Sign in to follow this  
Followers 0
niman

May 2015 Zika Partial Sequence From Brazil

29 posts in this topic

LOCUS       KU232301                 692 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 072ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232301
VERSION     KU232301.1  GI:987895001
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1

Share this post


Link to post
Share on other sites
LOCUS       KU232301                 692 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 072ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232301
VERSION     KU232301.1  GI:987895001
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..692
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="072ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>692
                     /codon_start=2
                     /product="NS5 protein"
                     /protein_id="AME17086.1"
                     /db_xref="GI:987895002"
                     /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM
                     YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK
                     TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN
                     WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW
                     EEVPFCSHHFNK"
ORIGIN      
        1 tgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg
       61 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc
      121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga
      181 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt
      241 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa
      301 agggaaaaca gtyatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt
      361 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc
      421 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa
      481 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg
      541 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg
      601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga
      661 agttccgttt tgctcccacc acttcaacaa gc

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1243124399%0.099%KU556802.1
1243124399%0.099%KU647676.1
1240124099%0.099%KU509998.1
1240124099%0.099%KU321639.1
1240124099%0.099%KM078936.1
1240124099%0.099%KJ776791.1
1236123699%0.099%KM078961.1
1234123499%0.099%KU501217.1
1234123499%0.099%KU501216.1
1234123499%0.099%KU501215.1
1234123499%0.099%KU365780.1
1234123499%0.099%KU365779.1
1234123499%0.099%KU365777.1
1234123499%0.099%KM078930.1
1232123299%0.099%KM078971.1
1232123299%0.099%KM078970.1
1232123299%0.099%KM078933.1
1231123199%0.099%KU365778.1
1231123199%0.099%KU312312.1
1231123199%0.099%KM078929.1
1222122299%0.099%KF993678.1
1214121497%0.099%KJ873160.1
1189118999%0.098%JN860885.1
1186118699%0.098%EU545988.1
1135113591%0.099%KJ873161.1
10741074100%0.094%HQ234499.1
93093076%0.099%KM851039.1
90290276%0.098%KM851038.1

Share this post


Link to post
Share on other sites

Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds

GenBank: KU232300.1

FASTA Graphics

LOCUS       KU232300                 692 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232300
VERSION     KU232300.1  GI:987894999
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..692
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="067ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>692
                     /codon_start=2
                     /product="NS5 protein"
                     /protein_id="AME17085.1"
                     /db_xref="GI:987895000"
                     /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM
                     YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK
                     TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN
                     WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW
                     EEVPFCSHHFNK"
ORIGIN      
        1 tgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg
       61 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc
      121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga
      181 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt
      241 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa
      301 agggaaaaca gtyatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt
      361 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc
      421 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa
      481 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg
      541 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg
      601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga
      661 agttccgttt tgctcccacc acttcaacaa gc

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1243124399%0.099%KU556802.1
1243124399%0.099%KU647676.1
1240124099%0.099%KU509998.1
1240124099%0.099%KU321639.1
1240124099%0.099%KM078936.1
1240124099%0.099%KJ776791.1
1236123699%0.099%KM078961.1
1234123499%0.099%KU501217.1
1234123499%0.099%KU501216.1
1234123499%0.099%KU501215.1
1234123499%0.099%KU365780.1
1234123499%0.099%KU365779.1
1234123499%0.099%KU365777.1
1234123499%0.099%KM078930.1
1232123299%0.099%KM078971.1
1232123299%0.099%KM078970.1
1232123299%0.099%KM078933.1
1231123199%0.099%KU365778.1
1231123199%0.099%KU312312.1
1231123199%0.099%KM078929.1
1222122299%0.099%KF993678.1
1214121497%0.099%KJ873160.1
1189118999%0.098%JN860885.1
1186118699%0.098%EU545988.1
1135113591%0.099%KJ873161.1
10741074100%0.094%HQ234499.1
93093076%0.099%KM851039.1
90290276%0.098%KM851038.1

Share this post


Link to post
Share on other sites
LOCUS       KU232299                 661 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232299
VERSION     KU232299.1  GI:987894997
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 661)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 661)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..661
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="015ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>661
                     /codon_start=2
                     /product="NS5 protein"
                     /protein_id="AME17084.1"
                     /db_xref="GI:987894998"
                     /translation="LNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDT
                     AGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDI
                     ISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSN
                     GWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPF
                     CS"
ORIGIN      
        1 cttgaacgag gatcactgga tggggagaga gaactcagga ggtggtgttg aagggctggg
       61 attacaaaga ctcggatatg tcctagaaga gatgagtcgc ataccaggag gaaggatgta
      121 tgcagatgac actgctggct gggacacccg catcagcagg tttgatctgg agaatgaagc
      181 tctaatcacc aaccaaatgg agaaagggca cagggccttg gcattggcca taatcaagta
      241 cacataccaa aacaaagtgg taaaggtcct tagaccagct gaaaaaggga aaacagttat
      301 ggacattatt tcgagacaag accaaagggg gagcggacaa gttgtcactt acgctcttaa
      361 cacatttacc aacctagtgg tgcaactcat tcggaatatg gaggctgagg aagttctaga
      421 gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg accaactggt tgcagagcaa
      481 cggatgggat aggctcaaac gaatggcagt cagtggagat gattgcgttg tgaagccaat
      541 tgatgatagg tttgcacatg ccctcaggtt cttgaatgat atgggaaaag ttaggaagga
      601 cacacaagag tggaaaccct caactggatg ggacaactgg gaagaagttc cgttttgctc
      661 c

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
11931193100%0.0100%KU556802.1
11931193100%0.0100%KU647676.1
11871187100%0.099%KU509998.1
11871187100%0.099%KU321639.1
11871187100%0.099%KM078936.1
11871187100%0.099%KJ873160.1
11871187100%0.099%KJ776791.1
11861186100%0.099%KM078961.1
11841184100%0.099%KU501217.1
11841184100%0.099%KU501216.1
11841184100%0.099%KU501215.1
11841184100%0.099%KU365780.1
11841184100%0.099%KU365779.1
11841184100%0.099%KU365777.1
11841184100%0.099%KM078930.1
11801180100%0.099%KM078971.1
11801180100%0.099%KM078970.1
11801180100%0.099%KM078933.1
11781178100%0.099%KU365778.1
11781178100%0.099%KU312312.1
11781178100%0.099%KM078929.1
11691169100%0.099%KF993678.1
11391139100%0.098%JN860885.1
11331133100%0.098%EU545988.1
1108110893%0.099%KJ873161.1
10251025100%0.094%HQ234499.1
90290277%0.099%KM851039.1
88188177%0.098%KM851038.1

Share this post


Link to post
Share on other sites
LOCUS       KU232298                 678 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232298
VERSION     KU232298.1  GI:987894995
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 678)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 678)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..678
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="050ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>678
                     /codon_start=2
                     /product="NS5 protein"
                     /protein_id="AME17083.1"
                     /db_xref="GI:987894996"
                     /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA
                     DDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTV
                     MDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWL
                     QSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEE
                     VPFCSHH"
ORIGIN      
        1 ccttggattc ttgaacgagg atcactggat ggggagagag aactcaggag gtggtgttga
       61 agggctggga ttacaaagac tcggatatgt cctagaagag atgagtcgca taccaggagg
      121 aaggatgtat gcagatgaca ctgctggctg ggacacccgc atcagcaggt ttgatctgga
      181 gaatgaagct ctaatcacca accaaatgga gaaagggcac agggccttgg cattggccat
      241 aatcaagtac acataccaaa acaaagtggt aaaggtcctt agaccagctg aaaaagggaa
      301 aacagttatg gacattattt cgagacaaga ccaaaggggg agcggacaag ttgtcactta
      361 cgctcttaac acatttacca acctagtggt gcaactcatt cggaatatgg aggctgagga
      421 agttctagag atgcaagact tgtggctgct gcggaggtca gagaaagtga ccaactggtt
      481 gcagagcaac ggatgggata ggctcaaacg aatggcagtc agtggagatg attgcgttgt
      541 gaagccaatt gatgataggt ttgcacatgc cctcaggttc ttgaatgata tgggaaaagt
      601 taggaaggac acacaagagt ggaaaccctc aactggatgg gacaactggg aagaagttcc
      661 gttttgctcc caccattt

http://www.ncbi.nlm.nih.gov/nuccore/KU232298.1

 

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
12181218100%0.099%KU556802.1
12181218100%0.099%KU647676.1
12141214100%0.099%KU509998.1
12141214100%0.099%KU321639.1
12141214100%0.099%KM078936.1
12141214100%0.099%KJ776791.1
12111211100%0.099%KM078961.1
12091209100%0.099%KU501217.1
12091209100%0.099%KU501216.1
12091209100%0.099%KU501215.1
12091209100%0.099%KU365780.1
12091209100%0.099%KU365779.1
12091209100%0.099%KU365777.1
12091209100%0.099%KM078930.1
12071207100%0.099%KM078971.1
12071207100%0.099%KM078970.1
12071207100%0.099%KM078933.1
12051205100%0.099%KU365778.1
12051205100%0.099%KU312312.1
12051205100%0.099%KM078929.1
1198119898%0.099%KJ873160.1
11961196100%0.099%KF993678.1
11641164100%0.098%JN860885.1
11601160100%0.098%EU545988.1
1119111992%0.099%KJ873161.1
10471047100%0.094%HQ234499.1
91391376%0.099%KM851039.1
89089076%0.098%KM851038.1

Share this post


Link to post
Share on other sites
LOCUS       KU232297                 693 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232297
VERSION     KU232297.1  GI:987894993
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 693)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 693)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..693
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="049ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>693
                     /codon_start=2
                     /product="NS5 protein"
                     /protein_id="AME17082.1"
                     /db_xref="GI:987894994"
                     /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM
                     YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK
                     TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN
                     WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW
                     EEVPFCSHHFNK"
ORIGIN      
        1 tgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg
       61 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc
      121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga
      181 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt
      241 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa
      301 agggaaaaca gtcatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt
      361 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc
      421 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa
      481 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg
      541 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg
      601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga
      661 ggttccgttt tgctcccacc atttcaacaa gca

http://www.ncbi.nlm.nih.gov/nuccore/KU232297.1

 

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1232123299%0.099%KU556802.1
1232123299%0.099%KU647676.1
1229122999%0.099%KU509998.1
1229122999%0.099%KU321639.1
1229122999%0.099%KM078936.1
1229122999%0.099%KJ776791.1
1225122599%0.099%KM078961.1
1223122399%0.099%KU501217.1
1223122399%0.099%KU501216.1
1223122399%0.099%KU501215.1
1223122399%0.099%KU365780.1
1223122399%0.099%KU365779.1
1223122399%0.099%KU365777.1
1223122399%0.099%KM078930.1
1222122299%0.099%KM078971.1
1222122299%0.099%KM078970.1
1222122299%0.099%KM078933.1
1220122099%0.099%KU365778.1
1220122099%0.099%KU312312.1
1220122099%0.099%KM078929.1
1211121199%0.099%KF993678.1
1204120497%0.099%KJ873160.1
1178117899%0.098%JN860885.1
1175117599%0.098%EU545988.1
1124112491%0.099%KJ873161.1
1063106399%0.094%HQ234499.1
91991976%0.098%KM851039.1
89289276%0.098%KM851038.1

Share this post


Link to post
Share on other sites
LOCUS       KU232296                 676 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232296
VERSION     KU232296.1  GI:987894991
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 676)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 676)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..676
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="045ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>676
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17081.1"
                     /db_xref="GI:987894992"
                     /translation="GFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYAD
                     DTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVM
                     DIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQ
                     SNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEV
                     PFCSHH"
ORIGIN      
        1 ttggattctt gaacgaggat cactggatgg ggagagagaa ctcaggaggt ggtgttgaag
       61 ggctgggatt acaaagactc ggatatgtcc tagaagagat gagtcgcata ccaggaggaa
      121 ggatgtatgc agatgacact gctggctggg acacccgcat cagcaggttt gatctggaga
      181 atgaagctct aatcaccaac caaatggaga aagggcacag ggccttggca ttggccataa
      241 tcaagtacac ataccaaaac aaagtggtaa aggtccttag accagctgaa aaagggaaaa
      301 cagttatgga cattatttcg agacaagacc aaagggggag cggacaagtt gtcacttacg
      361 ctcttaacac atttaccaac ctagtggtgc aactcattcg gaatatggag gctgaggaag
      421 ttctagagat gcaagacttg tggctgctgc ggaggtcaga gaaagtgacc aactggttgc
      481 agagcaacgg atgggatagg ctcaaacgaa tggcagtcag tggagatgat tgcgttgtga
      541 agccaattga tgataggttt gcacatgccc tcaggttctt gaatgatatg ggaaaagtta
      601 ggaaggacac acaagagtgg aaaccctcaa ctggatggga caactgggaa gaagttccgt
      661 tttgctccca ccattt

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1243124399%0.0100%KU556802.1
1243124399%0.0100%KU647676.1
1238123899%0.099%KU509998.1
1238123899%0.099%KU321639.1
1238123899%0.099%KM078936.1
1238123899%0.099%KJ776791.1
1234123499%0.099%KM078961.1
1232123299%0.099%KU501217.1
1232123299%0.099%KU501216.1
1232123299%0.099%KU501215.1
1232123299%0.099%KU365780.1
1232123299%0.099%KU365779.1
1232123299%0.099%KU365777.1
1232123299%0.099%KM078930.1
1229122999%0.099%KM078971.1
1229122999%0.099%KM078970.1
1229122999%0.099%KM078933.1
1227122799%0.099%KU365778.1
1227122799%0.099%KU312312.1
1227122799%0.099%KM078929.1
1225122598%0.099%KJ873160.1
1216121699%0.099%KF993678.1
1177117799%0.098%JN860885.1
1171117199%0.098%EU545988.1
1144114492%0.099%KJ873161.1
1033103399%0.094%HQ234499.1
92992976%0.099%KM851039.1
90290276%0.098%KM851038.1

Share this post


Link to post
Share on other sites
LOCUS       KU232295                 672 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232295
VERSION     KU232295.1  GI:987894989
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 672)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 672)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..672
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="068ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>672
                     /codon_start=1
                     /product="NS5 protein"
                     /protein_id="AME17080.1"
                     /db_xref="GI:987894990"
                     /translation="GFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYAD
                     DTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVM
                     DIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQ
                     SNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEV
                     PFCSHH"
ORIGIN      
        1 ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg tgttgaaggg
       61 ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc aggaggaagg
      121 atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga tctggagaat
      181 gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt ggccataatc
      241 aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa agggaaaaca
      301 gttatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt cacttacgct
      361 cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc tgaggaagtt
      421 ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa ctggttgcag
      481 agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg cgttgtgaag
      541 ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg aaaagttagg
      601 aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga agttccgttt
      661 tgctcccacc at

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1240124099%0.0100%KU556802.1
1240124099%0.0100%KU647676.1
1234123499%0.099%KU509998.1
1234123499%0.099%KU321639.1
1234123499%0.099%KM078936.1
1234123499%0.099%KJ776791.1
1230123099%0.099%KM078961.1
1229122999%0.099%KU501217.1
1229122999%0.099%KU501216.1
1229122999%0.099%KU501215.1
1229122999%0.099%KU365780.1
1229122999%0.099%KU365779.1
1229122999%0.099%KU365777.1
1229122999%0.099%KM078930.1
1225122599%0.099%KM078971.1
1225122599%0.099%KM078970.1
1225122599%0.099%KM078933.1
1225122599%0.099%KJ873160.1
1223122399%0.099%KU365778.1
1223122399%0.099%KU312312.1
1223122399%0.099%KM078929.1
1212121299%0.099%KF993678.1
1173117399%0.098%JN860885.1
1168116899%0.098%EU545988.1
1144114492%0.099%KJ873161.1
1029102999%0.094%HQ234499.1
92992977%0.099%KM851039.1
90290277%0.098%KM851038.1

Share this post


Link to post
Share on other sites
LOCUS       KU232294                 679 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232294
VERSION     KU232294.1  GI:987894987
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 679)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 679)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..679
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="061ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>679
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17079.1"
                     /db_xref="GI:987894988"
                     /translation="ALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMY
                     ADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKT
                     VMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNW
                     LQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWE
                     EVPFCSH"
ORIGIN      
        1 aagcccttgg attcttgaac gaggatcact ggatggggag agagaactca ggaggtggtg
       61 ttgaagggct gggattacaa agactcggat atgtcctaga agagatgagt cgcataccag
      121 gaggaaggat gtatgcagat gacactgctg gctgggacac ccgcatcagc aggtttgatc
      181 tggagaatga agctctaatc accaaccaaa tggagaaagg gcacagggcc ttggcattgg
      241 ccataatcaa gtacacatac caaaacaaag tggtaaaggt ccttagacca gctgaaaaag
      301 ggaaaacagt tatggacatt atttcgagac aagaccaaag ggggagcgga caagttgtca
      361 cttacgctct taacacattt accaacctag tggtgcaact cattcggaat atggaggctg
      421 aggaagttct agagatgcaa gacttgtggc tgctgcggag gtcagagaaa gtgaccaact
      481 ggttgcagag caacggatgg gataggctca aacgaatggc agtcagtgga gatgattgcg
      541 ttgtgaagcc aattgatgat aggtttgcac atgccctcag gttcttgaat gatatgggaa
      601 aagttaggaa ggacacacaa gagtggaaac cctcaactgg atgggacaac tgggaagaag
      661 ttccgttttg ctcccacca

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
12541254100%0.0100%KU556802.1
12541254100%0.0100%KU647676.1
12491249100%0.099%KU509998.1
12491249100%0.099%KU321639.1
12491249100%0.099%KM078936.1
12491249100%0.099%KJ776791.1
12451245100%0.099%KM078961.1
12431243100%0.099%KU501217.1
12431243100%0.099%KU501216.1
12431243100%0.099%KU501215.1
12431243100%0.099%KU365780.1
12431243100%0.099%KU365779.1
12431243100%0.099%KU365777.1
12431243100%0.099%KM078930.1
12401240100%0.099%KM078971.1
12401240100%0.099%KM078970.1
12401240100%0.099%KM078933.1
12381238100%0.099%KU365778.1
12381238100%0.099%KU312312.1
12381238100%0.099%KM078929.1
12271227100%0.099%KF993678.1
1225122598%0.099%KJ873160.1
11881188100%0.098%JN860885.1
11821182100%0.098%EU545988.1
1144114491%0.099%KJ873161.1
1044104499%0.095%HQ234499.1
92992976%0.099%KM851039.1
90290276%0.098%KM851038.1

Share this post


Link to post
Share on other sites
LOCUS       KU232293                 679 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232293
VERSION     KU232293.1  GI:987894985
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 679)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 679)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..679
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="057ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>679
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17078.1"
                     /db_xref="GI:987894986"
                     /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA
                     DDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTV
                     MDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWL
                     QSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEE
                     VPFCSHH"
ORIGIN      
        1 cccttggatt cttgaacgag gatcactgga tggggagaga gaactcagga ggtggtgttg
       61 aagggctggg attacaaaga ctcggatatg tcctagaaga gatgagtcgc ataccaggag
      121 gaaggatgta tgcagatgac actgctggct gggacacccg catcagcagg tttgatctgg
      181 agaatgaagc cctaatcacc aaccaaatgg agaaagggca cagggccttg gcattggcca
      241 taatcaagta cacataccaa aacaaagtgg taaaggtcct tagaccagct gaaaaaggga
      301 aaacagttat ggacattatt tcgagacaag accaaagggg gagcggacaa gttgtcactt
      361 acgctcttaa cacatttacc aacctagtgg tgcaactcat tcggaatatg gaggctgagg
      421 aagttctaga gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg accaactggt
      481 tgcagagcaa cggatgggat aggctcaaac gaatggcagt cagtggagat gattgcgttg
      541 tgaagccaat tgatgatagg tttgcacatg ccctcaggtt cttgaatgat atgggaaaag
      601 ttaggaagga cacacaagag tggaaaccct caactggatg ggacaactgg gaagaagttc
      661 cgttttgctc ccaccattt

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1243124399%0.099%KU556802.1
1243124399%0.099%KU647676.1
1238123899%0.099%KU509998.1
1238123899%0.099%KU321639.1
1238123899%0.099%KM078936.1
1238123899%0.099%KJ776791.1
1234123499%0.099%KM078961.1
1232123299%0.099%KU501217.1
1232123299%0.099%KU501216.1
1232123299%0.099%KU501215.1
1232123299%0.099%KU365780.1
1232123299%0.099%KU365779.1
1232123299%0.099%KU365777.1
1232123299%0.099%KM078930.1
1229122999%0.099%KM078971.1
1229122999%0.099%KM078970.1
1229122999%0.099%KM078933.1
1227122799%0.099%KU365778.1
1227122799%0.099%KU312312.1
1227122799%0.099%KM078929.1
1219121998%0.099%KJ873160.1
1216121699%0.099%KF993678.1
1177117799%0.098%JN860885.1
1171117199%0.098%EU545988.1
1138113891%0.099%KJ873161.1
1033103399%0.094%HQ234499.1
92492476%0.099%KM851039.1
89689676%0.098%KM851038.

Share this post


Link to post
Share on other sites
LOCUS       KU232292                 682 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232292
VERSION     KU232292.1  GI:987894983
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 682)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 682)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..682
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="054ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>682
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17077.1"
                     /db_xref="GI:987894984"
                     /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM
                     YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK
                     TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN
                     WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW
                     EEVPFCSH"
ORIGIN      
        1 ttgaagccct tggattcttg aacgaggatc actggatggg gagagagaac tcaggaggtg
       61 gtgttgaagg gctgggatta caaagactcg gatatgtcct agaagagatg agtcgcatac
      121 caggaggaag gatgtatgca gatgacactg ctggctggga cacccgcatc agcaggtttg
      181 atctggagaa tgaagctcta atcaccaacc aaatggagaa agggcacagg gccttggcat
      241 tggccataat caagtacaca taccaaaaca aagtggtaaa ggtccttaga ccagctgaaa
      301 aagggaaaac agttatggac attatttcga gacaagacca aagggggagc ggacaagttg
      361 tcacttacgc tcttaacaca tttaccaacc tagtggtgca actcattcgg aatatggagg
      421 ctgaggaagt tctagagatg caagacttgt ggctgctgcg gaggtcagag aaagtgacca
      481 actggttgca gagcaacgga tgggataggc tcaaacgaat ggcagtcagt ggagatgatt
      541 gcgtcgtgaa gccaattgat gataggtttg cacatgccct caggttcttg aatgatatgg
      601 gaaaagttag gaaggacaca caagagtgga aaccctcaac tggatgggac aactgggaag
      661 aagttccgtt ttgctcccac ca

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1251125199%0.099%KU556802.1
1251125199%0.099%KU647676.1
1245124599%0.099%KU509998.1
1245124599%0.099%KU321639.1
1245124599%0.099%KM078936.1
1245124599%0.099%KJ776791.1
1242124299%0.099%KM078961.1
1240124099%0.099%KU501217.1
1240124099%0.099%KU501216.1
1240124099%0.099%KU501215.1
1240124099%0.099%KU365780.1
1240124099%0.099%KU365779.1
1240124099%0.099%KU365777.1
1240124099%0.099%KM078930.1
1236123699%0.099%KM078971.1
1236123699%0.099%KM078970.1
1236123699%0.099%KM078933.1
1234123499%0.099%KU365778.1
1234123499%0.099%KU312312.1
1234123499%0.099%KM078929.1
1223122399%0.099%KF993678.1
1219121997%0.099%KJ873160.1
1184118499%0.098%JN860885.1
1179117999%0.098%