Sign in to follow this  
Followers 0
niman

January 2016 Iowa Swine Matches 2012 H3N2v Cases

5 posts in this topic

LOCUS       KU666891                1701 bp    cRNA    linear   VRL 27-FEB-2016
DEFINITION  Influenza A virus (A/swine/Iowa/A01729543/2016(H3N2)) segment 4
            hemagglutinin (HA) gene, complete cds.
ACCESSION   KU666891
VERSION     KU666891.1  GI:998632705
KEYWORDS    .
SOURCE      Influenza A virus (A/swine/Iowa/A01729543/2016(H3N2))
  ORGANISM  Influenza A virus (A/swine/Iowa/A01729543/2016(H3N2))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1701)
  AUTHORS   Lin,K., Huang,H. and Zhang,J.
  CONSRTM   USDA SIV Survelliance
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2016) National Veterinary Services Laboratory,
            USDA, 1920 Dayton Ave, Ames, IA 50010, USA
FEATURES             Location/Qualifiers
     source          1..1701
                     /organism="Influenza A virus
                     (A/swine/Iowa/A01729543/2016(H3N2))"
                     /mol_type="viral cRNA"
                     /strain="A/swine/Iowa/A01729543/2016"
                     /serotype="H3N2"
                     /isolation_source="lung"
                     /host="swine"
                     /db_xref="taxon:1794889"
                     /segment="4"
                     /country="USA: Iowa"
                     /collection_date="12-Jan-2016"
     gene            1..1701
                     /gene="HA"
     CDS             1..1701
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="AMK52058.1"
                     /db_xref="GI:998632706"
                     /translation="MKTIIAFSCILCLIFAQKLPGSDNSMATLCLGHHAVPNGTLVKT
                     LTDDQIEVTNATELVQSSSTGRICNSPHQILDGKNCTLIDALLGDPHCDDFQNKEWDL
                     FVERSTAYSNCYPYYVPDYATLRSIVASSGSLEFTQESFNWTGVSQDGSSHACRRGSV
                     KSFFSRLNWLYNLNYKYPEQNVTMPNNDKFDKLYIWGVHHPGTDKDQTNLYVQASGRV
                     IVSTKRGQQTVIPSIGSRPWVKGVSSIISIYWTIVKPGDILVINSTGNLIAPRGYFKI
                     QSGKSSIMRSDAHIDECNSECITPNGSISNDKPFQNVNKITYGACPRYVKQNTLKLAT
                     GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQ
                     ITGKLNRVIKKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
                     HTIDLTDSEMSKLFERTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDIYR
                     NEALNNRFQIKGVQLKSGYKDWILWISFAISCFLLCVVLLGFIMWACQKGNIRCNICI
                     "
     sig_peptide     1..48
                     /gene="HA"
     mat_peptide     49..1035
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1036..1698
                     /gene="HA"
                     /product="HA2"
     misc_feature    1..1701
                     /db_xref="IRD:IRD-A01729543.4"
ORIGIN      
        1 atgaagacta tcattgcttt tagctgcatt ctatgtctga ttttcgctca aaaacttccc
       61 ggaagtgaca acagcatggc aacgctgtgc ctgggacacc atgcagtgcc aaacggaaca
      121 ttagtaaaaa cactcacgga tgaccaaatt gaagtgacta atgctactga gctggtccag
      181 agttcctcaa caggtagaat atgcaacagt cctcaccaaa tccttgatgg gaaaaattgc
      241 acactgatag atgctctatt gggggaccct cattgtgatg acttccaaaa caaggaatgg
      301 gacctttttg ttgaacgaag cacagcctac agcaactgtt acccttatta tgtgccagat
      361 tatgccaccc ttaggtcaat agttgcctca tctggtagcc tggaatttac ccaagaaagc
      421 ttcaattgga ctggagtttc tcaagacgga tcaagccatg cctgcagaag gggatctgtt
      481 aaaagtttct ttagtagatt gaattggttg tataacttga attacaagta tccagaacag
      541 aatgtaacta tgccaaacaa tgacaaattt gacaaattgt acatttgggg ggttcaccac
      601 ccgggtacgg acaaggacca aaccaatcta tatgtccaag catcagggag agttatagtc
      661 tctaccaaaa gaggccaaca aactgtaatc ccgagtatcg ggtctagacc ctgggtaaag
      721 ggtgtatcca gcataataag catctattgg acgatagtaa aaccgggaga catacttgtg
      781 attaacagca cagggaatct aattgcccct cggggttact tcaaaataca aagtgggaaa
      841 agctcaataa tgagatcaga tgcacacatt gatgaatgca attctgaatg cattactcca
      901 aatggaagca tttccaatga caaacctttt caaaatgtaa acaagatcac atatggagcc
      961 tgtcccagat atgtcaagca aaacaccctg aaattggcaa caggaatgcg gaatgtacca
     1021 gagaaacaaa ctagaggcat attcggcgca attgcaggtt tcatagaaaa tggttgggag
     1081 ggaatggtag acggttggta cggtttcagg catcagaatt ctgaaggcac aggacaagca
     1141 gcagatctta aaagcactca agcagcaatc aaccaaatca ccgggaaact aaatagagta
     1201 atcaagaaaa cgaacgagaa atttcatcaa atcgaaaaag aattctcaga agtagagggg
     1261 agaattcagg acctagagaa atacgttgaa gacactaaaa tagatctctg gtcttacaac
     1321 gctgagcttc ttgttgccct ggagaaccaa catacaattg atttaaccga ctcagagatg
     1381 agcaaactgt tcgaaagaac aagaaggcaa ctgcgggaaa atgctgagga catgggcaat
     1441 ggttgcttca aaatatacca caaatgtgac aatgcctgca tagggtcaat cagaaatgga
     1501 acttatgacc atgatatata cagaaacgag gcattaaaca ataggttcca gatcaaaggt
     1561 gttcagctaa aatcaggata caaagattgg atcctatgga tttcctttgc catctcatgc
     1621 ttcttgcttt gtgttgttct gttggggttc attatgtggg cctgccaaaa aggcaacatt
     1681 aggtgcaaca tttgcatttg a

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI684582A/swine/Iowa/A01944835/2015 (A/H3N2) segment 4 (HA)3109.00.000000e+001695/1701 (99%)
text_code_colored.pngEPI538917A/swine/Iowa/A01501685/2014 (A/H3N2) segment 4 (HA)3081.30.000000e+001690/1701 (99%)
text_code_colored.pngEPI533958A/swine/Iowa/A01501046/2014 (A/H3N2) segment 4 (HA)3081.30.000000e+001690/1701 (99%)
text_code_colored.pngEPI560129A/swine/Iowa/A01565921/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI534944A/swine/Iowa/A01501240/2014 (A/H3N2) segment 4 (HA)3070.30.000000e+001688/1701 (99%)
text_code_colored.pngEPI538956A/swine/South Dakota/A01481811/2014 (A/H3N2) segment 4 (HA)3037.00.000000e+001683/1702 (98%)
text_code_colored.pngEPI501535A/swine/Minnesota/A01366050/2013 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI460974A/swine/Minnesota/A01350866/2013 (A/H3N2) segment 4 (HA)3037.00.000000e+001682/1701 (98%)
text_code_colored.pngEPI493012A/swine/Kansas/A01377090/2013 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI446927A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI446919A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI396280A/Indiana/144/2012 (A/H3N2) segment 4 (HA)3025.90.000000e+001680/1701 (98%)
text_code_colored.pngEPI528431A/swine/Ohio/13TOSU1547/2013 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI527870A/swine/Ohio/13TOSU2043/2013 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI527113A/swine/Ohio/13TOSU2052/2013 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI451202A/swine/Alabama/A01104056/2012 (A/H0) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI446888A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI446879A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI446838A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI446800A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI443550A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI443542A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI443534A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI443518A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI443510A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI426887A/swine/Iowa/A01432271/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI414186A/swine/Indiana/A00968394/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI414170A/swine/Indiana/A00968398/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI408202A/swine/Indiana/A01260099/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI406576A/swine/Iowa/A01203863/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI406504A/swine/Iowa/A01267939/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI404890A/Iowa/16/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI401676A/swine/Minnesota/A01301908/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI401609A/swine/Ohio/A00138552/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI397913A/Indiana/123/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI397906A/Illinois/11/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI397662A/Maryland/28/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI397396A/Indiana/93/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI397210A/Maryland/25/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI397006A/Ohio/78/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI396291A/Ohio/63/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI396262A/Indiana/127/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI396254A/Indiana/126/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI395883A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI395259A/Ohio/35/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI394944A/Maryland/22/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI393306A/Indiana/18/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI392926A/Maryland/20/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI388352A/Indiana/20/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI388346A/Indiana/15/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI388298A/Indiana/19/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI388282A/Indiana/13/2012 (A/H3N2) segment 4 (HA)3020.40.000000e+001679/1701 (98%)
text_code_colored.pngEPI398492A/swine/Maryland/A01104048/2012 (A/H3N2) segment 4 (HA)3016.70.000000e+001678/1701 (98%)
text_code_colored.pngEPI492349A/swine/Indiana/A00968364/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI446863A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI446830A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI443558A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI443526A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI433540A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI433533A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI433306A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI433298A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI424073A/swine/Michigan/A01259003/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI414178A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI406530A/swine/Illinois/A01432127/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI401702A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI401684A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI401680A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI401667A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI400105A/swine/Indiana/A00968308/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI398542A/swine/Ohio/A00152576/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI398534A/swine/Ohio/A01208457/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI398526A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI398518A/swine/Ohio/A01133464/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI398500A/swine/Ohio/A01133466/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI398479A/swine/Maryland/A01104040/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001679/1702 (98%)
text_code_colored.pngEPI397969A/Wisconsin/34/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397962A/Wisconsin/30/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397954A/Ohio/85/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397939A/Ohio/41/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397548A/Ohio/84/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397540A/Ohio/56/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397532A/Ohio/47/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397524A/Ohio/44/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397516A/Ohio/36/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397503A/Indiana/104/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397446A/Wisconsin/31/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397432A/Ohio/81/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397426A/Minnesota/15/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397412A/Michigan/16/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397385A/Indiana/138/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397351A/Ohio/37/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397340A/Indiana/150/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI397089A/Indiana/52/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI396299A/Maryland/23/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI396208A/Indiana/149/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI396192A/Ohio/77/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI396183A/Indiana/77/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI396175A/Ohio/80/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI395874A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI395866A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI395858A/swine/Ohio/12TOSU464/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI395850A/swine/Ohio/12TOSU467/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI395718A/swine/Indiana/A01104023/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI395711A/swine/Indiana/A01104016/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI395357A/Pennsylvania/17/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI395344A/Wisconsin/28/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI395270A/Pennsylvania/11/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI395267A/Ohio/65/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI394937A/Ohio/75/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI394933A/Wisconsin/23/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI394921A/Ohio/69/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI394077A/Wisconsin/27/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393914A/swine/Indiana/A00968380/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393782A/Ohio/74/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393702A/Ohio/64/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393695A/West Virginia/16/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393681A/West Virginia/10/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393673A/Ohio/71/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393661A/Ohio/62/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393519A/Indiana/65/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393317A/Ohio/38/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393311A/West Virginia/09/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393299A/Indiana/31/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI393298A/Indiana/21/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI392748A/Wisconsin/22/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI392735A/Pennsylvania/13/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI392696A/Indiana/43/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI392693A/Indiana/38/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI388362A/Indiana/16/2012 (A/H3N2) segment 4 (HA)3014.90.000000e+001678/1701 (98%)
text_code_colored.pngEPI414156A/swine/Iowa/A01244302/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001677/1701 (98%)
text_code_colored.pngEPI397562A/Wisconsin/29/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001677/1701 (98%)
text_code_colored.pngEPI397206A/Ohio/34/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001677/1701 (98%)
text_code_colored.pngEPI396277A/Indiana/135/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001677/1701 (98%)
text_code_colored.pngEPI396200A/Ohio/79/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001677/1701 (98%)
text_code_colored.pngEPI392699A/Indiana/46/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001677/1701 (98%)
text_code_colored.pngEPI388290A/Indiana/17/2012 (A/H3N2) segment 4 (HA)3011.20.000000e+001677/1701 (98%)
text_code_colored.pngEPI493688A/swine/Iowa/13E045/2013 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI446871A/swine/Ohio/12TOSU411/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI440751A/swine/Indiana/A01432492/2013 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI426908A/swine/Iowa/A01432308/2013 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI407279A/Minnesota/18/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI401687A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI400095A/swine/Indiana/A00968390/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI398672A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI398040A/Ohio/57/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001678/1702 (98%)
text_code_colored.pngEPI397912A/Indiana/114/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI397905A/Hawaii/03/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI397654A/Indiana/90/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI397555A/Ohio/86/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI397404A/Indiana/99/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI397211A/Indiana/113/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI396239A/Indiana/103/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI395956A/swine/Indiana/A00968379/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI395948A/swine/Indiana/A00968376/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI395940A/swine/Indiana/A00968373/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI395932A/swine/Indiana/A00968370/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI395740A/swine/Indiana/A00968386/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI395251A/Indiana/152/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI394069A/Pennsylvania/11/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI394063A/Indiana/21/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI394060A/Indiana/38/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001678/1702 (98%)
text_code_colored.pngEPI391413A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI383528A/swine/Indiana/A01203509/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI381873A/Hawaii/03/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI378523A/Indiana/09/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI378515A/Indiana/07/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI378502A/Indiana/07/2012 (A/H3N2) segment 4 (HA)3009.30.000000e+001677/1701 (98%)
text_code_colored.pngEPI392684A/Indiana/13/2012 (A/H3N2) segment 4 (HA)3007.50.000000e+001676/1701 (98%)
text_code_colored.pngEPI397204A/Indiana/21/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001676/1701 (98%)
text_code_colored.pngEPI392705A/Indiana/52/2012 (A/H3N2) segment 4 (HA)3005.60.000000e+001677/1702 (98%)
text_code_colored.pngEPI550135A/swine/Texas/13TOSU0060/2013 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI526932A/swine/Ohio/13TOSU1373/2013 (A/H3N2) segment 4 (HA)3003.80.000000e+001677/1702 (98%)
text_code_colored.pngEPI509734A/swine/Iowa/13H075/2013 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI443109A/swine/Ohio/A01349495/2013 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI443106A/swine/Ohio/A01349485/2013 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI443099A/swine/Ohio/A01349302/2013 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI443096A/swine/Ohio/A01349305/2013 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI400101A/swine/Indiana/A00968397/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI397961A/Ohio/88/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI397759A/Wisconsin/35/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI397106A/Indiana/115/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI397092A/Indiana/57/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI396270A/Indiana/133/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI396246A/Indiana/125/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI396230A/Indiana/147/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI395891A/swine/Ohio/12TOSU420/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI395732A/swine/Indiana/A01104030/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI395725A/swine/Indiana/A01104029/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI394913A/Indiana/132/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI392708A/Indiana/59/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI388327A/Indiana/14/2012 (A/H3N2) segment 4 (HA)3003.80.000000e+001676/1701 (98%)
text_code_colored.pngEPI395335A/Pennsylvania/11/2012 (A/H3N2) segment 4 (HA)3001.90.000000e+001676/1702 (98%)
text_code_colored.pngEPI392934A/Minnesota/11/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001675/1701 (98%)
text_code_colored.pngEPI392711A/Indiana/60/2012 (A/H3N2) segment 4 (HA)3000.10.000000e+001675/1701 (98%)
text_code_colored.pngEPI694168A/swine/Kentucky/D0385/2013 (A/H3N2) segment 4 (HA)2998.20.000000e+001676/1702 (98%)
text_code_colored.pngEPI492947A/swine/Iowa/A01365608/2013 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI492437A/swine/Iowa/A01364803/2013 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI472195A/swine/Iowa/A01432817/2013 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI472183A/swine/Iowa/A01432840/2013 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI460375A/swine/Indiana/A01260280/2013 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI453566A/swine/Indiana/A01260230/2013 (A/H3N2) segment 4 (HA)2998.20.000000e+001676/1702 (98%)
text_code_colored.pngEPI446735A/swine/Ohio/A01349615/2013 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI433279A/swine/Minnesota/A01280462/2013 (A/H3N2) segment 4 (HA)2998.20.000000e+001676/1702 (98%)
text_code_colored.pngEPI427184A/swine/Indiana/A01260163/2012 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI408199A/swine/Indiana/A01260093/2012 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI406469A/swine/Indiana/A01260041/2012 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI397677A/Ohio/83/2012 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI391404A/swine/Ohio/A01203186/2012 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI366030A/Utah/10/2012 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI346493A/West Virginia/06/2011 (A/H3N2) segment 4 (HA)2998.20.000000e+001675/1701 (98%)
text_code_colored.pngEPI451222A/swine/Ohio/A01208180/2012 (A/H3N2) segment 4 (HA)2994.50.000000e+001674/1701 (98%)
text_code_colored.pngEPI395328A/West Virginia/06/2011 (A/H3N2) segment 4 (HA)2994.50.000000e+001674/1701 (98%)
text_code_colored.pngEPI550128A/swine/Indiana/13TOSU5147/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI550079A/swine/Ohio/13TOSU0726/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI546878A/swine/Ohio/13TOSU1560/2013 (A/H0) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI527985A/swine/Ohio/13TOSU1221/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI527981A/swine/Ohio/13TOSU1238/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI527090A/swine/Ohio/13TOSU1541/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI527085A/swine/Ohio/13TOSU0411/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI504870A/swine/Iowa/A01290867/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI502658A/swine/Minnesota/A01409450/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI499946A/swine/Iowa/13H087/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI484441A/swine/Ohio/A01364406/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI482825A/Iowa/04/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI468206A/swine/Indiana/13TOSU490/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI468198A/swine/Indiana/13TOSU482/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI467958A/swine/Ohio/A01351573/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI465422A/Indiana/05/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI465420A/Indiana/17/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI465391A/Indiana/09/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI465382A/Indiana/05/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI465379A/Indiana/17/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI464503A/Indiana/04/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI464500A/Indiana/05/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI462227A/Indiana/15/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI461883A/Indiana/09/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI427178A/swine/Indiana/A01260015/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI426890A/swine/Indiana/A01432300/2013 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI398037A/Ohio/19/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI398000A/Ohio/43/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI397997A/Ohio/17/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI397925A/Ohio/18/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI397751A/Ohio/87/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI397388A/Indiana/49/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001675/1702 (98%)
text_code_colored.pngEPI395927A/swine/Ohio/12TOSU293/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI395919A/swine/Ohio/12TOSU268/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI394066A/Indiana/60/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001675/1702 (98%)
text_code_colored.pngEPI393667A/Ohio/28/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)
text_code_colored.pngEPI388339A/Ohio/16/2012 (A/H3N2) segment 4 (HA)2992.70.000000e+001674/1701 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI684583A/swine/Iowa/A01944835/2015 (A/H3N2) segment 6 (NA)2577.20.000000e+001405/1410 (99%)
text_code_colored.pngEPI538918A/swine/Iowa/A01501685/2014 (A/H3N2) segment 6 (NA)2555.00.000000e+001401/1410 (99%)
text_code_colored.pngEPI534945A/swine/Iowa/A01501240/2014 (A/H3N2) segment 6 (NA)2549.50.000000e+001400/1410 (99%)
text_code_colored.pngEPI560130A/swine/Iowa/A01565921/2014 (A/H3N2) segment 6 (NA)2532.90.000000e+001397/1410 (99%)
text_code_colored.pngEPI501537A/swine/Minnesota/A01366050/2013 (A/H3N2) segment 6 (NA)2527.30.000000e+001396/1410 (99%)
text_code_colored.pngEPI446924A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI446916A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI446860A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI446835A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI401703A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI401688A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI398671A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI398544A/swine/Ohio/A00152576/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI398536A/swine/Ohio/A01208457/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397946A/Ohio/84/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397904A/Hawaii/03/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397626A/Ohio/57/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397554A/Ohio/86/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI397425A/Minnesota/15/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI396269A/Indiana/133/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI396191A/Ohio/77/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI395876A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI395868A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI394925A/Illinois/11/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI394912A/Indiana/132/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI393701A/Ohio/64/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI383539A/swine/Indiana/A01203509/2012 (A/H3N2) segment 6 (NA)2521.80.000000e+001395/1410 (98%)
text_code_colored.pngEPI550081A/swine/Ohio/13TOSU0726/2013 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI546918A/swine/Indiana/13TOSU1054/2013 (A/H0) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI546892A/swine/Indiana/13TOSU1141/2013 (A/H0) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI527842A/swine/Indiana/13TOSU1047/2013 (A/H1N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI527152A/swine/Indiana/13TOSU1048/2013 (A/H1N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI527135A/swine/Indiana/13TOSU1058/2013 (A/H1N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI527073A/swine/Indiana/13TOSU1045/2013 (A/H1N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI527050A/swine/Indiana/13TOSU1060/2013 (A/H1N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI527008A/swine/Indiana/13TOSU1056/2013 (A/H1N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI527002A/swine/Indiana/13TOSU1049/2013 (A/H1N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI526977A/swine/Indiana/13TOSU1052/2013 (A/H1N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI526940A/swine/Indiana/13TOSU1044/2013 (A/H1N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI526912A/swine/Indiana/13TOSU1053/2013 (A/H1N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI509736A/swine/Iowa/13H075/2013 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI492943A/swine/Iowa/A01365015/2013 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI492350A/swine/Indiana/A00968364/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI468208A/swine/Indiana/13TOSU490/2013 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI468200A/swine/Indiana/13TOSU482/2013 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI465419A/Indiana/17/2013 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI460976A/swine/Minnesota/A01350866/2013 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI446885A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI446876A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI446827A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI446797A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI443547A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI443539A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI443531A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI443523A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI443515A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI443507A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI433303A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI433295A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI426886A/swine/Iowa/A01432271/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI414172A/swine/Indiana/A00968398/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI404892A/Iowa/16/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI401685A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI401681A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI400106A/swine/Indiana/A00968308/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI400102A/swine/Indiana/A00968397/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI400096A/swine/Indiana/A00968390/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI398520A/swine/Ohio/A01133464/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI398502A/swine/Ohio/A01133466/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI398494A/swine/Maryland/A01104048/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI398486A/swine/Maryland/A01104040/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI398123A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI398034A/Maryland/22/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397931A/Ohio/19/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397918A/Ohio/17/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397750A/Ohio/87/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397661A/Maryland/28/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397627A/Ohio/63/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397625A/Ohio/43/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397624A/Ohio/80/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397621A/Ohio/79/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397620A/Maryland/25/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397547A/Ohio/83/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397539A/Ohio/56/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397531A/Ohio/47/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397523A/Ohio/44/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397515A/Ohio/36/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397431A/Ohio/81/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397395A/Indiana/93/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397377A/Indiana/123/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397363A/Ohio/23/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397350A/Ohio/37/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397208A/Ohio/78/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI397088A/Indiana/52/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI396276A/Indiana/135/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI396261A/Indiana/127/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI396253A/Indiana/126/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI396234A/Ohio/34/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395958A/swine/Indiana/A00968379/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395950A/swine/Indiana/A00968376/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395934A/swine/Indiana/A00968370/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395921A/swine/Ohio/12TOSU268/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395885A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395860A/swine/Ohio/12TOSU464/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395852A/swine/Ohio/12TOSU467/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395742A/swine/Indiana/A00968386/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395336A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395330A/West Virginia/06/2011 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395327A/West Virginia/06/2011 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395266A/Ohio/65/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI395258A/Ohio/35/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI394936A/Ohio/75/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI394932A/Wisconsin/23/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI394920A/Ohio/69/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI394905A/Ohio/62/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI394062A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393915A/swine/Indiana/A00968380/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393696A/Indiana/20/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393694A/West Virginia/16/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393687A/Ohio/23/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393680A/West Virginia/10/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393672A/Ohio/71/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393666A/Ohio/28/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393510A/Ohio/52/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393316A/Ohio/38/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393310A/West Virginia/09/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393305A/Indiana/18/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI393294A/Ohio/24/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI392754A/Indiana/14/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI392704A/Indiana/52/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI392683A/Indiana/13/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI392677A/Ohio/13/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI388365A/Ohio/17/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI388345A/Indiana/15/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI388338A/Ohio/16/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI388329A/Ohio/20/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI388320A/Ohio/18/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI388318A/Ohio/20/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI388311A/Ohio/15/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI388304A/Ohio/14/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI378522A/Indiana/09/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI378514A/Indiana/07/2012 (A/H3N2) segment 6 (NA)2516.30.000000e+001394/1410 (98%)
text_code_colored.pngEPI465390A/Indiana/09/2013 (A/H3N2) segment 6 (NA)2512.60.000000e+001393/1410 (98%)
text_code_colored.pngEPI397924A/Ohio/18/2012 (A/H3N2) segment 6 (NA)2512.60.000000e+001393/1410 (98%)
text_code_colored.pngEPI550067A/swine/Indiana/13TOSU5669/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI549962A/swine/Indiana/13TOSU5869/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI538958A/swine/South Dakota/A01481811/2014 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI528458A/swine/Indiana/13TOSU1143/2013 (A/H1N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI528455A/swine/Ohio/13TOSU0410/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI528426A/swine/Indiana/13TOSU1149/2013 (A/H1N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI528423A/swine/Indiana/13TOSU1144/2013 (A/H1N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI527994A/swine/Indiana/13TOSU1042/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI527945A/swine/Indiana/13TOSU1151/2013 (A/H1N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI527898A/swine/Indiana/13TOSU1145/2013 (A/H1N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI527846A/swine/Indiana/13TOSU1050/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI527158A/swine/Indiana/13TOSU1158/2013 (A/H1N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI527087A/swine/Ohio/13TOSU0411/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI527062A/swine/Indiana/13TOSU1160/2013 (A/H1N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI526965A/swine/Indiana/13TOSU1142/2013 (A/H1N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI502642A/swine/South Dakota/A01366093/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI499948A/swine/Iowa/13H087/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI499655A/swine/North Carolina/A01409048/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI493013A/swine/Kansas/A01377090/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI487337A/swine/Minnesota/A01364816/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI465387A/Indiana/10/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI448835A/swine/Kansas/13-105721a/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI446868A/swine/Ohio/12TOSU411/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI433542A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI433535A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI433281A/swine/Minnesota/A01280462/2013 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI416856A/swine/Tennessee/A01104055/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI414180A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI414029A/swine/Indiana/A01260135/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI408203A/swine/Indiana/A01260099/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI406575A/swine/Iowa/A01203863/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397623A/Indiana/150/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397561A/Wisconsin/29/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397502A/Indiana/104/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397445A/Wisconsin/31/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397439A/Wisconsin/30/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397411A/Michigan/16/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397403A/Indiana/99/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397387A/Indiana/49/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397214A/Pennsylvania/17/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397212A/Indiana/115/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI397124A/Pennsylvania/11/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI396298A/Maryland/23/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI396245A/Indiana/125/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI396229A/Indiana/147/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI396222A/Indiana/57/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI396207A/Indiana/149/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI396182A/Indiana/77/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395942A/swine/Indiana/A00968373/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395929A/swine/Ohio/12TOSU293/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395893A/swine/Ohio/12TOSU420/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI395269A/Pennsylvania/11/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI394076A/Wisconsin/27/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI394068A/Pennsylvania/11/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI394065A/Indiana/60/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI394059A/Indiana/38/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393518A/Indiana/65/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393297A/Indiana/21/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI393291A/Indiana/38/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392752A/Indiana/16/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392710A/Indiana/60/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392707A/Indiana/59/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392698A/Indiana/46/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392695A/Indiana/43/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI392691A/Indiana/31/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI391438A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI388331A/Utah/10/2012 (A/H3N2) segment 6 (NA)2510.70.000000e+001393/1410 (98%)
text_code_colored.pngEPI550032A/swine/Indiana/13TOSU5248/2013 (A/H1N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI544929A/swine/Iowa/13H098/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI544922A/swine/Iowa/13H090/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI538984A/swine/Iowa/13H092/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI538970A/swine/Iowa/13H076/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI510221A/swine/North Carolina/A01409981/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI505031A/swine/Illinois/A01409735/2014 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI472211A/swine/Indiana/A01260313/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI467963A/swine/Minnesota/A01351603/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI467960A/swine/Ohio/A01351573/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI466705A/Indiana/05/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI465384A/Indiana/07/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI465381A/Indiana/05/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI464502A/Indiana/04/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI464499A/Indiana/05/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI463709A/swine/Illinois/A01432795/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI443555A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI443111A/swine/Ohio/A01349495/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI443101A/swine/Ohio/A01349302/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI443098A/swine/Ohio/A01349305/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI427179A/swine/Indiana/A01260015/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI426907A/swine/Iowa/A01432308/2013 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI424075A/swine/Michigan/A01259003/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI414188A/swine/Indiana/A00968394/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI414155A/swine/Iowa/A01244302/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI406470A/swine/Indiana/A01260041/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI401677A/swine/Minnesota/A01301908/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI401610A/swine/Ohio/A00138552/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI399293A/swine/Minnesota/A01327922/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397960A/Ohio/88/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397509A/Indiana/90/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397384A/Indiana/138/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI397097A/Indiana/103/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396279A/Indiana/144/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI396213A/Indiana/113/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395734A/swine/Indiana/A01104030/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395343A/Wisconsin/28/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI395250A/Indiana/152/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)
text_code_colored.pngEPI383540A/swine/Minnesota/A01203517/2012 (A/H3N2) segment 6 (NA)2505.20.000000e+001392/1410 (98%)

Share this post


Link to post
Share on other sites
Descriptions
AlignSegment-IDNameScoreE-ValueIdentity
text_code_colored.pngEPI684584A/swine/Iowa/A01944835/2015 (A/H3N2) segment 7 (MP)1803.50.000000e+00980/982 (99%)
text_code_colored.pngEPI641845A/swine/Iowa/A02035112/2015 (A/H1N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI641448A/swine/Iowa/A02077950/2015 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI620631A/swine/Iowa/A02076563/2015 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI600406A/swine/South Dakota/A01477879/2014 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI550286A/swine/Minnesota/A01502081/2014 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI533793A/swine/Illinois/A01475376/2014 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI532384A/swine/Iowa/A01475300/2014 (A/H1N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)
text_code_colored.pngEPI669261A/swine/Iowa/A02076969/2015 (A/H1N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI669153A/swine/Iowa/A02076952/2015 (A/H1N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI615352A/swine/Minnesota/A01471246/2015 (A/H1N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI612554A/swine/Minnesota/A01471108/2015 (A/H1N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI612528A/swine/Iowa/A02077176/2015 (A/H1N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI600448A/swine/Iowa/A01476909/2014 (A/H1N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI593955A/swine/Iowa/A01489009/2015 (A/H1N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI586091A/swine/Minnesota/A01489611/2015 (A/H1N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI545809A/swine/Iowa/A01476404/2014 (A/H1N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)
text_code_colored.pngEPI558859A/swine/Iowa/A01477719/2014 (A/H0) segment 7 (MP)1790.50.000000e+00977/982 (99%)
text_code_colored.pngEPI684600A/swine/Iowa/A01944889/2015 (A/H0) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI612570A/swine/Iowa/A02076301/2015 (A/H1N2) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI502724A/swine/Illinois/A01291992/2013 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI502657A/swine/Iowa/A01290789/2013 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI499749A/swine/Iowa/A01409307/2013 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI441673A/swine/Iowa/A01244529/2013 (A/H1N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)
text_code_colored.pngEPI703962A/swine/Missouri/A01796703/2015 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI687666A/swine/Missouri/A01796292/2015 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI685661A/swine/Iowa/A02076919/2015 (A/H0) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI685657A/swine/Iowa/A02076918/2015 (A/H0) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI678408A/swine/Illinois/A01945894/2015 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI641708A/swine/Minnesota/A01472033/2015 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI615358A/swine/Minnesota/A01471308/2015 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI559595A/swine/Iowa/A01476572/2014 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI502727A/swine/Iowa/A01290826/2013 (A/H1N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)
text_code_colored.pngEPI703794A/swine/Iowa/A01796352/2015 (A/H1N1) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI673000A/swine/Minnesota/A01746595/2015 (A/H1N1) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI663373A/swine/Iowa/A02025591/2015 (A/H1N2) segment 7 (MP)1775.80.000000e+00975/982 (99%)
text_code_colored.pngEPI623649A/swine/Iowa/A02076879/2015 (A/H0) segment 7 (MP)1772.10.000000e+00973/982 (99%)
text_code_colored.pngEPI678429A/swine/Minnesota/A01795487/2015 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI538678A/swine/Iowa/A01410925/2014 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI533790A/swine/Iowa/A01410783/2014 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI532366A/swine/Iowa/A01410680/2014 (A/H1N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI487210A/swine/Illinois/A01291140/2013 (A/H1N2) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI467599A/swine/Iowa/A01432867/2013 (A/H3N2) segment 7 (MP)1770.20.000000e+00974/982 (99%)
text_code_colored.pngEPI545168A/swine/Illinois/A01520306/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI510195A/swine/Illinois/A01411401/2014 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI506270A/swine/Nebraska/A01393720/2013 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI505035A/swine/Illinois/A01409620/2013 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI505026A/swine/Illinois/A01410029/2013 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI504884A/swine/Illinois/A01290945/2013 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI502666A/swine/Illinois/A01409324/2013 (A/H1N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)
text_code_colored.pngEPI508778A/swine/Illinois/A01395227/2013 (A/H1N1) segment 7 (MP)1762.80.000000e+00972/981 (99%)
text_code_colored.pngEPI641630A/swine/Illinois/A02090081/2015 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI584857A/swine/Illinois/A01489880/2015 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI573349A/swine/Minnesota/A01567010/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI568687A/swine/Illinois/A01462197/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI568684A/swine/Illinois/A01462070/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI558906A/swine/Indiana/A01260555/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI532504A/swine/Indiana/A01260513/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI531064A/swine/Iowa/A01410515/2014 (A/H1N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI530995A/swine/Iowa/A01410497/2014 (A/H1N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI530320A/swine/Indiana/A01410481/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI510207A/swine/Illinois/A01410235/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI505046A/swine/Illinois/A01409744/2014 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI449017A/swine/Wyoming/A01379346/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI433321A/swine/Wyoming/A01444560/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI427146A/swine/Maryland/A01444460/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI427131A/swine/Wyoming/A01444562/2013 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI406513A/swine/Iowa/A01432069/2012 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI391459A/swine/Wisconsin/A01203142/2012 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI390675A/swine/Indiana/A01243254/2012 (A/H1N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI383548A/swine/Iowa/A01203503/2012 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI347602A/Iowa/07/2011 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI346435A/Iowa/08/2011 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI346427A/Iowa/07/2011 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI346419A/Iowa/09/2011 (A/H3N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI341736A/swine/Iowa/A01049970/2011 (A/H1N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)
text_code_colored.pngEPI678308A/swine/Indiana/A01857868/2015 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI669481A/swine/Kentucky/14TOSU23973/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI669460A/swine/Kentucky/14TOSU23991/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI669426A/swine/Kentucky/14TOSU23804/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI669335A/swine/Kentucky/14TOSU23975/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI584869A/swine/Illinois/A01489879/2015 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI584833A/swine/Illinois/A01489875/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI573499A/swine/Illinois/A01840194/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI545387A/swine/Iowa/A01476332/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI531087A/swine/Minnesota/A01493671/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI531076A/swine/Illinois/A01410538/2014 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI527995A/swine/Iowa/13TOSU0226/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00972/983 (98%)
text_code_colored.pngEPI527872A/swine/Iowa/13TOSU0239/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00972/983 (98%)
text_code_colored.pngEPI527110A/swine/Iowa/13TOSU0240/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00972/983 (98%)
text_code_colored.pngEPI492963A/swine/Minnesota/A01394248/2013 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI492380A/swine/Minnesota/A01392079/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI489727A/swine/Minnesota/A01394021/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI472194A/swine/Iowa/A01432826/2013 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI461427A/swine/Ohio/11SW233/2011 (A/H0) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI461420A/swine/Ohio/11SW149/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI461386A/swine/Ohio/11SW238/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI459607A/swine/Ohio/11SW144/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI459599A/swine/Ohio/11SW121/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI459591A/swine/Ohio/11SW127/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI459573A/swine/Ohio/11SW230/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI459535A/swine/Ohio/11SW349/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI459520A/swine/Ohio/11SW223/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI459499A/swine/Ohio/11SW111/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI459488A/swine/Ohio/11SW133/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI459466A/swine/Ohio/11SW344/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI457158A/swine/Korea/CY03-19/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI457150A/swine/Korea/CY03-18/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI457142A/swine/Korea/CY03-17/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI457134A/swine/Korea/CY03-16/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI457126A/swine/Korea/CY03-15/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI457118A/swine/Korea/CY03-14/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI453430A/swine/Korea/D79/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI441649A/swine/Iowa/A01445788/2013 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI441498A/swine/Ohio/A01349140/2013 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI433310A/swine/Iowa/A01444786/2013 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI433271A/swine/Ohio/A01280357/2013 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI426874A/swine/Ohio/A01280112/2013 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI416916A/swine/North Carolina/A01442548/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415974A/swine/Ohio/11SW232/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415966A/swine/Ohio/11SW347/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415958A/swine/Ohio/11SW240/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415950A/swine/Ohio/11SW239/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415942A/swine/Ohio/11SW237/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415926A/swine/Ohio/11SW235/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415918A/swine/Ohio/11SW234/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415904A/swine/Ohio/11SW231/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415896A/swine/Ohio/11SW229/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415888A/swine/Ohio/11SW228/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415880A/swine/Ohio/11SW227/2011 (A/H0) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415871A/swine/Ohio/11SW226/2011 (A/H0) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415862A/swine/Ohio/11SW225/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415853A/swine/Ohio/11SW224/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415846A/swine/Ohio/11SW221/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415838A/swine/Ohio/11SW220/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415830A/swine/Ohio/11SW218/2011 (A/H0) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415812A/swine/Ohio/11SW216/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415804A/swine/Ohio/11SW215/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415796A/swine/Ohio/11SW213/2011 (A/H0) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415779A/swine/Ohio/11SW210/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415771A/swine/Ohio/11SW209/2011 (A/H0) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415762A/swine/Ohio/11SW207/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415745A/swine/Ohio/11SW205/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415737A/swine/Ohio/11SW204/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415720A/swine/Ohio/11SW202/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415685A/swine/Ohio/11SW196/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415617A/swine/Ohio/11SW184/2011 (A/H0) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415573A/swine/Ohio/11SW175/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415556A/swine/Ohio/11SW173/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415548A/swine/Ohio/11SW172/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415497A/swine/Ohio/11SW163/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415481A/swine/Ohio/11SW146/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415473A/swine/Ohio/11SW140/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415465A/swine/Ohio/11SW139/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415457A/swine/Ohio/11SW138/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415449A/swine/Ohio/11SW137/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415441A/swine/Ohio/11SW136/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415433A/swine/Ohio/11SW135/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415425A/swine/Ohio/11SW134/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415415A/swine/Ohio/11SW96/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415411A/swine/Ohio/11SW132/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415403A/swine/Ohio/11SW131/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415395A/swine/Ohio/11SW130/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415387A/swine/Ohio/11SW129/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415379A/swine/Ohio/11SW128/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415371A/swine/Ohio/11SW126/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415365A/swine/Ohio/11SW125/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415357A/swine/Ohio/11SW124/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415349A/swine/Ohio/11SW123/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415341A/swine/Ohio/11SW122/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415313A/swine/Ohio/11SW95/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415289A/swine/Ohio/11SW87/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415257A/swine/Ohio/11SW114/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415249A/swine/Ohio/11SW113/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415241A/swine/Ohio/11SW112/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI415225A/swine/Ohio/11SW108/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI414110A/swine/Ohio/A01279763/2012 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI414104A/swine/Ohio/A01279737/2012 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI414053A/swine/Ohio/A01279640/2012 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI414050A/swine/Ohio/A01279687/2012 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI414038A/swine/Ohio/A01279522/2012 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI408330A/swine/Indiana/A01432188/2012 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI408198A/swine/Indiana/A01260048/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI407026A/swine/Ohio/A01279011/2012 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI406535A/swine/Ohio/A01267959/2012 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI398690A/swine/North Carolina/A01270266/2012 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI397414A/Michigan/23/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI397342A/Michigan/19/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI395346A/Michigan/20/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI395329A/West Virginia/06/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI395324A/West Virginia/06/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI391475A/swine/Ohio/A01203186/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI391470A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI391144A/swine/Indiana/A01202621/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI391142A/swine/Indiana/A01202632/2011 (A/H1N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI390882A/swine/Michigan/A01203374/2012 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI390881A/swine/Indiana/A01203372/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI390671A/swine/Indiana/A01243255/2012 (A/H1N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI388330A/Utah/10/2012 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI347605A/Iowa/08/2011 (A/H3N2) segment 7 (MP)1753.60.000000e+00971/982 (98%)
text_code_colored.pngEPI584860A/swine/Illinois/A01489876/2015 (A/H1N1) segment 7 (MP)1749.90.000000e+00970/982 (98%)
text_code_colored.pngEPI433327A/swine/Wyoming/A01444566/2013 (A/H3N2) segment 7 (MP)1749.90.000000e+00970/982 (98%)
text_code_colored.pngEPI678640A/swine/Illinois/A01857744/2015 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI600412A/swine/Indiana/A01477855/2014 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI600355A/swine/Indiana/A01477882/2014 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI586105A/swine/Iowa/A01470314/2015 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI584851A/swine/Nebraska/A01489870/2014 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI584830A/swine/Nebraska/A01489868/2014 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI573595A/swine/Arkansas/A01840243/2014 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI568720A/swine/Arkansas/A01840184/2014 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI568691A/swine/Illinois/A01567572/2015 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI559568A/swine/Iowa/A01476555/2014 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI546902A/swine/Indiana/13TOSU1982/2013 (A/H0) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI545830A/swine/Iowa/A01476395/2014 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI545369A/swine/Indiana/A01476322/2014 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI539063A/swine/Nebraska/A01501767/2014 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI533920A/swine/Iowa/A01481221/2014 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI532390A/swine/Illinois/A01411761/2014 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI526872A/swine/Minnesota/A01480518/2014 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI505095A/swine/Nebraska/A01409647/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI501539A/swine/South Dakota/A01366063/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI499646A/swine/Iowa/A01290671/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI492657A/swine/Nebraska/A01394342/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI492356A/swine/Indiana/A00968365/2012 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI492351A/swine/Indiana/A00968364/2012 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI487955A/swine/Indiana/A01260366/2013 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI487944A/swine/Minnesota/A01394278/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI476506A/swine/Virginia/A01290329/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI472154A/swine/Wyoming/A01397389/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI467890A/swine/Nebraska/A01397576/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI464431A/swine/Ohio/A01351184/2013 (A/H1N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI461446A/swine/Wyoming/A01381202/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI453429A/swine/Korea/A18/2011 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI451230A/swine/Ohio/A01208181/2012 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI451185A/swine/Pennsylvania/A01432652/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI451178A/swine/Wyoming/A01379327/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI451175A/swine/Wyoming/A01379354/2013 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI446881A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI446873A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI446857A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI446832A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI446824A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI446733A/swine/Ohio/A01349572/2013 (A/H1N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI438228A/swine/Indiana/A01260209/2013 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI427201A/swine/Indiana/A01260183/2012 (A/H1N1) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI416865A/swine/Iowa/A01432207/2012 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI415934A/swine/Ohio/11SW236/2011 (A/H1N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI415703A/swine/Ohio/11SW200/2011 (A/H0) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI414181A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)
text_code_colored.pngEPI407274A/Minnesota/18/2012 (A/H3N2) segment 7 (MP)1748.10.000000e+00970/982 (98%)

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now
Sign in to follow this  
Followers 0

  • Recently Browsing   0 members

    No registered users viewing this page.