Sign in to follow this  
Followers 0
niman

May 2015 Zika Partial Sequence From Brazil

29 posts in this topic

LOCUS       KU232289                 663 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232289
VERSION     KU232289.1  GI:987894977
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 663)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 663)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..663
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="020ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>663
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17074.1"
                     /db_xref="GI:987894978"
                     /translation="LNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDT
                     AGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDI
                     ISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSN
                     GWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPF
                     CS"
ORIGIN      
        1 tcttgaacga ggatcactgg atggggagag agaactcagg aggtggtgtt gaagggctgg
       61 gattacaaag actcggatat gtcctagaag agatgagtcg cataccagga ggaaggatgt
      121 atgcagatga cactgctggc tgggacaccc gcatcagcag gtttgatctg gagaatgaag
      181 ctctaatcac caaccaaatg gagaaagggc acagggcctt ggcattggcc ataatcaagt
      241 acacatacca aaacaaagtg gtaaaggtcc ttagaccagc tgaaaaaggg aaaacagtta
      301 tggacattat ttcgagacaa gaccaaaggg ggagcggaca agttgtcact tacgctctta
      361 acacatttac caacctagtg gtgcaactca ttcggaatat ggaggctgag gaagttctag
      421 agatgcaaga cttgtggctg ctgcggaggt cagagaaagt gaccaactgg ttgcagagca
      481 acggatggga taggctcaaa cgaatggcag tcagtggaga tgattgcgtt gtgaagccaa
      541 ttgatgatag gtttgcacat gccctcaggt tcttgaatga tatgggaaaa gttaggaagg
      601 acacacaaga gtggaaaccc tcaactggat gggacaactg ggaagaagtt ccgttttgct
      661 ccc

http://www.ncbi.nlm.nih.gov/nuccore/KU232289.1

 

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
12251225100%0.0100%KU556802.1
12251225100%0.0100%KU647676.1
12191219100%0.099%KU509998.1
12191219100%0.099%KU321639.1
12191219100%0.099%KM078936.1
12191219100%0.099%KJ776791.1
1218121899%0.099%KJ873160.1
12161216100%0.099%KM078961.1
12141214100%0.099%KU501217.1
12141214100%0.099%KU501216.1
12141214100%0.099%KU501215.1
12141214100%0.099%KU365780.1
12141214100%0.099%KU365779.1
12141214100%0.099%KU365777.1
12141214100%0.099%KM078930.1
12101210100%0.099%KM078971.1
12101210100%0.099%KM078970.1
12101210100%0.099%KM078933.1
12081208100%0.099%KU365778.1
12081208100%0.099%KU312312.1
12081208100%0.099%KM078929.1
11971197100%0.099%KF993678.1
11581158100%0.098%JN860885.1
11531153100%0.098%EU545988.1
1136113693%0.099%KJ873161.1
10201020100%0.094%HQ234499.1
92292277%0.099%KM851039.1
89489477%0.098%KM851038.1

Share this post


Link to post
Share on other sites
LOCUS       KU232288                 665 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232288
VERSION     KU232288.1  GI:987894975
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 665)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 665)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..665
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="001ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>665
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17073.1"
                     /db_xref="GI:987894976"
                     /translation="LNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDT
                     AGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDI
                     ISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSN
                     GWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPF
                     CSH"
ORIGIN      
        1 tcttgaacga ggatcactgg atggggagag agaactcagg aggtggtgtt gaagggctgg
       61 gattacaaag actcggatat gtcctagaag agatgagtcg cataccagga ggaaggatgt
      121 atgcagatga cactgctggc tgggacaccc gcatcagcag gtttgatctg gagaatgaag
      181 ctctaatcac caaccaaatg gagaaagggc acagggcctt ggcattggcc ataatcaagt
      241 acacatacca aaacaaagtg gtaaaggtcc ttagaccagc tgaaaaaggg aaaacagtta
      301 tggacattat ttcgagacaa gaccaaaggg ggagcggaca agttgtcact tacgctctta
      361 acacatttac caacctagtg gtgcaactca ttcggaatat ggaggctgag gaagttctag
      421 agatgcaaga cttgtggctg ctgcggaggt cagagaaagt gaccaactgg ttgcagagca
      481 acggatggga taggctcaaa cgaatggcag tcagtggaga tgattgcgtt gtgaagccaa
      541 ttgatgatag gtttgcacat gccctcaggt tcttgaatga tatgggaaaa gttaggaagg
      601 acacacaaga gtggaaaccc tcaactggat gggacaactg ggaagaagtt ccgttttgct
      661 cccac

http://www.ncbi.nlm.nih.gov/nuccore/KU232288.1

 

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
12291229100%0.0100%KU556802.1
12291229100%0.0100%KU647676.1
12231223100%0.099%KU509998.1
12231223100%0.099%KU321639.1
12231223100%0.099%KM078936.1
12231223100%0.099%KJ776791.1
1221122199%0.099%KJ873160.1
12191219100%0.099%KM078961.1
12181218100%0.099%KU501217.1
12181218100%0.099%KU501216.1
12181218100%0.099%KU501215.1
12181218100%0.099%KU365780.1
12181218100%0.099%KU365779.1
12181218100%0.099%KU365777.1
12181218100%0.099%KM078930.1
12141214100%0.099%KM078971.1
12141214100%0.099%KM078970.1
12141214100%0.099%KM078933.1
12121212100%0.099%KU365778.1
12121212100%0.099%KU312312.1
12121212100%0.099%KM078929.1
12011201100%0.099%KF993678.1
11621162100%0.098%JN860885.1
11571157100%0.098%EU545988.1
1140114093%0.099%KJ873161.1
1022102299%0.094%HQ234499.1
92692677%0.099%KM851039.1
89889877%0.098%KM851038.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.