niman

Partial Zika Sequence From Rio de Janeiro Brazil CSF

9 posts in this topic

LOCUS       KT381874                 238 bp    RNA     linear   VRL 14-FEB-2016
DEFINITION  Zika virus strain Zika1697_BR-RJ/2015 envelope protein gene,
            partial cds.
ACCESSION   KT381874
VERSION     KT381874.1  GI:987919162
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 238)
  AUTHORS   Sequeira,P.C., Mendonca,M.C.L., Brasil,P., Calvet,G., Alves,S.S.,
            Fabri,A.A., Araujo,E.S.M., Santos,F.B.D., Nogueira,R.M.R. and
            Filippis,A.M.B.
  TITLE     Detection of Zika RNA in cerebrospinal fluid (CSF) from a patient
            with neurological manifestations during Zika outbreak in Rio de
            Janeiro, Brazil
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 238)
  AUTHORS   Sequeira,P.C., Mendonca,M.C.L., Brasil,P., Calvet,G., Alves,S.S.,
            Fabri,A.A., Araujo,E.S.M., Santos,F.B.D., Nogueira,R.M.R. and
            Filippis,A.M.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-AUG-2015) Oswaldo Cruz Institute, Oswaldo Cruz
            Foundation, Av. Brasil, 4365 - Pavilhao Helio e Peggy Pereira,
            B103, Rio de Janeiro, RJ 21045-900, Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..238
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="Zika1697_BR-RJ/2015"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="2015"
                     /note="genotype: Asian"

Share this post


Link to post
Share on other sites
LOCUS       KT381874                 238 bp    RNA     linear   VRL 14-FEB-2016
DEFINITION  Zika virus strain Zika1697_BR-RJ/2015 envelope protein gene,
            partial cds.
ACCESSION   KT381874
VERSION     KT381874.1  GI:987919162
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 238)
  AUTHORS   Sequeira,P.C., Mendonca,M.C.L., Brasil,P., Calvet,G., Alves,S.S.,
            Fabri,A.A., Araujo,E.S.M., Santos,F.B.D., Nogueira,R.M.R. and
            Filippis,A.M.B.
  TITLE     Detection of Zika RNA in cerebrospinal fluid (CSF) from a patient
            with neurological manifestations during Zika outbreak in Rio de
            Janeiro, Brazil
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 238)
  AUTHORS   Sequeira,P.C., Mendonca,M.C.L., Brasil,P., Calvet,G., Alves,S.S.,
            Fabri,A.A., Araujo,E.S.M., Santos,F.B.D., Nogueira,R.M.R. and
            Filippis,A.M.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-AUG-2015) Oswaldo Cruz Institute, Oswaldo Cruz
            Foundation, Av. Brasil, 4365 - Pavilhao Helio e Peggy Pereira,
            B103, Rio de Janeiro, RJ 21045-900, Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..238
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="Zika1697_BR-RJ/2015"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="2015"
                     /note="genotype: Asian"
     CDS             <1..>238
                     /codon_start=2
                     /product="envelope protein"
                     /protein_id="AME17706.1"
                     /db_xref="GI:987919163"
                     /translation="CIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELV
                     TTTVSNMAEVRSYCYEVSISDMASDSRCPTQGEAY"
ORIGIN      
        1 gtgcatagga gtcagcaata gggactttgt ggaaggtatg tcaggtggga cttgggttga
       61 tgttgtcttg gaacatggag gttgtgtcac cgtaatggca caggacaaac cgactgtcga
      121 catagagctg gttacaacaa cagtcagcaa catggcggag gtaagatcct actgctatga
      181 ggtctccata tcagacatgg cttcggacag ccgctgccca acacaaggtg aagcctac

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
440440100%5e-120100%KT381874.1
424424100%5e-11599%KU729218.1
424424100%5e-11599%KU761564.1
424424100%5e-11599%KU740184.1
424424100%5e-11599%KU527068.1
424424100%5e-11599%KU646828.1
424424100%5e-11599%KU647676.1
424424100%5e-11599%KU509998.1
424424100%5e-11599%KU365778.1
424424100%5e-11599%KU312315.1
424424100%5e-11599%KU312314.1
424424100%5e-11599%KU312313.1
424424100%5e-11599%KM212966.1
424424100%5e-11599%KJ579441.1
424424100%5e-11599%AB908162.1
418418100%2e-11398%KU744693.1
418418100%2e-11398%KU497555.1
418418100%2e-11398%KU707826.1
418418100%2e-11398%KU646827.1
418418100%2e-11398%KU501217.1
418418100%2e-11398%KU501216.1
418418100%2e-11398%KU501215.1
418418100%2e-11398%KU365780.1
418418100%2e-11398%KU365779.1
418418100%2e-11398%KU365777.1
418418100%2e-11398%KU312312.1
418418100%2e-11398%KU321639.1
418418100%2e-11398%KM212965.1
418418100%2e-11398%KM212964.1
418418100%2e-11398%KM212963.1
418418100%2e-11398%KJ634273.1
418418100%2e-11398%KJ776791.1
418418100%2e-11398%KJ680134.1
412412100%1e-11198%KU681081.3
412412100%1e-11198%KF993678.1
412412100%1e-11198%JN860885.1
407407100%5e-11097%KU729217.1
401401100%2e-10897%KU681082.3
401401100%2e-10897%EU545988.1
39239295%1e-10598%KU686218.1
351351100%3e-9393%HQ234499.1
307307100%6e-8090%HQ234500.1

Share this post


Link to post
Share on other sites
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccession
440440100%5e-120100%KT381874.1
424424100%5e-11599%KU853013.1
424424100%5e-11599%KU853012.1
424424100%5e-11599%KU844090.1
424424100%5e-11599%KU729218.1
424424100%5e-11599%KU761564.1
424424100%5e-11599%KU740184.1
424424100%5e-11599%KU527068.1
424424100%5e-11599%KU646828.1
424424100%5e-11599%KU647676.1
424424100%5e-11599%KU509998.1
424424100%5e-11599%KU365778.1
424424100%5e-11599%KU312315.1
424424100%5e-11599%KU312314.1
424424100%5e-11599%KU312313.1
424424100%5e-11599%KM212966.1
424424100%5e-11599%KJ579441.1
424424100%5e-11599%AB908162.1
418418100%2e-11398%KU820899.2
418418100%2e-11398%KU820897.1
418418100%2e-11398%KU744693.1
418418100%2e-11398%KU497555.1
418418100%2e-11398%KU707826.1
418418100%2e-11398%KU646827.1
418418100%2e-11398%KU501217.1
418418100%2e-11398%KU501216.1
418418100%2e-11398%KU501215.1
418418100%2e-11398%KU365780.1
418418100%2e-11398%KU365779.1
418418100%2e-11398%KU365777.1
418418100%2e-11398%KU312312.1
418418100%2e-11398%KU321639.1
418418100%2e-11398%KM212965.1
418418100%2e-11398%KM212964.1
418418100%2e-11398%KM212963.1
418418100%2e-11398%KJ634273.1
418418100%2e-11398%KJ776791.1
418418100%2e-11398%KJ680134.1
412412100%1e-11198%KU681081.3
412412100%1e-11198%KF993678.1
412412100%1e-11198%JN860885.1
407407100%5e-11097%KU729217.2
401401100%2e-10897%KU681082.3
401401100%2e-10897%EU545988.1
39239295%2e-10598%KU686218.1
351351100%3e-9393%HQ234499.1

Share this post


Link to post
Share on other sites

The entire fragment was used (238 BP)

Edited by niman

Share this post


Link to post
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!


Register a new account

Sign in

Already have an account? Sign in here.


Sign In Now

  • Recently Browsing   0 members

    No registered users viewing this page.