Sign in to follow this  
Followers 0
niman

Full Zika Sequence From Amniotic Fluid Microcephaly Paraiba Brazil

6 posts in this topic

LOCUS       KU497555               10793 bp    RNA     linear   VRL 18-FEB-2016
DEFINITION  Zika virus isolate Brazil-ZKV2015, complete genome.
ACCESSION   KU497555
VERSION     KU497555.1  GI:985578255
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10793)
  AUTHORS   Calvet,G., Aguiar,R.S., Melo,A.S.O., Sampaio,S.A., de Filippis,I.,
            Fabri,A., Araujo,E.S.M., de Sequeira,P.C., de Mendonca,M.C.L., de
            Oliveira,L., Tschoeke,D.A., Schrago,C.G., Thompson,F.L., Brasil,P.,
            dos Santos,F.B., Nogueira,R.M.R., Tanuri,A. and de Filippis,A.M.B.
  TITLE     Detection and sequencing of Zika virus from amniotic fluid of
            fetuses with microcephaly in Brazil: a case study
  JOURNAL   Lancet Infect Dis (2016) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 10793)
  AUTHORS   Tanuri,A., Bispo,A., Thompson,F., Santana,R., Tschoeke,D., de
            Oliveira,L. and Guerra,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JAN-2016) UFRJ, UFRJ, Avenida Carlos Chagas Filho,
            373, Rio de Janeiro, Rio de Janeiro 21040-900, Brazil
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: SPAdes v. 3.6
            Assembly Name         :: ZKV Brazil
            Coverage              :: 19 X
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10793
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="Brazil-ZKV2015"
                     /isolation_source="anminiotic liquid"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="30-Nov-2015"

http://www.ncbi.nlm.nih.gov/nuccore/KU497555

 

Share this post


Link to post
Share on other sites
OCUS       KU497555               10793 bp    RNA     linear   VRL 18-FEB-2016
DEFINITION  Zika virus isolate Brazil-ZKV2015, complete genome.
ACCESSION   KU497555
VERSION     KU497555.1  GI:985578255
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10793)
  AUTHORS   Calvet,G., Aguiar,R.S., Melo,A.S.O., Sampaio,S.A., de Filippis,I.,
            Fabri,A., Araujo,E.S.M., de Sequeira,P.C., de Mendonca,M.C.L., de
            Oliveira,L., Tschoeke,D.A., Schrago,C.G., Thompson,F.L., Brasil,P.,
            dos Santos,F.B., Nogueira,R.M.R., Tanuri,A. and de Filippis,A.M.B.
  TITLE     Detection and sequencing of Zika virus from amniotic fluid of
            fetuses with microcephaly in Brazil: a case study
  JOURNAL   Lancet Infect Dis (2016) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 10793)
  AUTHORS   Tanuri,A., Bispo,A., Thompson,F., Santana,R., Tschoeke,D., de
            Oliveira,L. and Guerra,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JAN-2016) UFRJ, UFRJ, Avenida Carlos Chagas Filho,
            373, Rio de Janeiro, Rio de Janeiro 21040-900, Brazil
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: SPAdes v. 3.6
            Assembly Name         :: ZKV Brazil
            Coverage              :: 19 X
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10793
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="Brazil-ZKV2015"
                     /isolation_source="anminiotic liquid"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="30-Nov-2015"
     CDS             101..10372
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AMD16557.1"
                     /db_xref="GI:985578256"
                     /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK
                     RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET
                     DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF
                     HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGTQEGAVHTALAGALEAE
                     MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
                     TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG
                     EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG
                     AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC
                     SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR
                     MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK
                     SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE
                     CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI
                     EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR
                     GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA
                     GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA
                     ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCFLQT
                     AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL
                     ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE
                     VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD
                     AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY
                     VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW
                     HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN
                     IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT
                     QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP
                     TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY
                     IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV
                     PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT
                     KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR
                     RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK
                     VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM
                     EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL
                     PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV
                     LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP
                     QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA
                     SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL
                     LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV
                     VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP
                     NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ
                     MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK
                     VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH
                     MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM
                     ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP
                     VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG
                     SYVAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD
                     PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV
                     EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA
                     RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD
                     TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ
                     DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR
                     LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH
                     FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR
                     DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT
                     PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST
                     QVRYLGEEGSTPGVL"
ORIGIN      
        1 ccaatctgtg aatcagactg cgacagttcg agtttgaagc gaaagctagc aacagtatca
       61 acaggtttta ttttggattt ggaaacgaga gtttctggtc atgaaaaacc caaaaaagaa
      121 atccggagga ttccggattg tcaatatgct aaaacgcgga gtagcccgtg tgagcccctt
      181 tgggggcttg aagaggctgc cagccggact tctgctgggt catgggccca tcaggatggt
      241 cttggcgatt ctagcctttt tgagattcac ggcaatcaag ccatcactgg gtctcatcaa
      301 tagatggggt tcagtgggga aaaaagaggc tatggaaata ataaagaagt tcaagaaaga
      361 tctggctgcc atgctgagaa taatcaatgc caggaaggag aagaagagac gaggcgcaga
      421 tactagtgtc ggaatcgttg gcctcctgct gaccacagct atggcagcgg aggtcactag
      481 acgtgggagt gcatactata tgtacttgga cagaaacgat gctggggagg ccatatcttt
      541 tccaaccaca ttggggatga ataagtgtta tatacagatc atggatcttg gacacatgtg
      601 tgatgccacc atgagctatg aatgccctat gctggatgag ggggtggaac cagatgacgt
      661 cgattgttgg tgcaacacga cgtcaacttg ggttgtgtac ggaacctgcc atcacaaaaa
      721 aggtgaagca cggagatcta gaagagctgt gacgctcccc tcccattcca ctaggaagct
      781 gcaaacgcgg tcgcaaacct ggttggaatc aagagaatac acaaagcact tgattagagt
      841 cgaaaattgg atattcagga accctggctt cgcgttagca gcagctgcca tcgcttggct
      901 tttgggaagc tcaacgagcc aaaaagtcat atacttggtc atgatactgc tgattgcccc
      961 ggcatacagc atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg
     1021 tgggacttgg gttgatgttg tcttggaaca tgggggttgt gtcaccgtaa tggcacagga
     1081 caaaccgact gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag
     1141 atcctactgc tatgaggcat caatatcaga catggcttcg gacagccgct gcccaacaca
     1201 aggtgaagcc taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt
     1261 ggacagaggc tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacatgcgc
     1321 taagtttgca tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta
     1381 ccggataatg ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg
     1441 acatgaaact gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga
     1501 agccaccctg gggggttttg gaagcttagg acttgattgt gaaccgagga caggccttga
     1561 cttttcagat ttgtattact tgactatgaa taacaagcac tggttggttc acaaggagtg
     1621 gttccacgac attccattac cttggcacgc tggggcagac accggaactc cacactggaa
     1681 caacaaagaa gcactggtag agttcaagga cgcacatgcc aaaaggcaaa ctgtcgtggt
     1741 tctagggact caagaaggag cagttcacac ggcccttgct ggagctctgg aggctgagat
     1801 ggatggtgca aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa
     1861 acttagattg aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaagat
     1921 cccggctgaa acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg
     1981 accttgcaag gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag
     2041 gttgataacc gctaaccccg taatcactga aagcactgag aactctaaga tgatgctgga
     2101 acttgatcca ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac
     2161 ccaccactgg cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg
     2221 tgccaagaga atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc
     2281 tctcaactca ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt
     2341 tggaggaatg tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggtct
     2401 gaacacaaag aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt
     2461 cttatccaca gccgtctctg ctgatgtggg gtgctcggtg gacttctcaa agaaggagac
     2521 gagatgtggt acaggggtgt tcgtctataa cgacgttgaa gcctggaggg acaggtacaa
     2581 gtaccatcct gactctcccc gtagattggc agcagcagtc aagcaagcct gggaagatgg
     2641 tatctgcggg atctcctctg tttcaagaat ggaaaacatc atgtggagat cagtagaagg
     2701 ggagcttaac gcaatcctgg aagagaatgg agttcaactg acggtcgttg tgggatctgt
     2761 aaaaaacccc atgtggagag gtccacagag attgcccgtg cctgtgaacg agctgcccca
     2821 cggctggaag gcttggggga aatcgtactt cgtcagagca gcaaagacaa ataacagctt
     2881 tgtcgtggat ggtgacacac tgaaggaatg cccactcaaa catagagcat ggaacagctt
     2941 tcttgtggag gatcatgggt tcggggtatt tcacactagt gtctggctca aggttagaga
     3001 agattattca ttagagtgtg atccagccgt tattggaaca gctgttaagg gaaaggaggc
     3061 tgtacacagt gatctaggct actggattga gagtgagaag aatgacacat ggaggctgaa
     3121 gagggcccat ctgatcgaga tgaaaacatg tgaatggcca aagtcccaca cattgtggac
     3181 agatggaata gaagagagtg atctgatcat acccaagtct ttagctgggc cactcagcca
     3241 tcacaatacc agagagggct acaggaccca aatgaaaggg ccatggcaca gtgaagagct
     3301 tgaaattcgg tttgaggaat gcccaggcac taaggtccac gtggaggaaa catgtggaac
     3361 aagaggacca tctctgagat caaccactgc aagcggaagg gtgatcgagg aatggtgctg
     3421 cagggagtgc acaatgcccc cactgtcgtt ccgggctaaa gatggctgtt ggtatggaat
     3481 ggagataagg cccaggaaag aaccagaaag caacttagta aggtcaatgg tgactgcagg
     3541 atcaactgat cacatggatc acttctccct tggagtgctt gtgattctgc tcatggtgca
     3601 ggaagggctg aagaagagaa tgaccacaaa gatcatcata agcacatcaa tggcagtgct
     3661 ggtagctatg atcctgggag gattttcaat gagtgacctg gctaagcttg caattttgat
     3721 gggtgccacc ttcgcggaaa tgaacactgg aggagatgta gctcatctgg cgctgatagc
     3781 ggcattcaaa gtcagaccag cgttgctggt atctttcatc ttcagagcta attggacacc
     3841 ccgtgaaagc atgctgctgg ccttggcctc gtgttttttg caaactgcga tctccgcctt
     3901 ggaaggcgac ctgatggttc tcatcaatgg ttttgctttg gcctggttgg caatacgagc
     3961 gatggttgtt ccacgcactg acaacatcac cttggcaatc ctggctgctc tgacaccact
     4021 ggcccggggc acactgcttg tggcgtggag agcaggcctt gctacttgcg gggggtttat
     4081 gctcctctct ctgaagggaa aaggcagtgt gaagaagaac ttaccatttg tcatggccct
     4141 gggactaacc gctgtgaggc tggtcgaccc catcaacgtg gtgggactgc tgttgctcac
     4201 aaggagtggg aagcggagct ggccccctag cgaagtactc acagctgttg gcctgatatg
     4261 cgcattggct ggagggttcg ccaaggcaga tatagagatg gctgggccca tggccgcggt
     4321 cggtctgcta attgtcagtt acgtggtctc aggaaagagt gtggacatgt acattgaaag
     4381 agcaggtgac atcacatggg aaaaagatgc ggaagtcact ggaaacagtc cccggctcga
     4441 tgtggcgcta gatgagagtg gtgacttctc cctggtggag gatgacggtc cccccatgag
     4501 agagatcata ctcaaggtgg tcctgatgac catctgtggc atgaacccaa tagccatacc
     4561 ctttgcagct ggagcgtggt acgtatacgt gaagactgga aaaaggagtg gtgctctatg
     4621 ggatgtgcct gctcccaagg aagtaaaaaa gggggagacc acagatggag tgtacagagt
     4681 aatgactcgt agactgctag gttcaacaca agttggagtg ggagttatgc aagagggggt
     4741 ctttcacact atgtggcacg tcacaaaagg atccgcgctg agaagcggtg aagggagact
     4801 tgatccatac tggggagatg tcaagcagga tctggtgtca tactgtggtc catggaagct
     4861 agatgccgcc tgggacgggc acagcgaggt gcagctcttg gccgtgcccc ccggagagag
     4921 agcgaggaac atccagactc tgcccggaat atttaagaca aaggatgggg acattggagc
     4981 ggttgcgctg gattacccag caggaacttc aggatctcca atcctagaca agtgtgggag
     5041 agtgatagga ctttatggca atggggtcgt gataaaaaat gggagttatg ttagtgccat
     5101 cacccaaggg aggagggagg aagagactcc tgttgagtgc ttcgagcctt cgatgctgaa
     5161 gaagaagcag ctaactgtct tagacttgca tcctggagct gggaaaacca ggagagttct
     5221 tcctgaaata gtccgtgaag ccataaaaac aagactccgt actgtgatct tagctccaac
     5281 cagggttgtc gctgctgaaa tggaggaagc ccttagaggg cttccagtgc gttatatgac
     5341 aacagcagtc aatgtcaccc actctggaac agaaatcgtc gacttaatgt gccatgccac
     5401 cttcacttca cgtctactac agccaatcag agtccccaac tataatctgt atattatgga
     5461 tgaggcccac ttcacagatc cctcaagcat agcagcaaga ggatacattt caacaagggt
     5521 tgagatgggc gaggcggctg ccatcttcat gaccgccacg ccaccaggaa cccgtgacgc
     5581 atttccggac tccaactcac caattatgga caccgaagtg gaagtcccag agagagcctg
     5641 gagctcaggc tttgattggg tgacggatca ttctggaaaa acagtttggt ttgttccaag
     5701 cgtgaggaac ggcaatgaga tcgcagcttg tctgacaaag gctggaaaac gggtcataca
     5761 gctcagcaga aagacttttg agacagagtt ccagaaaaca aaacatcaag agtgggactt
     5821 tgtcgtgaca actgacattt cagagatggg cgccaacttt aaagctgacc gtgtcataga
     5881 ttccaggaga tgcctaaagc cggtcatact tgatggcgag agagtcattc tggctggacc
     5941 catgcctgtc acacatgcca gcgctgccca gaggaggggg cgcataggca ggaatcccaa
     6001 caaacctgga gatgagtacc tgtatggagg tgggtgcgca gagactgacg aagaccatgc
     6061 acactggctt gaagcaagaa tgctccttga caatatttac ctccaagatg gcctcatagc
     6121 ctcgctctat cgacctgagg ccgacaaagt agcagccatt gagggagagt tcaagcttag
     6181 gacggagcaa aggaagacct ttgtggaact catgaaaaga ggagatcttc ctgtttggct
     6241 ggcctatcag gttgcatctg ccggaataac ctacacagat agaagatggt gctttgatgg
     6301 cacgaccaac aacaccataa tggaagacag tgtgccggca gaggtgtgga ccagacacgg
     6361 agagaaaaga gtgctcaaac cgaggtggat ggacgccaga gtttgttcag atcatgcggc
     6421 cctgaagtca ttcaaggagt ttgccgctgg gaaaagagga gcggcttttg gagtgatgga
     6481 agccctggga acactgccag gacacatgac agagagattc caggaagcca ttgacaacct
     6541 cgctgtgctc atgcgggcag agactggaag caggccttac aaagccgcgg cggcccaatt
     6601 gccggagacc ctagagacca ttatgctttt ggggttgctg ggaacagtct cgctgggaat
     6661 ctttttcgtc ttgatgagga acaagggcat agggaagatg ggctttggaa tggtgactct
     6721 tggggccagc gcatggctca tgtggctctc ggaaattgag ccagccagaa ttgcatgtgt
     6781 cctcattgtt gtgttcctat tgctggtggt gctcatacct gagccagaaa agcaaagatc
     6841 tccccaggac aaccaaatgg caatcatcat catggtagca gtaggtcttc tgggcttgat
     6901 taccgccaat gaactcggat ggttggagag aacaaagagt gacctaagcc atctaatggg
     6961 aaggagagag gagggggcaa ccataggatt ctcaatggac attgacctgc ggccagcctc
     7021 agcttgggcc atctatgctg ccttgacaac tttcattacc ccagccgtcc aacatgcagt
     7081 gaccacttca tacaacaact actccttaat ggcgatggcc acgcaagctg gagtgttgtt
     7141 tggtatgggc aaagggatgc cattctacgc atgggacttt ggagtcccgc tgctaatgat
     7201 aggttgctac tcacaattaa cacccctgac cctaatagtg gccatcattt tgctcgtggc
     7261 gcactacatg tacttgatcc cagggctgca ggcagcagct gcgcgtgctg cccagaagag
     7321 aacggcagct ggcatcatga agaaccctgt tgtggatgga atagtggtga ctgacattga
     7381 cacaatgaca attgaccccc aagtggagaa aaagatggga caggtgctac tcatagcagt
     7441 agccgtctcc agcgccatac tgtcgcggac cgcctggggg tggggggagg ctggggccct
     7501 gatcacagcc gcaacttcca ctttgtggga aggctctccg aacaagtact ggaactcctc
     7561 tacagccact tcactgtgta acatttttag gggaagttac ttggctggag cttctctaat
     7621 ctacacagta acaagaaacg ctggcttggt caagagacgt gggggtggaa caggagagac
     7681 cctgggagag aaatggaagg cccgcttgaa ccagatgtcg gccctggagt tctactccta
     7741 caaaaagtca ggcatcaccg aggtgtgcag agaagaggcc cgccgcgccc tcaaggacgg
     7801 tgtggcaacg ggaggccatg ctgtgtcccg aggaagtgca aagctgagat ggttggtgga
     7861 gcggggatac ctgcagccct atggaaaggt cattgatctt ggatgtggca gagggggctg
     7921 gagttactac gccgccacca tccgcaaagt tcaagaagtg aaaggataca caaaaggagg
     7981 ccctggtcat gaagaacccg tgttggtgca aagctatggg tggaacatag tccgtcttaa
     8041 gagtggggtg gacgtctttc atatggcggc tgagccgtgt gacacgttgc tgtgtgacat
     8101 aggtgagtca tcatctagtc ctgaagtgga agaagcacgg acgctcagag tcctctccat
     8161 ggtgggggat tggcttgaaa aaagaccagg agccttttgc ataaaagtgt tgtgcccata
     8221 caccagcact atgatggaaa ccctggagcg actgcagcgt aggtatgggg gaggactggt
     8281 cagagtgcca ctctcccgca actctacaca tgagatgtac tgggtctctg gagcgaaaag
     8341 caacaccata aaaagtgtgt ccaccacgag ccagctcctc ttggggcgca tggacgggcc
     8401 taggaggcca gtgaaatatg aggaggatgt gaatctcggc tctggcacgc gggctgtggt
     8461 aagctgcgct gaagctccca acatgaagat cattggtaac cgcattgaaa ggatccgcag
     8521 tgagcacgcg gaaacgtggt tctttgacga aaaccaccca tataggacat gggcttacca
     8581 tggaagctat gtggccccca cacaagggtc agcgtcctct ctaataaacg gggttgtcag
     8641 gctcctgtca aaaccctggg atgtggtgac tggagtcaca ggaatagcca tgaccgacac
     8701 cacaccgtat ggtcagcaaa gagttttcaa ggaaaaagtg gacactaggg tgccagaccc
     8761 ccaagaaggc actcgtcagg ttatgagcat ggtctcttcc tggttgtgga aagagctagg
     8821 caaacacaaa cgaccacgag tctgtaccaa agaagagttc atcaacaagg ttcgtagcaa
     8881 tgcagcatta ggggcaatat ttgaagagga aaaagagtgg aagactgcag tggaagctgt
     8941 gaacgatcca aggttctggg ctctagtgga caaggaaaga gagcaccacc tgagaggaga
     9001 gtgccagagt tgtgtgtaca acatgatggg aaaaagagaa aagaaacaag gggaatttgg
     9061 aaaggccaag ggcagccgcg ccatctggta tatgtggcta ggggctagat ttctagagtt
     9121 cgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg
     9181 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc
     9241 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga
     9301 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt
     9361 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa
     9421 agggaaaaca gttatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt
     9481 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc
     9541 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa
     9601 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg
     9661 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg
     9721 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga
     9781 agttccgttt tgctcccacc acttcaacaa gctccatctc aaggacggga ggtccattgt
     9841 ggttccctgc cgccaccaag atgaactgat tggccgggcc cgcgtctctc caggggcggg
     9901 atggagcatc cgggagactg cttgcctagc aaaatcatat gcgcaaatgt ggcagctcct
     9961 ttatttccac agaagggacc tccgactgat ggccaatgcc atttgttcat ctgtgccagt
    10021 tgactgggtt ccaactggga gaactacctg gtcaatccat ggaaagggag aatggatgac
    10081 cactgaagac atgcttgtgg tgtggaacag agtgtggatt gaggagaacg accacatgga
    10141 agacaagacc ccagttacga aatggacaga cattccctat ttgggaaaaa gggaagactt
    10201 gtggtgtgga tctctcatag ggcacagacc gcgcaccacc tgggctgaga acattaaaaa
    10261 tacagtcaac atggtgcgca ggatcatagg tgatgaagaa aagtacatgg actacctatc
    10321 cacccaagtt cgctacttgg gtgaagaagg gtctacacct ggagtgctgt gagcaccaat
    10381 cttaatgttg tcaggcctgc tagtcagcca cagcttgggg aaagctgtgc agcctgtgac
    10441 ccctccagga gaagctgggt aaccaagcct atagtcaggc cgagaacgcc atggcacgga
    10501 agaagccatg ctgcctgtga gcccctcaga ggacactgag tcaaaaaacc ccacgcgctt
    10561 ggaggcgcag gatgggaaaa gaaggtggcg accttcccca cccttcaatc tggggcctga
    10621 actggagatc agctgtggat ctccagaaga gggactagtg gttagaggag accccccgga
    10681 aaacgcaaaa cagcatattg acgctgggaa agaccagaga ctccatgagt ttccaccacg
    10741 ctggccgcca ggcacagatc gccgaatagc ggcggccggt gtggggaaat cca

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
183951839599%0.099%KU509998.1
183901839099%0.099%KJ776791.1
183811838199%0.099%KU321639.1
183721837299%0.099%KU647676.1
183721837299%0.099%KU365779.1
183591835999%0.099%KU365780.1
183541835499%0.099%KU365777.1
183501835099%0.099%KU501217.1
183451834599%0.099%KU501216.1
183411834199%0.099%KU365778.1
183411834199%0.099%KU312312.1
183321833299%0.099%KU501215.1
177531775399%0.098%JN860885.1
177151771598%0.099%KF993678.1
176031760399%0.098%EU545988.1
164111641199%0.095%HQ234499.1

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
11931193100%0.0100%KU497555.1
11931193100%0.0100%KU232299.1
11931193100%0.0100%KU232298.1
11931193100%0.0100%KU232296.1
11931193100%0.0100%KU232295.1
11931193100%0.0100%KU232294.1
11931193100%0.0100%KU232290.1
11931193100%0.0100%KU232289.1
11931193100%0.0100%KU232288.1
11931193100%0.0100%KU556802.1
11931193100%0.0100%KU647676.1
11891189100%0.099%KU232300.1
11871187100%0.099%KU232293.1
11871187100%0.099%KU232292.1
11871187100%0.099%KU509998.1
11871187100%0.099%KU321639.1
11871187100%0.099%KM078936.1
11871187100%0.099%KJ873160.1
11871187100%0.099%KJ776791.1
11861186100%0.099%KM078961.1
11841184100%0.099%KU740184.1
11841184100%0.099%KU707826.1
11841184100%0.099%KU527068.1
11841184100%0.099%KU232297.1
11841184100%0.099%KU501217.1
11841184100%0.099%KU501216.1
11841184100%0.099%KU501215.1
11841184100%0.099%KU365780.1
11841184100%0.099%KU365779.1
11841184100%0.099%KU365777.1
11841184100%0.099%KM078930.1
11801180100%0.099%KM078971.1
11801180100%0.099%KM078970.1
11801180100%0.099%KM078933.1
11781178100%0.099%KU232291.1
11781178100%0.099%KU365778.1
11781178100%0.099%KU312312.1
11781178100%0.099%KM078929.1
11691169100%0.099%KF993678.1
11661166100%0.099%KU744693.1
11601160100%0.099%KU681081.3
11601160100%0.099%KU179098.1
11391139100%0.098%JN860885.1
11331133100%0.098%EU545988.1
11241124100%0.098%KU681082.3
1108110893%0.099%KJ873161.1
10251025100%0.094%HQ234499.1
90290277%0.099%KM851039.1
88188177%0.098%KM851038.1

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
1852518525100%0.0100%KU497555.1
183951839599%0.099%KU509998.1
183901839099%0.099%KJ776791.1
183811838199%0.099%KU321639.1
183721837299%0.099%KU707826.1
183721837299%0.099%KU647676.1
183721837299%0.099%KU365779.1
183591835999%0.099%KU365780.1
183541835499%0.099%KU365777.1
183501835099%0.099%KU501217.1
183451834599%0.099%KU527068.1
183451834599%0.099%KU501216.1
183411834199%0.099%KU365778.1
183411834199%0.099%KU312312.1
183321833299%0.099%KU501215.1
183051830599%0.099%KU740184.1
181461814699%0.099%KU744693.1
180581805899%0.099%KU681081.3
177531775399%0.098%JN860885.1
177151771598%0.099%KF993678.1
176031760399%0.098%EU545988.1
174571745799%0.098%KU681082.3
164111641199%0.095%HQ234499.

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.