niman Posted March 4, 2016 Report Share Posted March 4, 2016 State Research Center of Virology and Biotechnology 'Vector' has released a partial February 2016 Zika sequence, Moscow-2016, from a Moscow traveler infected in the Dominican Republic.http://www.ncbi.nlm.nih.gov/nuccore/KU844090.1 Link to comment Share on other sites More sharing options...
niman Posted March 4, 2016 Author Report Share Posted March 4, 2016 LOCUS KU844090 281 bp RNA linear VRL 01-MAR-2016 DEFINITION Zika virus isolate Moscow-2016 polyprotein gene, partial cds. ACCESSION KU844090 VERSION KU844090.1 GI:1002167045 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 281) AUTHORS Popova,A.Y., Maksyutov,R.A., Bodnev,S.A., Tregubchak,T.V., Pyankov,O.V., Demina,Y.V., Agafonov,A.P. and Miheev,V.N. TITLE Zika virus in a human, Russia, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 281) AUTHORS Popova,A.Y., Maksyutov,R.A., Bodnev,S.A., Tregubchak,T.V., Pyankov,O.V., Demina,Y.V., Agafonov,A.P. and Miheev,V.N. TITLE Direct Submission JOURNAL Submitted (29-FEB-2016) Laboratory of Diagnosis and Repository of Variola Virus DNA, State Research Center of Virology and Biotechnology 'Vector', Koltsovo, Novosibirsk Region 630559, Russia COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..281 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Moscow-2016" /host="Homo sapiens" /db_xref="taxon:64320" /country="Russia" /collection_date="Feb-2016" CDS <1..>281 /codon_start=2 /product="polyprotein" /protein_id="AMM76159.1" /db_xref="GI:1002167046" /translation="PAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPT VDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQ" ORIGIN 1 cccggcatac agcatcaggt gcataggagt cagcaatagg gactttgtgg aaggtatgtc 61 aggtgggact tgggttgatg ttgtcttgga acatggaggt tgtgtcaccg taatggcaca 121 ggacaaaccg actgtcgaca tagagctggt tacaacaaca gtcagcaaca tggcggaggt 181 aagatcctac tgctatgagg catcaatatc agacatggct tcggacagcc gctgcccaac 241 acaaggtgaa gcctaccttg acaagcaatc agacactcaa t Link to comment Share on other sites More sharing options...
niman Posted March 4, 2016 Author Report Share Posted March 4, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU844090.1|Zika virus isolate Moscow-2016 polyprotein gene, partial cds508508100%3e-140100%KU844090.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds508508100%3e-140100%KU729218.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds508508100%3e-140100%KU761564.1Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds508508100%3e-140100%KU740184.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome508508100%3e-140100%KU527068.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds508508100%3e-140100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome508508100%3e-140100%KU509998.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds508508100%3e-140100%KU365778.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds508508100%3e-140100%KU312315.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds508508100%3e-140100%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds508508100%3e-140100%KU312313.1Select seq gb|KM212966.1|Zika virus isolate NC13(FP)-26112013-22072 glycoprotein gene, partial cds508508100%3e-140100%KM212966.1Select seq gb|KJ579441.1|Zika virus isolate PF13-CP221013c polyprotein gene, partial cds508508100%3e-140100%KJ579441.1Select seq dbj|AB908162.1|Zika virus gene for polyprotein, partial cds, strain: ZIKV Hu/Tahiti/01u/2014NIID508508100%3e-140100%AB908162.1Select seq gb|KU820899.1|Zika virus isolate ZJ03 polyprotein gene, complete cds502502100%1e-13899%KU820899.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds502502100%1e-13899%KU820897.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome502502100%1e-13899%KU744693.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome502502100%1e-13899%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome502502100%1e-13899%KU707826.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds502502100%1e-13899%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds502502100%1e-13899%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome502502100%1e-13899%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds502502100%1e-13899%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds502502100%1e-13899%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds502502100%1e-13899%KU365777.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds502502100%1e-13899%KU312312.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome502502100%1e-13899%KU321639.1Select seq gb|KM212965.1|Zika virus isolate NC13(FP)-20112013-22015 glycoprotein gene, partial cds502502100%1e-13899%KM212965.1Select seq gb|KM212964.1|Zika virus isolate NC14-17042014-4554 glycoprotein gene, partial cds502502100%1e-13899%KM212964.1Select seq gb|KM212963.1|Zika virus isolate NC14-23012014-250 glycoprotein gene, partial cds502502100%1e-13899%KM212963.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds502502100%1e-13899%KJ776791.1Select seq gb|KJ680134.1|Zika virus strain PF13-091213-121 polyprotein gene, partial cds502502100%1e-13899%KJ680134.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome499499100%2e-13799%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds499499100%2e-13799%JN860885.1Select seq gb|KU729217.1|Zika virus isolate BeH823339 polyprotein gene, complete cds493493100%7e-13699%KU729217.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds49149199%2e-13599%KF993678.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome484484100%4e-13398%KU681082.3Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds48448495%4e-133100%KU646828.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds484484100%4e-13398%EU545988.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds480480100%4e-13298%KU686218.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds47947995%2e-13199%KU646827.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds47947995%2e-13199%KJ634273.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds439439100%1e-11995%HQ234499.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds417417100%4e-11393%KF268949.1Select seq gb|KT381874.1|Zika virus strain Zika1697_BR-RJ/2015 envelope protein gene, partial cds41641684%2e-11299%KT381874.1 Link to comment Share on other sites More sharing options...
niman Posted March 4, 2016 Author Report Share Posted March 4, 2016 Sequence map updatedhttps://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en Link to comment Share on other sites More sharing options...
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now