niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 LOCUS KU232289 663 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232289 VERSION KU232289.1 GI:987894977 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 663) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 663) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..663 /organism="Zika virus" /mol_type="genomic RNA" /isolate="020ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>663 /codon_start=3 /product="NS5 protein" /protein_id="AME17074.1" /db_xref="GI:987894978" /translation="LNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDT AGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDI ISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSN GWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPF CS" ORIGIN 1 tcttgaacga ggatcactgg atggggagag agaactcagg aggtggtgtt gaagggctgg 61 gattacaaag actcggatat gtcctagaag agatgagtcg cataccagga ggaaggatgt 121 atgcagatga cactgctggc tgggacaccc gcatcagcag gtttgatctg gagaatgaag 181 ctctaatcac caaccaaatg gagaaagggc acagggcctt ggcattggcc ataatcaagt 241 acacatacca aaacaaagtg gtaaaggtcc ttagaccagc tgaaaaaggg aaaacagtta 301 tggacattat ttcgagacaa gaccaaaggg ggagcggaca agttgtcact tacgctctta 361 acacatttac caacctagtg gtgcaactca ttcggaatat ggaggctgag gaagttctag 421 agatgcaaga cttgtggctg ctgcggaggt cagagaaagt gaccaactgg ttgcagagca 481 acggatggga taggctcaaa cgaatggcag tcagtggaga tgattgcgtt gtgaagccaa 541 ttgatgatag gtttgcacat gccctcaggt tcttgaatga tatgggaaaa gttaggaagg 601 acacacaaga gtggaaaccc tcaactggat gggacaactg ggaagaagtt ccgttttgct 661 ccchttp://www.ncbi.nlm.nih.gov/nuccore/KU232289.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds12251225100%0.0100%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds12251225100%0.0100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome12191219100%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome12191219100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds12191219100%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds12191219100%0.099%KJ776791.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1218121899%0.099%KJ873160.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds12161216100%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds12141214100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds12141214100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome12141214100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds12141214100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds12141214100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds12141214100%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds12141214100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds12101210100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds12101210100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds12101210100%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds12081208100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds12081208100%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds12081208100%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds11971197100%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds11581158100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds11531153100%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1136113693%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds10201020100%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92292277%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89489477%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 LOCUS KU232288 665 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232288 VERSION KU232288.1 GI:987894975 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 665) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 665) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..665 /organism="Zika virus" /mol_type="genomic RNA" /isolate="001ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>665 /codon_start=3 /product="NS5 protein" /protein_id="AME17073.1" /db_xref="GI:987894976" /translation="LNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDT AGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDI ISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSN GWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPF CSH" ORIGIN 1 tcttgaacga ggatcactgg atggggagag agaactcagg aggtggtgtt gaagggctgg 61 gattacaaag actcggatat gtcctagaag agatgagtcg cataccagga ggaaggatgt 121 atgcagatga cactgctggc tgggacaccc gcatcagcag gtttgatctg gagaatgaag 181 ctctaatcac caaccaaatg gagaaagggc acagggcctt ggcattggcc ataatcaagt 241 acacatacca aaacaaagtg gtaaaggtcc ttagaccagc tgaaaaaggg aaaacagtta 301 tggacattat ttcgagacaa gaccaaaggg ggagcggaca agttgtcact tacgctctta 361 acacatttac caacctagtg gtgcaactca ttcggaatat ggaggctgag gaagttctag 421 agatgcaaga cttgtggctg ctgcggaggt cagagaaagt gaccaactgg ttgcagagca 481 acggatggga taggctcaaa cgaatggcag tcagtggaga tgattgcgtt gtgaagccaa 541 ttgatgatag gtttgcacat gccctcaggt tcttgaatga tatgggaaaa gttaggaagg 601 acacacaaga gtggaaaccc tcaactggat gggacaactg ggaagaagtt ccgttttgct 661 cccachttp://www.ncbi.nlm.nih.gov/nuccore/KU232288.1 Link to comment Share on other sites More sharing options...
niman Posted February 16, 2016 Author Report Share Posted February 16, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds12291229100%0.0100%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds12291229100%0.0100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome12231223100%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome12231223100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds12231223100%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds12231223100%0.099%KJ776791.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1221122199%0.099%KJ873160.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds12191219100%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds12181218100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds12181218100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome12181218100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds12181218100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds12181218100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds12181218100%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds12181218100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds12141214100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds12141214100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds12141214100%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds12121212100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds12121212100%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds12121212100%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds12011201100%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds11621162100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds11571157100%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1140114093%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1022102299%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92692677%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89889877%0.098%KM851038.1 Link to comment Share on other sites More sharing options...
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now