Sign in to follow this  
Followers 0
niman

Partial Zika Sequence From Jambi Indonesia Dec 2014

4 posts in this topic

LOCUS       KU179098                1148 bp    RNA     linear   VRL 19-FEB-2016
DEFINITION  Zika virus isolate JMB-185 nonstructural protein 5 gene, partial
            cds.
ACCESSION   KU179098
VERSION     KU179098.1  GI:998491569
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 1148)
  AUTHORS   Perkasa,A., Yudaputri,F., Haryanto,S., Hayati,R.F., Ma'roef,C.N.,
            Antonjaya,U., Yohan,B., Myint,K.S.A., Ledderman,J.P., Rosenberg,R.,
            Powers,A.M. and Sasmono,R.T.
  TITLE     Isolation of Zika virus from febrile patient, Indonesia
  JOURNAL   Emerging Infect. Dis. 22 (5) (2016) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 1148)
  AUTHORS   Perkasa,A., Yudaputri,F., Haryanto,S., Hayati,R.F., Ma'roef,C.N.,
            Antonjaya,U., Yohan,B., Myint,K.S.A., Ledderman,J.P., Rosenberg,R.,
            Powers,A.M. and Sasmono,R.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-NOV-2015) Dengue Unit, Eijkman Institute for
            Molecular Biology, Jl. Diponegoro 69, Jakarta 10430, Indonesia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1148
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="JMB-185"
                     /isolation_source="serum"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Indonesia: Jambi"
                     /collection_date="30-Dec-2014"

Share this post


Link to post
Share on other sites
LOCUS       KU179098                1148 bp    RNA     linear   VRL 19-FEB-2016
DEFINITION  Zika virus isolate JMB-185 nonstructural protein 5 gene, partial
            cds.
ACCESSION   KU179098
VERSION     KU179098.1  GI:998491569
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 1148)
  AUTHORS   Perkasa,A., Yudaputri,F., Haryanto,S., Hayati,R.F., Ma'roef,C.N.,
            Antonjaya,U., Yohan,B., Myint,K.S.A., Ledderman,J.P., Rosenberg,R.,
            Powers,A.M. and Sasmono,R.T.
  TITLE     Isolation of Zika virus from febrile patient, Indonesia
  JOURNAL   Emerging Infect. Dis. 22 (5) (2016) In press
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 1148)
  AUTHORS   Perkasa,A., Yudaputri,F., Haryanto,S., Hayati,R.F., Ma'roef,C.N.,
            Antonjaya,U., Yohan,B., Myint,K.S.A., Ledderman,J.P., Rosenberg,R.,
            Powers,A.M. and Sasmono,R.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-NOV-2015) Dengue Unit, Eijkman Institute for
            Molecular Biology, Jl. Diponegoro 69, Jakarta 10430, Indonesia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1148
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="JMB-185"
                     /isolation_source="serum"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Indonesia: Jambi"
                     /collection_date="30-Dec-2014"
     CDS             <1..>1148
                     /note="NS5"
                     /codon_start=1
                     /product="nonstructural protein 5"
                     /protein_id="AMK49492.1"
                     /db_xref="GI:998491570"
                     /translation="GAIFEEEKEWKTAVEAVNDPRFWALVDKEREHHLRGECQSCVYN
                     MMGKREKKQGEFGKAKGSRAIWYMWLGARFLEFEALGFLNEDHWMGRENSGGGVEGLG
                     LQRLGYVLEEMSRIPGGRMYADDTAGWDTRISRFDLENEALITNQMEKGHRALALAII
                     KYTYQNKVVKVLRPAEKGKTVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAE
                     EVLEMQDLWLLRRSEKVTNWLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDM
                     GKVRKDTQEWKPSTGWDNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDELIGRARVSP
                     GAGWSIRETACLAKSYAQMWQLLYFHRRDLRLMANAICSSVPVDWVPTG"
ORIGIN      
        1 ggagcaatat ttgaagagga aaaagagtgg aagactgcag tggaagctgt gaacgatcca
       61 aggttctggg ctctagtgga caaggaaaga gagcaccacc tgagaggaga gtgccagagc
      121 tgtgtgtaca acatgatggg aaaaagagaa aagaaacaag gggaatttgg aaaggccaag
      181 ggcagccgcg ccatctggta tatgtggcta ggggctagat ttctagagtt cgaagccctt
      241 ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg tgttgaaggg
      301 ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc aggaggaagg
      361 atgtatgcag atgatactgc tggctgggac acccgcatca gcaggtttga tctggagaat
      421 gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt ggccataatc
      481 aagtatacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa agggaagaca
      541 gttatggaca ttatttcaag acaagaccaa agggggagcg gacaagttgt cacttacgct
      601 cttaatacat ttaccaacct agtggtgcag ctcattcgga atatggaggc tgaggaagtt
      661 ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa ctggttgcag
      721 agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg cgttgtgaag
      781 ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg aaaagttagg
      841 aaggacacac aagagtggaa accctcgact ggatgggaca actgggaaga agttccgttt
      901 tgctcccacc acttcaacaa gctccatctc aaggacggga ggtccattgt ggttccctgc
      961 cgccaccaag atgaactgat tggccgggcc cgcgtctctc caggggcggg atggagcatc
     1021 cgggagactg cttgcctagc aaaatcgtat gcgcaaatgt ggcagctcct ttatttccac
     1081 agaagggacc tccgactgat ggccaatgcc atttgttcat ctgtgccagt tgactgggtt
     1141 ccaactgg

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
20352035100%0.099%KF993678.1
20302030100%0.099%KU509998.1
20302030100%0.099%KJ776791.1
20262026100%0.099%KU647676.1
20262026100%0.099%KU501217.1
20262026100%0.099%KU501216.1
20212021100%0.099%KU501215.1
20212021100%0.099%KU321639.1
20122012100%0.099%KU365780.1
20122012100%0.099%KU365779.1
20122012100%0.099%KU365777.1
20122012100%0.099%KU312312.1
20032003100%0.099%KU365778.1
19991999100%0.099%JN860885.1
19841984100%0.098%EU545988.1
18191819100%0.095%HQ234499.1
1710171084%0.099%KM078936.1
1709170984%0.099%KM078961.1
1707170784%0.099%KM078930.1
1703170384%0.099%KM078971.1
1703170384%0.099%KM078970.1
1703170384%0.099%KM078933.1
1701170184%0.099%KM078929.1
1579157977%0.099%KJ873160.1

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
20712071100%0.0100%KU179098.1
20352035100%0.099%KF993678.1
20302030100%0.099%KU509998.1
20302030100%0.099%KJ776791.1
20262026100%0.099%KU497555.1
20262026100%0.099%KU647676.1
20262026100%0.099%KU501217.1
20262026100%0.099%KU501216.1
20212021100%0.099%KU501215.1
20212021100%0.099%KU321639.1
20172017100%0.099%KU527068.1
20122012100%0.099%KU740184.1
20122012100%0.099%KU707826.1
20122012100%0.099%KU365780.1
20122012100%0.099%KU365779.1
20122012100%0.099%KU365777.1
20122012100%0.099%KU312312.1
20032003100%0.099%KU365778.1
19991999100%0.099%KU681081.3
19991999100%0.099%JN860885.1
19941994100%0.099%KU744693.1
19841984100%0.098%EU545988.1
19631963100%0.098%KU681082.3
18191819100%0.095%HQ234499.1
1710171084%0.099%KM078936.1
1709170984%0.099%KM078961.1
1707170784%0.099%KM078930.1
1703170384%0.099%KM078971.1
1703170384%0.099%KM078970.1
1703170384%0.099%KM078933.1
1701170184%0.099%KM078929.1
1579157977%0.099%KJ873160.1

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.