099%KJ873160.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds1184118499%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1179117999%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1138113891%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1044104499%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92492475%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89689675%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cdsGenBank: KU232291.1FASTA GraphicsGo to:LOCUS KU232291 667 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232291 VERSION KU232291.1 GI:987894981 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 667) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 667) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..667 /organism="Zika virus" /mol_type="genomic RNA" /isolate="051ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>667 /codon_start=1 /product="NS5 protein" /protein_id="AME17076.1" /db_xref="GI:987894982" /translation="FLNEDHWMGRENSGGGVEGLGLQKLGYVLEEMSRIPGGRMYADD TAGWDTRISRFDLENEALVTNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMD IISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQS NGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVP FCSH" ORIGIN 1 ttcttgaacg aggatcactg gatgggaaga gagaactcag gaggtggtgt tgaagggctg 61 ggattacaaa aactcggata tgtcctagaa gagatgagtc gcataccagg aggaaggatg 121 tatgcagatg acactgctgg ctgggacacc cgcatcagca ggtttgatct ggagaatgaa 181 gctctagtca ccaaccaaat ggagaaaggg cacagggcct tggcattggc cataatcaag 241 tacacatacc aaaacaaagt ggtaaaggtc cttagaccag ctgaaaaagg gaaaacagtt 301 atggacatta tttcgagaca agaccaaagg gggagcggac aagttgtcac ttacgctctt 361 aacacattta ccaacctagt ggtgcaactc attcggaata tggaggctga ggaagttcta 421 gagatgcaag acttgtggct gctgcggagg tcagagaaag tgaccaactg gttgcagagc 481 aacggatggg ataggctcaa acgaatggca gtcagtggag atgattgcgt tgtgaagcca 541 attgatgata ggtttgcaca tgccctcagg ttcttgaatg atatgggaaa agttaggaag 601 gacacacaag agtggaaacc ctcaactgga tgggacaact gggaagaagt tccgttttgc 661 tcccacc Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds12161216100%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds12161216100%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome12101210100%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome12101210100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds12101210100%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds12101210100%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds12061206100%0.099%KM078961.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1206120699%0.099%KJ873160.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds12051205100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds12051205100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome12051205100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds12051205100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds12051205100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds12051205100%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds12051205100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds12011201100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds12011201100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds12011201100%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds11991199100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds11991199100%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds11991199100%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds11881188100%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds11491149100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds11441144100%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1131113193%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1007100799%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92292277%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89489477%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 LOCUS KU232290 688 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232290 VERSION KU232290.1 GI:987894979 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 688) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 688) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..688 /organism="Zika virus" /mol_type="genomic RNA" /isolate="036ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>688 /codon_start=3 /product="NS5 protein" /protein_id="AME17075.1" /db_xref="GI:987894980" /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA DDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTV MDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWL QSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEE VPFCSHHFNK" ORIGIN 1 cccttggatt cttgaacgag gatcactgga tggggagaga gaactcagga ggtggtgttg 61 aagggctggg attacaaaga ctcggatatg tcctagaaga gatgagtcgc ataccaggag 121 gaaggatgta tgcagatgac actgctggct gggacacccg catcagcagg tttgatctgg 181 agaatgaagc tctaatcacc aaccaaatgg agaaagggca cagggccttg gcattggcca 241 taatcaagta cacataccaa aacaaagtgg taaaggtcct tagaccagct gaaaaaggga 301 aaacagttat ggacattatt tcgagacaag accaaagggg gagcggacaa gttgtcactt 361 acgctcttaa cacatttacc aacctagtgg tgcaactcat tcggaatatg gaggctgagg 421 aagttctaga gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg accaactggt 481 tgcagagcaa cggatgggat aggctcaaac gaatggcagt cagtggagat gattgcgttg 541 tgaagccaat tgatgatagg tttgcacatg ccctcaggtt cttgaatgat atgggaaaag 601 ttaggaagga cacacaagag tggaaaccct caactggatg ggacaactgg gaagaagttc 661 cgttttgctc ccaccatttc aacaagca Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1264126499%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1264126499%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1258125899%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1258125899%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1258125899%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1258125899%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1254125499%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1253125399%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1253125399%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1253125399%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1253125399%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1253125399%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1253125399%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1253125399%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1249124999%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1249124999%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1249124999%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1247124799%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1247124799%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1247124799%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1240124098%0.099%KJ873160.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds1236123699%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds1197119799%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1192119299%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1158115892%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1053105399%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds94494476%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds91391376%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now