Sign in to follow this  
Followers 0
niman

Full Zika July 2015 Sequence From Salvador Bahia Brazil

3 posts in this topic

LOCUS       KU707826               10648 bp    RNA     linear   VRL 12-FEB-2016
DEFINITION  Zika virus isolate SSABR1, complete genome.
ACCESSION   KU707826
VERSION     KU707826.1  GI:992324757
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10648)
  AUTHORS   Alcantara,L.C.J., Giovanetti,M., Nunes,M.R.T., Vasconcelos,J.M.,
            Vianez,J.L. Jr. and da Silva,S.P.
  TITLE     Zika virus genome from Salvador, Bahia, Brazil

http://www.ncbi.nlm.nih.gov/nuccore/KU707826.1

 

Edited by niman

Share this post


Link to post
Share on other sites
LOCUS       KU707826               10648 bp    RNA     linear   VRL 12-FEB-2016
DEFINITION  Zika virus isolate SSABR1, complete genome.
ACCESSION   KU707826
VERSION     KU707826.1  GI:992324757
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10648)
  AUTHORS   Alcantara,L.C.J., Giovanetti,M., Nunes,M.R.T., Vasconcelos,J.M.,
            Vianez,J.L. Jr. and da Silva,S.P.
  TITLE     Zika virus genome from Salvador, Bahia, Brazil
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10648)
  AUTHORS   Alcantara,L.C.J., Giovanetti,M., Nunes,M.R.T., Vasconcelos,J.M.,
            Vianez,J.L. Jr. and da Silva,S.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-FEB-2016) Centro de Pesquisas Goncalo Moniz, Fundacao
            Oswaldo Cruz, Rua Waldemar Falcao, 121, Candeal, Salvador, Bahia
            40296710, Brazil
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Mira v. v. 4.0; Geneious v. v. 7
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10648
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="SSABR1"
                     /isolation_source="serum"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="01-Jul-2015"
                     /note="type: Asian"
     CDS             79..10350
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AMH87239.1"
                     /db_xref="GI:992324758"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 gacagttcga gtttgaagcg aaagctagca acagtatcaa caggttttat ttggatttgg
       61 aaacgagagt ttctggtcat gaaaaaccca aaaaagaaat ccggaggatt ccggattgtc
      121 aatatgctaa aacgcggagt agcccgtgtg agcccctttg ggggcttgaa gaggctgcca
      181 gccggacttc tgctgggtca tgggcccatc aggatggtct tggcgattct agcctttttg
      241 agattcacgg caatcaagcc atcactgggt ctcatcaata gatggggttc agtggggaaa
      301 aaagaggcta tggaaataat aaagaagttc aagaaagatc tggctgccat gctgagaata
      361 atcaatgcta ggaaggagaa gaagagacga ggcgcagata ctagtgtcgg aattgttggc
      421 ctcctgctga ccacagctat ggcagcggag gtcactagac gtgggagtgc atactatatg
      481 tacttggaca gaaacgatgc tggggaggcc atatcttttc caaccacatt ggggatgaat
      541 aagtgttata tacagatcat ggatcttgga cacatgtgtg atgccaccat gagctatgaa
      601 tgccctatgc tggatgaggg ggtggaacca gatgacgtcg attgttggtg caacacgacg
      661 tcaacttggg ttgtgtacgg aacctgccat cacaaaaaag gtgaagcacg gagatctaga
      721 agagctgtga cgctcccctc ccattccact aggaagctgc aaacgcggtc gcaaacctgg
      781 ttggaatcaa gagaatacac aaagcacttg attagagtcg aaaattggat attcaggaac
      841 cctggcttcg cgttagcagc agctgccatc gcttggcttt tgggaagctc aacgagccaa
      901 aaagtcatat acttggtcat gatactgctg attgccccgg catacagcat caggtgcata
      961 ggagtcagca atagggactt tgtggaaggt atgtcaggtg ggacctgggt tgatgttgtc
     1021 ttggaacatg gaggttgtgt caccgtaatg gcacaggaca aaccgactgt cgacatagag
     1081 ctggttacaa caacagtcag caacatggcg gaggtaagat cctactgcta tgaggcatca
     1141 atatcagaca tggcttcgga cagccgctgc ccaacacaag gtgaagccta ccttgacaag
     1201 caatcagaca ctcaatatgt ctgcaaaaga acgttagtgg acagaggctg gggaaatgga
     1261 tgtggacttt ttggcaaagg gagcctggtg acatgcgcta agtttgcatg ctccaagaaa
     1321 atgaccggga agagcatcca gccagagaat ctggagtacc ggataatgct gtcagttcat
     1381 ggctcccagc acagtgggat gattgttaat gacacaggac atgaaactga tgagaataga
     1441 gcgaaagttg agataacgcc caattcacca agagccgaag ccaccctggg gggttttgga
     1501 agcctaggac ttgattgtga accgaggaca ggccttgact tttcagattt gtattacttg
     1561 actatgaata acaagcactg gttggttcac aaggagtggt tccacgacat tccattacct
     1621 tggcacgctg gggcagacac cggaactcca cactggaaca acaaagaagc actggtagag
     1681 ttcaaggacg cacatgccaa aaggcaaact gtcgtggttc tagggagtca agaaggagca
     1741 gttcacacgg cccttgctgg agctctggag gctgagatgg atggtgcaaa gggaaggctg
     1801 tcctctggcc acttgaaatg tcgcctgaaa atggataaac ttagattgaa gggcgtgtca
     1861 tactccttgt gtactgcagc gttcacattc accaagatcc cggctgaaac actgcacggg
     1921 acagtcacag tggaggtaca gtacgcaggg acagatggac cttgcaaggt tccagctcag
     1981 atggcggtgg acatgcaaac tctgacccca gttgggaggt tgataaccgc taaccccgta
     2041 atcactgaaa gcactgagaa ctctaagatg atgctggaac ttgatccacc atttggggac
     2101 tcttacattg tcataggagt cggggagaag aagatcaccc accactggca caggagtggc
     2161 agcaccattg gaaaagcatt tgaagccact gtgagaggtg ccaagagaat ggcagtcttg
     2221 ggagacacag cctgggactt tggatcagtt ggaggcgctc tcaactcatt gggcaagggc
     2281 atccatcaaa tttttggagc agctttcaaa tcattgtttg gaggaatgtc ctggttctca
     2341 caaattctca ttggaacgtt gctgatgtgg ttgggtctga acacaaagaa tggatctatt
     2401 tcccttatgt gcttggcctt agggggagtg ttgatcttct tatccacagc cgtctctgct
     2461 gatgtggggt gctcggtgga cttctcaaag aaggagacga gatgcggtac aggggtgttc
     2521 gtctataacg acgttgaagc ctggagggac aggtacaagt accatcctga ctccccccgt
     2581 agattggcag cagcagtcaa gcaagcctgg gaagatggta tctgcgggat ctcctctgtt
     2641 tcaagaatgg aaaacatcat gtggagatca gtagaagggg agctcaacgc aatcctggaa
     2701 gagaatggag ttcaactgac ggtcgttgtg ggatctgtaa aaaaccccat gtggagaggt
     2761 ccacagagat tgcccgtgcc tgtgaacgag ctgccccacg gctggaaggc ttgggggaaa
     2821 tcgtacttcg tcagagcagc aaagacaaat aacagctttg tcgtggatgg tgacacactg
     2881 aaggaatgcc cactcaaaca tagagcatgg aacagctttc ttgtggagga tcatgggttc
     2941 ggggtatttc acactagtgt ctggctcaag gttagagaag attattcatt agagtgtgat
     3001 ccagccgtta ttggaacagc tgttaaggga aaggaggctg tacacagtga tctaggctac
     3061 tggattgaga gtgagaagaa tgacacatgg aggctgaaga gggcccatct gatcgagatg
     3121 aaaacatgtg aatggccaaa gtcccacaca ttgtggacag atggaataga agagagtgat
     3181 ctgatcatac ccaagtcttt agctgggcca ctcagccatc acaataccag agagggctac
     3241 aggacccaaa tgaaagggcc atggcacagt gaagagcttg aaattcggtt tgaggaatgc
     3301 ccaggcacta aggtccacgt ggaggaaaca tgtggaacaa gaggaccatc tctgagatca
     3361 accactgcaa gcggaagggt gatcgaggaa tggtgctgca gggagtgcac aatgccccca
     3421 ctgtcgttcc gggctaaaga tggctgttgg tatggaatgg agataaggcc caggaaagaa
     3481 ccagaaagca acttagtaag gtcaatggtg actgcaggat caactgatca catggaccac
     3541 ttctcccttg gagtgcttgt gattctgctc atggtgcagg aagggctgaa gaagagaatg
     3601 accacaaaga tcatcataag cacatcaatg gcagtgctgg tagctatgat cctgggagga
     3661 ttttcaatga gtgacctggc taagcttgca attttgatgg gtgccacctt cgcggaaatg
     3721 aacactggag gagatgtagc tcatctggcg ctgatagcgg cattcaaagt cagaccagcg
     3781 ttgctggtat ctttcatctt cagagctaat tggacacccc gtgaaagcat gctgctggcc
     3841 ttggcctcgt gtcttttgca aactgcgatc tccgccttgg aaggcgacct gatggttctc
     3901 atcaatggtt ttgctttggc ctggttggca atacgagcga tggttgttcc acgcactgat
     3961 aacatcacct tggcaatcct ggctgctctg acaccactgg cccggggcac actgcttgtg
     4021 gcgtggagag caggccttgc tacttgcggg gggtttatgc tcctctctct gaagggaaaa
     4081 ggcagtgtga agaagaactt accatttgtc atggccctgg gactaaccgc tgtgaggctg
     4141 gtcgacccca tcaacgtggt gggactgctg ttgctcacaa ggagtgggaa gcggagctgg
     4201 ccccctagcg aagtactcac agctgttggc ctgatatgcg cattggctgg agggttcgcc
     4261 aaggcagata tagagatggc tgggcccatg gccgcggtcg gtctgctaat tgtcagttac
     4321 gtggtctcag gaaagagtgt ggacatgtac attgaaagag caggtgacat cacatgggaa
     4381 aaagatgcgg aagtcactgg aaacagtccc cggctcgatg tggcgctaga tgagagtggt
     4441 gatttctccc tggtggagga tgacggtccc cccatgagag agatcatact caaggtggtc
     4501 ctgatgacca tctgtggcat gaacccaata gccataccct ttgcagctgg agcgtggtac
     4561 gtatacgtga agactggaaa aaggagtggt gctctatggg atgtgcctgc tcccaaggaa
     4621 gtaaaaaagg gggagaccac agatggagtg tacagagtaa tgactcgtag actgctaggt
     4681 tcaacacaag ttggagtggg agttatgcaa gagggggtct ttcacactat gtggcacgtc
     4741 acaaaaggat ccgcgctgag aagcggtgaa gggagacttg atccatactg gggagatgtc
     4801 aagcaggatc tggtgtcata ctgtggtcca tggaagctag atgccgcctg ggacgggcac
     4861 agcgaggtgc agctcttggc cgtgcccccc ggagagagag cgaggaacat ccagactctg
     4921 cccggaatat ttaagacaaa ggatggggac attggagcgg ttgcgctgga ttacccagca
     4981 ggaacttcag gatctccaat cctagacaag tgtgggagag tgataggact ttatggcaat
     5041 ggggtcgtga tcaaaaatgg gagttatgtt agtgccatca cccaagggag gagggaggaa
     5101 gagactcctg ttgagtgctt cgagccttcg atgctgaaga agaagcagct aactgtctta
     5161 gacttgcatc ctggagctgg gaaaaccagg agagttcttc ctgaaatagt ccgtgaagcc
     5221 ataaaaacaa gactccgtac tgtgatctta gctccaacca gggttgtcgc tgctgaaatg
     5281 gaggaggccc ttagagggct tccagtgcgt tatatgacaa cagcagtcaa tgtcacccac
     5341 tctggaacag aaatcgtcga cttaatgtgc catgccacct tcacttcacg tctactacag
     5401 ccaatcagag tccccaacta taatctgtat attatggatg aggcccactt cacagatccc
     5461 tcaagtatag cagcaagagg atacatttca acaagggttg agatgggcga ggcggctgcc
     5521 atcttcatga ccgccacgcc accaggaacc cgtgacgcat ttccggactc caactcacca
     5581 attatggaca ccgaagtgga agtcccagag agagcctgga gctcaggctt tgattgggtg
     5641 acggatcatt ctggaaaaac agtttggttt gttccaagcg tgaggaacgg caatgagatc
     5701 gcagcttgtc tgacaaaggc tggaaaacgg gtcatacagc tcagcagaaa gacttttgag
     5761 acagagttcc agaaaacaaa acatcaagag tgggactttg tcgtgacaac tgacatttca
     5821 gagatgggcg ccaactttaa agctgaccgt gtcatagatt ccaggagatg cctaaagccg
     5881 gtcatacttg atggcgagag agtcattctg gctggaccca tgcctgtcac acatgccagc
     5941 gctgcccaga ggagggggcg cataggcagg aatcccaaca aacctggaga tgagtatctg
     6001 tatggaggtg ggtgcgcaga gactgacgaa gaccatgcac actggcttga agcaagaatg
     6061 ctccttgaca atatttacct ccaagatggc ctcatagcct cgctctatcg acctgaggcc
     6121 gacaaagtag cagccattga gggagagttc aagcttagga cggagcaaag gaagaccttt
     6181 gtggaactca tgaaaagagg agatcttcct gtttggctgg cctatcaggt tgcatctgcc
     6241 ggaataacct acacagatag aagatggtgc tttgatggca cgaccaacaa caccataatg
     6301 gaagacagtg tgccggcaga ggtgtggacc agacacggag agaaaagagt gctcaaaccg
     6361 aggtggatgg acgccagagt ttgttcagat catgcggccc tgaagtcatt caaggagttt
     6421 gccgctggga aaagaggagc ggcttttgga gtgatggaag ccctgggaac actgccagga
     6481 cacatgacag agagattcca ggaagccatt gacaacctcg ctgtgctcat gcgggcagag
     6541 actggaagca ggccttacaa agccgcggcg gcccaattgc cggagaccct agagaccatt
     6601 atgcttttgg ggttgctggg aacagtctcg ctgggaatct tcttcgtctt gatgaggaac
     6661 aagggcatag ggaagatggg ctttggaatg gtgactcttg gggccagcgc atggctcatg
     6721 tggctctcgg aaattgagcc agccagaatt gcatgtgtcc tcattgttgt gtttctattg
     6781 ctggtggtgc tcatacctga gccagaaaag caaagatctc cccaggacaa ccaaatggca
     6841 atcatcatca tggtagcagt aggtcttctg ggcttgatta ccgccaatga actcggatgg
     6901 ttggagagaa caaagagtga cctaagccat ctaatgggaa ggagagagga gggggcaacc
     6961 ataggattct caatggacat tgacctgcgg ccagcctcag cttgggccat ctatgctgcc
     7021 ttgacaactt tcattacccc agccgtccaa catgcagtga ccacttcata caacaactac
     7081 tccttaatgg cgatggccac gcaagctgga gtgttgtttg gtatgggcaa agggatgcca
     7141 ttctacgcat gggactttgg agtcccgctg ctaatgatag gttgctactc acaattaaca
     7201 cccctgaccc taatagtggc catcattttg ctcgtggcgc actacatgta cttgatccca
     7261 gggctgcagg cagcagctgc gcgtgctgcc cagaagagaa cggcagctgg catcatgaag
     7321 aaccctgttg tggatggaat agtggtgact gacattgaca caatgacaat tgacccccaa
     7381 gtggagaaaa agatgggaca ggtgctactc atagcagtag ccgtctccag cgccatactg
     7441 tcgcggaccg cctgggggtg gggggaggct ggggccctga tcacagccgc aacttccact
     7501 ttgtgggaag gctctccgaa caagtactgg aactcctcta cagccacttc actgtgtaac
     7561 atttttaggg gaagttactt ggctggagct tctctaatct acacagtaac aagaaacgct
     7621 ggcttggtca agagacgtgg gggtggaaca ggagagaccc tgggagagaa atggaaggcc
     7681 cgcttgaacc agatgtcggc cctggagttc tactcctaca aaaagtcagg catcaccgag
     7741 gtgtgcagag aagaggcccg ccgcgccctc aaggacggtg tggcaacggg aggccatgct
     7801 gtgtcccgag gaagtgcaaa gctgagatgg ttggtggagc ggggatacct gcagccctat
     7861 ggaaaggtca ttgatcttgg atgtggcaga gggggctgga gttactacgc cgccaccatc
     7921 cgcaaagttc aagaagtgaa aggatacaca aaaggaggcc ctggtcatga agaacccgtg
     7981 ttggtgcaaa gctatgggtg gaacatagtc cgtcttaaga gtggggtgga cgtctttcat
     8041 atggcggctg agccgtgtga cacgttgctg tgtgacatag gtgagtcatc atctagtcct
     8101 gaagtggaag aagcacggac gctcagagtc ctctccatgg tgggggattg gcttgaaaaa
     8161 agaccaggag ccttttgtat aaaggtgttg tgcccataca ccagcactat gatggaaacc
     8221 ctggagcgac tgcagcgtag gtatggggga ggactggtca gagtgccact ctcccgcaac
     8281 tctacacatg agatgtattg ggtctctgga gcgaaaagca acaccataaa aagtgtgtcc
     8341 accacgagcc agctcctctt ggggcgcatg gacgggccta ggaggccagt gaaatatgag
     8401 gaggatgtga atctcggctc tggcacgcgg gctgtggtaa gctgcgctga agctcccaac
     8461 atgaagatca ttggtaaccg cattgaaagg atccgcagtg agcacgcgga aacgtggttc
     8521 tttgacgaga accacccata taggacatgg gcttaccatg gaagctatga ggcccccaca
     8581 caagggtcag cgtcctctct aataaacggg gttgtcaggc tcctgtcaaa accctgggat
     8641 gtggtgactg gagtcacagg aatagccatg accgacacca caccgtatgg tcagcaaaga
     8701 gttttcaagg aaaaagtgga cactagggtg ccagaccccc aagaaggcac tcgtcaggtt
     8761 atgagcatgg tctcttcctg gttgtggaaa gagctaggca aacacaaacg gccacgagtc
     8821 tgtaccaaag aagagttcat caacaaggtt cgtagcaatg cagcattagg ggcaatattt
     8881 gaagaggaaa aagagtggaa gactgcagtg gaagctgtga acgatccaag gttctgggct
     8941 ctagtggata aggaaagaga gcaccacctg agaggagagt gccagagttg tgtgtacaac
     9001 atgatgggaa aaagagaaaa gaaacaaggg gaatttggaa aggccaaggg cagccgcgcc
     9061 atctggtata tgtggctagg ggctagattt ctagagttcg aagcccttgg attcttgaac
     9121 gaggatcact ggatggggag agagaactca ggaggtggtg ttgaagggct gggattacaa
     9181 agactcggat atgtcctaga agagatgagt cgtataccag gaggaaggat gtatgcagat
     9241 gacactgctg gctgggacac ccgcatcagc aggtttgatc tggagaatga agctctaatc
     9301 accaaccaaa tggaaaaagg gcacagggcc ttggcattgg ccataatcaa gtacacatac
     9361 caaaacaaag tggtaaaggt ccttagacca gctgaaaaag ggaaaacagt tatggacatt
     9421 atttcgagac aagaccaaag ggggagcgga caagttgtca cttacgctct taacacattt
     9481 accaacctag tggtgcaact cattcggaat atggaggctg aggaagttct agagatgcaa
     9541 gacttgtggc tgctgcggag gtcagagaaa gtgaccaact ggttgcagag caacggatgg
     9601 gataggctca aacgaatggc agtcagtgga gatgattgcg ttgtgaagcc aattgatgat
     9661 aggtttgcac atgccctcag gttcttgaat gatatgggaa aagttaggaa ggacacacaa
     9721 gagtggaaac cctcaactgg atgggacaac tgggaagaag ttccgttttg ctcccaccac
     9781 ttcaacaagc tccatctcaa ggacgggagg tccattgtgg ttccctgccg ccaccaagat
     9841 gaactgattg gccgggcccg cgtctctcca ggggcgggat ggagcatccg ggagactgct
     9901 tgcctagcaa aatcatatgc gcaaatgtgg cagctccttt atttccacag aagggacctc
     9961 cgactgatgg ccaatgccat ttgttcatct gtgccagttg actgggttcc aactgggaga
    10021 actacctggt caatccatgg aaagggagaa tggatgacca ctgaagacat gcttgtggtg
    10081 tggaacagag tgtggattga ggagaacgac cacatggaag acaagacccc agttacgaaa
    10141 tggacagaca tcccctattt gggaaaaagg gaagacttgt ggtgtggatc tctcataggg
    10201 cacagaccgc gcaccacctg ggctgagaac attaaaaaca cagtcaacat ggtgcgcagg
    10261 atcataggtg atgaagaaaa gtacatggac tacctatcca cccaagttcg ctacttgggt
    10321 gaagaagggt ctacacctgg agtgctgtaa gcaccagtct taatgttgtc aggcctgcta
    10381 gtcagccaca gcttggggaa agctgtgcag cctgtgaccc ccccaggaga agctgggaaa
    10441 ccaagcctat agtcaggccg agaacgccat ggcacggaag aagccatgct gcctgtgagc
    10501 ccctcagagg acactgagtc aaaaaacccc acgcgcttgg aggcgcagga tgggaaaaga
    10561 aggtggcgac cttccccacc cttcaatctg gggcctgaac tggagatcag ctgtggatct
    10621 ccagaagagg gactagtggt tagaggag

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1852518525100%0.0100%KU365779.1
1850718507100%0.099%KU365777.1
1850218502100%0.099%KU365780.1
1842018420100%0.099%KU509998.1
1842018420100%0.099%KU365778.1
1842018420100%0.099%KU312312.1
1841718417100%0.099%KJ776791.1
1841118411100%0.099%KU501215.1
1840818408100%0.099%KU321639.1
1838418384100%0.099%KU501217.1
1838118381100%0.099%KU647676.1
1838118381100%0.099%KU501216.1
177661776699%0.098%JN860885.1
177211772198%0.099%KF993678.1
1761217612100%0.098%EU545988.1
164691646999%0.096%HQ234499.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.