Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Press Briefing TranscriptTuesday, July 19, 2016 Audio recording[MP3, 5.18 MB]Please Note:This transcript is not edited and may contain errors. KATHY HARBEN: Good afternoon everyone, and thank you for joining us for this CDC Media Availability. We understand there is a lot of interest in Utah’s report of the new case of Zika. We are holding this call so CDC experts can answer questions about what the new report means in terms of family contact, infection control, mosquito control and any changes in current guidance. CDC is not releasing new or additional information today. The purpose of today's availability is to provide additional context about what this case means based on what we currently know. We’ll continue to provide updates from this case from our perspective as new information is available. Joining us on the call today are Satish Pillai, he's our incident Deputy Incident Manager with our CDC's Zika response. Denise Jamieson, Chief of the Women's health and Fertility Branch, Division of Reproductive Health and CDC National Center of Chronic Disease Prevention And Health Promotion. Michael Bell is Deputy Director of CDC's Division of Health Care Quality Promotion. Ingrid Rabe with CDC's Division of Vector Borne Diseases and Doctor Robert Wirtz is an Entomologist here at the CDC. Dr. Pillai will begin with brief remarks and then we'll take your questions. SATISH PILLAI: Good afternoon, Utah health officials confirmed today a new case of Zika in Utah. This person is associated with the family of the patient who died in late June. Based on what we know now, the person has not recently traveled to an area of Zika and has not had sex with someone affected with the Zika or a returning traveler. In addition, there is no evidence at this time that mosquito that are commonly known to spread are present in Utah. A CDC emergency response team or (CERT) is in Utah at the request of the Utah Department of Health. The team includes experts in infection control, virology, mosquito control and disease investigation and health communication. The investigation in Utah includes additional interviews with, and laboratory testing of, family members and healthcare workers who may have had contact with the person who died and trapping of mosquitos and assessing the risk of local spread by mosquitos. As of July 13, 2016, 1306 cases of Zika have been reported in continental US and Hawaii. None of these have been the result of local spread by mosquitos. These cases include 14 believed to be the results of sexual transmission and one was a result of a lab exposure. We don't have all the answers right now but we'll continue to update what we know,when we know it. At this point, we look forward to taking your questions, thank you. OPERATOR: Thank you. We will now begin our question and answer question, if you would like to ask a question, press star one, one moment while we wait for the first question. Our first question comes from Mike Stobbe with the Associated Press. MIKE STOBBE: Thank you for taking the question. First, could you make sure I have the complete list? There’s been evidence of Zika infection found in what bodily fluid? Semen, vaginal fluid, urine, blood, saliva or tears anything else? Can you say what type of care or how intense the care was with the family contact was given to the deceased or how many people were caring for the patient at home or at the hospital. SATISH PILLAI: I can begin and I can turn over to my colleague, Dr. Rabe for additional comments regarding bodily fluids that we know that Zika has been recovered in-as you pointed out, blood, semen, saliva and urine. The question of the -- and the question of the type of fear that this is an important element in our investigation. the person was caring for the elderly patient before death were trying to determine if the contact between the very sick elderly patient and the person plays a role in how the person got sick. We don't have all those answers right now but we'll continue to share the information as it becomes available. I want to make sure if Ingrid have any additions to the bodily fluids that I described as having covered it in the past if she wants to supplement that with any information. INGRID RABE: Thank you very much. So just in addition to that as was mentioned was the genital tract swabs that have been found positive and other public report goes, there is also a report of detection of virus in breastmilk as well as detection of viral Aqueous fluids from the inside of the eye in a patient to had uveitis. MIKE STOBBE: Does that mean tears? INGRID GRABE: No, that's actually internal. MIKE STOBBE: How many people are you interviewing other than care givers? SATISH PILLAI: This investigation is ongoing of our team in the field are continuing to evaluate the numbers of individuals that maybe involved with stratifying and attempting to target the investigation. MIKE STOBBE: Thank you. KATHY HARBEN: Next question please. OPERATOR: Thank you. Next question comes from Brady Dennis with the Washington Post. BRADY DENNIS: thank you for the call, I have two different questions, one is the deceased person, are you able to share if this person died at the health care hospital or at home, and also the other person infected, did that person shows symptoms of the Zika virus, is that partly how he was diagnosed in many people do not so I was wonder if he had hour symptoms? SATISH PILLAI: Regarding the care and location of the where the index patient passed away, we of course, defer to our colleagues at the Utah department of Health for details such as that. Regarding the symptoms of other individual who acquired Zika, as is common with Zika, They developed mild symptoms and rapidly recovered which is the typical time course and presentation and recovery that you would expect with Zika virus. KATHY HARBEN: Next question, please. OPERATOR: One moment. Helen Branswell with STAT, your line is open. HELEN BRANSWELL: Thank you very much. I was struck by your observation of your press release, the person who died had more than 100,000 times the viral level that is normally seen with Zika. I am wondering what you are thinking on that and why he was so viremic whether that would change your thinking of the potential for transmission in a close contact setting like that. Would one have to worry at that point that maybe the virus would be in the skin, for instance? SATISH PILLAI: I am going to start and i am going to turn over to my laboratory and infection control colleague. I think what you highlighted is an important aspect of this. This is a very unique situation with these elevated viral loads that we have previously seen. The family contacted carrying for the individuals whose sick and later died. however, we are still, there is a lot we don't know about the Zika virus, we are still doing a lot of investigation to understand whether Zika can be spread from person to person through contact of a sick person. That’s under investigation. The facts remain that Zika is spread primarily through the bites of the infected Aedes species mosquito. A pregnant woman can pass Zika virus to her fetus or at the time of birth or a person who’s infected can pass it to their sex partner. That’s what we know and what we believe of the primary mode of transmission. But I would like to allow my colleague to weigh in as well. MIKE BELL: So this is Mike Bell. From the infection control perspective, I think it is early to make a clear statement about what we think could have happened. Certainly a high viral load is something we take very seriously, and as you just heard it is no something about which we have a very long experience. We are not at a point today to describe any specific action that might have led to transmission. That’s the point of occurrence of investigation under way in Utah. As soon as we know something new, we'll certainly use that information to assess risks to both family members and others. And health care personnel. But currently, nothing we can say other than recognizing a high viral load could be a different situation than we would ordinarily see. HELEN BRANSWELL: can I ask a follow-up questions, please. When the man in Utah died, the way that his death was framed was- He had Zika but he had another severe illness and it was not clear whether he died from Zika or died with Zika or how much Zika contributed to his death. When you see a viral load like that does that have to answer the question? MIKE BELL: So you are asking sort of a chicken or the egg question. Someone who is extremely ill and debilitated from another disease process could have a diminished immune system that does not fight the virus as well and that might allow more virus to proliferate in the bloodstream. On the other hand someone with a high viral load could be sick with the viral infection. I personally cannot tell you which way that went. But, it is certainly worth thinking about. HELEN BRANSWELL: Thank you. KATHY HARBEN: Next question, please. OPERATOR: Next question comes from Dr Jon LaPook with CBS News. DR. JON LAPOOK: Hi, it’s kind of a follow-up on exactly that line of questioning, I’m wondering the chicken and egg – was the patient immune compromised from some non-zika condition first and that led to a higher viral load or is it almost a sepsis-like thing happens from Zika, I don't remember seeing that in the literature that it could cause a sepsis like picture which would then lead to an overwhelmingly high viremia. Can you tell us a little bit of the underline illness that the deceased man had? SATISH PILLAI: No, at this point, these are all avenues that's under investigation. DR. JON LAPOOK: Okay. SATISH PILLAI: The department of health and Utah can provide more details of the individual case. DR. JON LAPOOK: Okay. KATHY HARBEN: Next question please. OPERATOR: Next comes from Kimberly Leonard with U.S. News and World Report. KIMBERLY LEONARD: Hi, thank you for taking my question. I am wondering whether the possibility that the virus has become airborne is being considered or is that just off the table given the way that we know it already transmits. MIKE BELL: So in our line of work, nothing is truly off the table. The table is vast. We never want to under estimate possibilities, however, it would be extremely unlikely for something like that to occur. In the absence of something like a medical procedure that could create a mechanical error for example -- this is one of the reasons when we handle viruses and other pathogens in the laboratory, we use special precautions because within these things in machines that travel very high velocity and if the test tube breaks, and that could create a special risk. In contrast a human being behaves differently, and so what we see with this virus is as you heard already the predominant mode of transmission is through the bite of an infectious mosquito. Right now, we’re accessing very carefully to see whether any other form of transmission could be happening it is a little bit early to be saying it specifically. KIMBERLY LEONARD: I am sorry, who's speaking? MIKE BELL: This is Doctor Mike Bell. KIMBERLY LEONARD: Thank you, Doctor Bell. KATHY HARBEN: Next question, please. OPERATOR: Next question comes from Robert King with Washington Examiner. ROBERT KING: Hi, Thanks for taking my question, I have a question about the mosquito in Utah, you said you were testing mosquitos in the area but the two mosquitos that primarily spread Zika (the Aedes Egypti and the Aedes Albipictus) aren’t in Utah, do you believe that more mosquitos are now potentially spreading the virus or could spread the virus? BOB WIRTZ: This is Bob Wirtz. No, we don't believe that. Right now as you mentioned the Aedes Egypti and the Aedes Albipictus are currently not found in the area. We have two CDC Entomologists who are assisting the Salt Lake City Mosquito Abatement District and Mosquito Collections -- they are collecting quite low numbers different species of mosquitos – primarily culex mosquitoes that preferably feed on birds. As Mike mentioned, we never take anything off the table, right now we feel that transmission by Aedes mosquitos is highly unlikely. ROBERT KING: What are you looking for in the mosquitos that you are collecting? BOB WIRTZ: They are checking for West Nile Virus as well as the Zika virus just to cover all the bases and to make sure that we get as much information as we can from the collecting that we are doing. ROBERT KING: Okay. KATHY HARBEN: Next question, please. OPERATOR: Next question comes from Maryn McKenna with National Geographic. MARYN MCKENNA: Thanks for having this call. I recognize that you said already that you don't have a hypothesis yet for the transmission that is too early. But, you have known this is going to ignite a lot of concerns in the general public that's paying attention to the Zika. Is there anything that you can say to temp that down in any way to keep team thinking of anyone who may have been exposed to the Zika is walking around with the infection. SATISH PILLAI: I think this goes back to my earlier statement that primary load of transmission for Zika is through the bite of the Aedes Egypti mosquitos. That has so far being the most common mode of transmission, there are other mechanisms or other modes of transmission such as sex and through pregnant woman passing the virus through pregnancy or what's what we know. We don't have evidence right now that the Zika can be passed to one person or another person by sneezing or coughing or touching or hugging or sharing utensils. The person with the mutated Zika that is being reported today was a family contact of an elderly patient who had been infected with the Zika and as we have heard earlier had a high viral load. While we still don't know exactly how this family contact became sick and we are actively investigating it. What we do know is that the primary mechanism in transmission are mosquito born. We feel that should provide some levels of reassurance to the public. KATHY HARBEN: Next question, please. OPERATOR: Next question comes from Stephanie Soucheray with CIDRAP News. STEPHANIE SOUCHERAY: Hi, thanks for taking this question. I am wondering what are the current safety guidelines for protecting health care workers in other countries where Zika is more endemic? MIKE BELL: This is Mike Bell, you’re asking what the infection control practice is in other countries are? I’m not aware of anything special or different other than what we would recommend here. For instance, I don't know of any country is treating these patients like you asked earlier if it is transmitted there you the air. this is something we are approaching, most or if not all country are approaching and using standard precautions to make sure that health care personnel don't have any direct contact with blood or bodily fluid, it is through broken skin or needle stick or slashes through the mucous membrane. STEPHANIE SOUCHERAY: Thank you. KATHY HARBEN: Next question, please. OPERATOR: Next question comes from Julie Steenhuysen with Reuters. Your line is open. JULIE STEENHUYSEN: Hi, yes, I have two questions. First of all, I want to confirm -- so it was not learned that the deceased person had Zika until after his or her death, is that correct? Is it right to assume that the person that's carrying for this patient did not know that the elderly man had Zika? I have a follow up. SATISH PILLAI: I don't want speculate on what the individual and the timing of when the individual found out the diagnoses of Zika. The important thing is when you are essentially caring for an individual, health care workers caring for the individual with the virus, the use of standard precautions is appropriate way to help prevent transmission of infection and preventing exposure to blood and bodily fluids. JULIE STEENHUYSEN: Okay, a follow up, Mike, do you think this alters the CDC recommendations for personal protective gear and health care workers in anyway. You know several times in your press releases you were saying it was surprising. Clearly, it is. I am wondering if it means particularly extremely ill patients and you need to do some testing for high viral load and you need to alter PPE instructions. MIKE BELL: Currently, we are not altering PPE instructions. I think what this highlights is the fact that when you have an infection like Zika virus infection where a good percentage of patients don't have symptoms. It means that as important as ever to stick with good precautions. Just like we assume anybody might carry hepatitis or HIV, we don’t wait for a positive diagnosis in order to prevent blood or bodily fluid exposure. The same thing is true with Zika virus and this is a great example of why we should never take chances but always adhere to careful and standard precautions. SATISH PILLAI: I would like to just reemphasize one point, you know, as of July 13th, there have been 1306 cases of Zika reported in the continental United States and Hawaii. And, of these cases there is no reason to suspect this kind of person to person transmission is the mode of transmission. This is a unique event in that context. I think that needs to also be kept in mind. JULIE STEENHUYSEN: Thank you. KATHY HARBEN: I think we have time for one more question. OPERATOR: Our last question comes from Jeneen Interlandi with Customer Reports. JENEEN INTERLANDI: Thanks so much for having the call. Quickly. Most of my questions were answered, you mentioned earlier and I think I saw in an earlier report of a question of whether or not this second infection of this person interacting with the elderly man who was sick whether it had anything to do with him contacting the virus. Is there a chance that he got it some other way that he did not come from this patient? SATISH PILLAI: I think all we are saying with that is that we are having an ongoing investigation, we are considering and as you heard earlier, mosquito trapping is occurring, a detailed hospital investigation is under going. We don't want to put the blinders on and just go down to one avenue of investigation. So I think that's the point of that statement. JENEEN INTERLANDI: thank you. KATHY HARBEN: Last call if there is another question we can take it if not. We’ll wrap it up. OPERATOR: Yes, we do have a few more. Okay, Melissa Healy, with the Los Angeles times. Your line is open. MELISSA HEALY: Hi there, thanks for taking my question. Can I ask as part of the investigation, is there still the possibility of conducting any post-mortem study of the deceased patient. Will his brain be looked at of investigation of the Zika virus there? Is there any evidence he had Guillain-Barre syndrome? MIKE BELL: The details of that and the investigation is ongoing. I don't have that level of details right now regarding the specifics of elderly individual’s clinical course and regarding the air – we would defer to the Utah Department of Health for those particulars but we are continuing to do the clinical investigations understanding the potential risk factors that may have contributed. As we get more information we'll share as quickly as we can and we'll see information that shed more light onto this event. KATHY HARBEN: We do have time for one more question. OPERATOR: Next question comes from Heather Tesoriero with CBS News. HEATHER TESORIERO: Hi, two things. One of the viral load of the new Utah patient, was that in a more typical range and the other thing is can you shed some light on the process and the procedure you’ll be undertaking to try to understand the unusual viral load in the deceased patient? SATISH PILLAI: I think for the ladder, it will require a thorough review of the clinical course getting better understanding of under lining potentials, medical comorbidities – but as you heard earlier in this call by Doctor Bell, there was a chicken or egg situation and understanding whether what or how if there was an under line illness that may have contributed to immunosuppression this or becoming critically ill contributed to the high viral load. At this point, i don't think we can provide an answer but the goal of the investigation is to reveal the clinical course and the medical records and get a better understanding of how the individual may have come to a developed a high viral load. And, regarding the initial question, we have no indications to suggest that the individuals who subsequently became ill had the similar type of high viral load that was noted inside the index case. Most importantly this individual rapidly recovered and which is the typical and clinical course that one may inspect with this Zika virus infection. HEATHER TESORIERO: Thank you so much, one quick follow up. Was it – I’m sorry if you’ve already addressed this already but was it known with the deceased patient, was it not discovered that the patient had Zika virus until the patient was deceased or was it known while the patient was known and dying. SATISH PILLAI: I would say this is still in the realm of our active investigation and as we get more of the sequence of events and understanding timing and working with our colleagues at Utah Department of Health, we hope to get you updates regarding this and additional information as quickly as possible. Again, I think the bottom line here is that this is a unique case of the 1300 cases that we have reported thus far and the continental United States and Hawaii, there is no suggestions of this type of spread to date. But, Zika continues to surprise us. and I think above all, we want to make sure that pregnant women are safe and they should not be traveling to some of the locations that is we described previously that have active mosquito born transmissions of Zika which can be found on the CDC website and individuals who may be at risk for sexual transmission of Zika should use condoms correctly and consistently at all times or abstain from sex. Again, thank you very much for calling in. I am going to turn it back over to Mrs. Harben. KATHY HARBEN: Thank you everyone for joining us. This concludes today's media availability, we'll post a transcript on the CDC's news room website as soon as possible. If you have other questions or need additional information, you can call us at 404-629-3286 or you can e-mail us. Thank you very much. OPERATOR: Please disconnect at this time of your conference. http://www.cdc.gov/media/releases/2016/0719-zika-utah-investigation-update.html
  2. Zika outbreak in Florida? Miami reports first case of virus NOT related to travelMiami resident has contracted Zika without visiting a region with the virusHealth officials have launched an investigation, could mark first outbreakThe virus is spread via Aedes aegypti mosquitoes and sex Until now, there is no known sign that Zika-carrying mosquitoes are in USUtah has also launched investigation into non-travel-related infection By MIA DE GRAAF FOR DAILYMAIL.COM and AFP PUBLISHED: 07:34 EST, 20 July 2016 | UPDATED: 08:37 EST, 20 July 2016 1 View comments Florida has reported America's first homegrown Zika infection. A patient in Miami has contracted the virus despite not traveling to a region affected by Zika, health officials revealed on Wednesday. It could mean that, after months of looming fears, mosquitoes carrying the infection have arrived in continental US. Utah is also investigating a non-travel-related case after the carer of an elderly man who died of Zika contracted the virus. SCROLL DOWN FOR VIDEO +2A New Yorker has become the first woman known to infect a man with Zika (pictured) through sex It was not immediately clear whether the Miami case involved mosquito bites or sexual contact, since both are known routes of transmission. The Florida Health Department 'is conducting an investigation into a possible non-travel related case of Zika virus in Miami-Dade County,' it said in a statement. The US Centers for Disease Control and Prevention said Florida had confirmed a Zika infection, and that the CDC is 'closely coordinating with Florida officials,' according to a statement. The CDC said federal authorities would, upon request, 'conduct additional laboratory testing.' RELATED ARTICLESPrevious1NextRevealed: How Zika passes from mother to baby in the womb -...Woman infects man with Zika through sex: New York reports...SHARE THIS ARTICLEShareAs of mid-July, there have been 1,306 cases of Zika in the continental United States, nearly all involving people who had traveled to areas in Latin America and the Caribbean basin that are affected by the current outbreak. Fourteen of the cases were transmitted by sexual contact between those who had traveled and their US-based partners. The US territory of Puerto Rico has also seen a spike in cases in recent months. Earlier this week, a case emerged in Utah in which a caregiver appeared to have been infected by an elderly patient, though the exact route of transmission remains unknown. Zika is a concern because if a pregnant woman is infected, she faces a higher risk of bearing a child with microcephaly, in which the skull and brain are malformed and smaller than normal. The 'CDC has been working with state, local, and territorial health officials to prepare for the possibility of locally acquired Zika infection in the United States,' the agency said. Researchers looking into fighting Zika with bacteria Loaded: 0%Progress: 0%0:00PlayMute Current Time0:00/Duration Time6:16FullscreenNeed Text 'To date, CDC has provided Florida more than $2 million in Zika-specific funding and about $27 million in emergency preparedness funding that can be used toward Zika response efforts.' The Florida Department of Health said Zika prevention kits and repellent would be available for pickup at the health department and distributed in the area being studied. 'Zika kits are intended for pregnant women,' the health department said. 'Mosquito control has already conducted reduction and prevention activities in the area of investigation.' Zika virus can cause a variety of symptoms, including rash and joint and muscle pain, but often carries no symptoms at all. It can also trigger Guillain-Barre Syndrome, which leads the immune system to attack the nerves and may lead to paralysis. The virus was first identified in 1947 but is poorly understood, and there remains no vaccine to prevent it or medicine to treat it. Officials urge pregnant women to avoid traveling to Zika-affected areas and to wear mosquito repellent to reduce the risk of being bitten. Condoms or abstinence are also recommended to reduce the risk of infection by people traveling to or living in places where Zika is circulating. WHAT YOU NEED TO KNOW ABOUT ZIKA WHAT IS ZIKA? The Zika (ZEE'-ka) virus was first discovered in monkey in Uganda in 1947 - its name comes from the Zika forest where it was first discovered. It is native mainly to tropical Africa, with outbreaks in Southeast Asia and the Pacific Islands. It appeared in Brazil in 2014 and has since been reported in many Latin American countries and Caribbean islands. +2The World Health Organization says Zika is rapidly spreading in the Americas because it is new to the region, people aren't immune to it, and the Aedes aegypti mosquito that carries it is just about everywhere HOW IS IT SPREAD? It is typically transmitted through bites from the same kind of mosquitoes - Aedes aegypti - that can spread other tropical diseases, like dengue fever, chikungunya and yellow fever. Scientists have found Zika can be transmitted sexually. The World Health Organisation recently warned the mode of transmission is 'more common than previously assumed'. Couples should abstain or wear condoms for eight weeks if either partner has traveled to a country with a Zika outbreak, regardless of whether they have symptoms. During the current outbreak, the first case of sexually transmitted Zika was reported in Texas, at the beginning of February. The patient became infected after sexual contact with a partner diagnosed with the virus after travelling to an affected region. Now, health officials in the US are investigating more than a dozen possible cases of Zika in people thought to be infected during sex. There are also reported cases in France and Canada. Prior to this outbreak, scientists reported examples of sexual transmission of Zika in 2008. A researcher from Colorado, who caught the virus overseas, is thought to have infected his wife, on returning home. And records show the virus was found in the semen of a man in Tahiti. On Friday July 15, it was confirmed that women can pass the virus to men after such a case was seen in New York City. The World Health Organization says Zika is rapidly spreading in the Americas because it is new to the region, people aren't immune to it, and the Aedes aegypti mosquito that carries it is just about everywhere - including along the southern United States. Canada and Chile are the only places without this mosquito. ARE THERE SYMPTOMS? The majority of people infected with Zika virus will not experience symptoms. Those that do, usually develop mild symptoms - fever, rash, joint pain, and red eyes - which usually last no more than a week. There is no specific treatment for the virus and there is currently no vaccine to protect against infection, though several are in the developmental stages. WHY IS IT A CONCERN NOW? In Brazil, there has been mounting evidence linking Zika infection in pregnant women to a rare birth defect called microcephaly, in which a newborn's head is smaller than normal and the brain may not have developed properly. Brazilian health officials last October noticed a spike in cases of microcephaly in tandem with the Zika outbreak. The country said it has confirmed more than 860 cases of microcephaly - and that it considers them to be related to Zika infections in the mother. Brazil is also investigating more than 4,200 additional suspected cases of microcephaly. However, Brazilian health officials said they had ruled out 1,471 suspected cases in the week ending March 19. Now Zika has been conclusively proven to cause microcephaly. The WHO also stated that researchers are now convinced that Zika is responsible for increased reports of a nerve condition called Guillain-Barre that can cause paralysis. A team of Purdue University scientists recently revealed a molecular map of the Zika virus, which shows important structural features that may help scientists craft the first treatments to tackle the disease. The map details vital differences on a key protein that may explain why Zika attacks nerve cells - while other viruses in the same family, such as dengue, Yellow Fever and West Nile, do not. CAN THE SPREAD BE STOPPED? Individuals can protect themselves from mosquito bites by using insect repellents, and wearing long sleeves and long pants - especially during daylight, when the mosquitoes tend to be most active, health officials say. Eliminating breeding spots and controlling mosquito populations can help prevent the spread of the virus. Read more: http://www.dailymail.co.uk/health/article-3699331/Zika-outbreak-Florida-State-reports-case-virus-NOT-related-travel.html#ixzz4ExO3hUN3 Follow us: @MailOnline on Twitter | DailyMail on Facebook
  3. July 19, 2016 Department of HealthInvestigating Possible Non-Travel Related Case of ZikaContact:Communications [email protected](850) 245-4111 Tallahassee, Fla. — Today the Florida Department of Health announced that it is conducting an investigation into a possible non-travel related case of Zika virus in Miami-Dade County. The department is actively conducting an epidemiological investigation, is collaborating with the Centers for Disease Control and will share additional details as they become available. Zika prevention kits and repellant will be available for pickup at DOH-Miami-Dade and distributed in the area under investigation. Zika kits are intended for pregnant women. Mosquito control has already conducted reduction and prevention activities in the area of investigation. Residents and visitors are reminded that the best way to protect themselves is to prevent mosquito bites through practicing good drain and cover methods: DRAIN standing water to stop mosquitoes from multiplying Drain water from garbage cans, house gutters, buckets, pool covers, coolers, toys, flower pots or any other containers where sprinkler or rain water has collected.Discard old tires, drums, bottles, cans, pots and pans, broken appliances and other items that aren't being used.Empty and clean birdbaths and pet's water bowls at least once or twice a week.Protect boats and vehicles from rain with tarps that don’t accumulate water.Maintain swimming pools in good condition and appropriately chlorinated. Empty plastic swimming pools when not in use. COVER skin with clothing or repellent CLOTHING - Wear shoes, socks, long pants and long-sleeves. This type of protection may be necessary for people who must work in areas where mosquitoes are present.REPELLENT - Apply mosquito repellent to bare skin and clothing.Always use repellents according to the label. Repellents with DEET, picaridin, oil of lemon eucalyptus, and IR3535 are effective.EPA-approved repellent is safe for pregnant women to use.Use mosquito netting to protect children younger than 2 months old. COVER doors and windows with screens to keep mosquitoes out of your house Repair broken screening on windows, doors, porches and patios.The department continues to issue daily updates each week day at 2 p.m. Updates include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. For more information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/07/071916-investigating-possible-non-travel-related-case-zika.html
  4. Zika outbreak: possible local transmission in Florida investigatedPotential first homegrown case of Zika virus in continental U.S.CBC News Posted: Jul 20, 2016 9:30 AM ET Last Updated: Jul 20, 2016 9:30 AM ET 1 share Facebook Twitter Reddit Google Share Email Related StoriesCaregiver mysteriously gets Zika from man who diedGo inside a Level 3 virus lab battling ZikaExternal LinksInvestigating Possible Non-Travel Related Case of Zika, Florida Department of Health,(Note: CBC does not endorse and is not responsible for the content of external links.) Evaristo Miqueli, a natural resources officer in Florida, looks through a microscope at Aedes aegypti mosquito larvae in June in Florida. Health officials in the state are distributing Zika prevention kits and repellent. (Lynne Sladky/Associated Press) Florida health officials said they are investigating a case of Zika virus infection that does not appear to have stemmed from travel to another region with an outbreak. Tuesday's statement from the Florida Department of Health did not specify whether the Zika case was believed to have been transmitted via mosquito bite, sexual contact or other means. The department said the case was reported in Miami-Dade County and that it is working with the U.S. Centers for Disease Control and Prevention on an epidemiological study. The department also reiterated guidance to Florida residents on protecting themselves from mosquitoes that may carry the virus. Caregiver mysteriously gets Zika from man who diedGo inside a Level 3 virus lab battling Zika "Zika prevention kits and repellant will be available for pickup … and distributed in the area under investigation," the health department said in a statement. "Mosquito control has already conducted reduction and prevention activities in the area of investigation." Zika, which can cause a rare birth defect and other neurological conditions, has spread rapidly through the Americas. A small number of cases of Zika transmitted between sexual partners have also been documented. There has yet to be a case of local transmission by mosquitoes in the continental United States, though more than 1,300 people in the U.S. have reported infections after traveling to a Zika outbreak area. U.S. officials have predicted local outbreaks to begin as the weather warms, particularly in southern states such as Florida and Texas. http://www.cbc.ca/news/health/zika-florida-1.3686868?cmp=rss
  5. ReferencesJump to Section1. Why this case is important?2. Case description3. Other similar and contrasting published cases4. DiscussionCompeting interestsFundingEthical approvalReferencesCao-Lormeau, V.-M., Blake, A., Mons, S., Lastère, S., Roche, C., Vanhomwegen, J. et al. Guillain-Barré syndrome outbreak associated with Zika virus infection in French Polynesia: a case-control study.Lancet. 2016;DOI: http://dx.doi.org/10.1016/S0140-6736(16)00562-6View in Article | Abstract | Full Text | Full Text PDF | PubMed | Scopus (17)Brasil, P., Pereira, J.P., Raja Gabaglia, C., Damasceno, L., Wakimoto, M., Ribeiro Nogueira, R.M. et al.Zika virus infection in pregnant women in Rio de Janeiro—preliminary report. N. Engl. J. Med. 2016;DOI: http://dx.doi.org/10.1056/NEJMoa1602412View in Article | Crossref | PubMedHuzly, D., Hanselmann, I., Schmidt-Chanasit, J., and Panning, M. High specificity of a novel Zika virus ELISA in European patients after exposure to different flaviviruses. Euro Surveill. 2016; 21DOI: http://dx.doi.org/10.2807/1560-7917.ES.2016.21.16.30203View in Article | Crossref | Scopus (1)Lanciotti, R.S., Kosoy, O.L., Laven, J.J., Velez, J.O., Lambert, A.J., Johnson, A.J. et al. Genetic and serologic properties of Zika virus associated with an epidemic, Yap State, Micronesia, 2007. Emerg. Infect. Dis. 2008; 14: 1232–1239DOI: http://dx.doi.org/10.3201/eid1408.080287View in Article | Crossref | PubMed | Scopus (131)Cao-Lormeau, V.-M. and Musso, D. Emerging arboviruses in the Pacific. Lancet. 2014; 384: 1571–1572DOI: http://dx.doi.org/10.1016/S0140-6736(14)61977-2View in Article | Abstract | Full Text | Full Text PDF | PubMedZanluca, C., de Melo, V.C.A., Mosimann, A.L.P., Dos Santos, G.I.V., Dos Santos, C.N.D., and Luz, K. First report of autochthonous transmission of Zika virus in Brazil. Mem. Inst. Oswaldo Cruz. 2015; 110: 569–572DOI: http://dx.doi.org/10.1590/0074-02760150192View in Article | Crossref | PubMed | Scopus (90)European Center for Disease Control and Prevention (ECDC). Zika Virus Disease Epidemic: Potential Association with Microcephaly and Guillain–Barré Syndrome. Second Update, 9 March 2016. ECDC,Stocholm; March 2016 (Available from:)http://ecdc.europa.eu/en/publications/Publications/zika-virus-rapid-risk-assessment-9-march-2016.pdf.View in Article Zwizwai, R. Infection disease surveillance update. Lancet Infect. Dis. 2016; 16: 157DOI: http://dx.doi.org/10.1016/S1473-3099(16)00023-2View in Article | Abstract | Full Text | Full Text PDF | PubMedHeang, V., Yasuda, C.Y., Sovann, L., Haddow, A.D., Travassos da Rosa, A.P., Tesh, R.B. et al. Zika virus infection, Cambodia, 2010. Emerg. Infect. Dis. 2012; 18: 349–351DOI: http://dx.doi.org/10.3201/eid1802.111224View in Article | Crossref | PubMed | Scopus (49)Tappe, D., Rissland, J., Gabriel, M., Emmerich, P., Gunther, S., Held, G. et al. First case of laboratory-confirmed Zika virus infection imported into Europe, November 2013. Euro Surveill. 2014; 19View in Article Wæhre, T., Maagard, A., Tappe, D., Cadar, D., and Schmidt-Chanasit, J. Zika virus infection after travel to Tahiti, December 2013. Emerg. Infect. Dis. 2014; 20: 1412–1414DOI: http://dx.doi.org/10.3201/eid2008.140302View in Article | Crossref | PubMed | Scopus (20)Maria, A.T., Maquart, M., Makinson, A., Flusin, O., Segondy, M., Leparc-Goffart, I. et al. Zika virus infections in three travellers returning from South America and the Caribbean respectively, to Montpellier, France December 2015–January 2016. Euro Surveill. 2016; 21DOI: http://dx.doi.org/10.2807/1560-7917.ES.2016.21.6.30131View in Article | Crossref | Scopus (5)Musso, D., Roche, C., Nhan, T.-X., Robin, E., Teissier, A., and Cao-Lormeau, V.-M. Detection of Zika virus in saliva. J. Clin. Virol. 2015; 68: 53–55DOI: http://dx.doi.org/10.1016/j.jcv.2015.04.021View in Article | Abstract | Full Text | Full Text PDF | PubMed | Scopus (49)Gourinat, A.-C., O'Connor, O., Calvez, E., Goarant, C., and Dupont-Rouzeyrol, M. Detection of Zika virus in urine. Emerg. Infect. Dis. 2014; 21: 84–86DOI: http://dx.doi.org/10.3201/eid2101.140894View in Article | Crossref | Scopus (59)de M. Campos, R., Cirne-Santos, C., Meira, G.L.S., Santos, L.L.R., de Meneses, M.D., Friedrich, J. et al.Prolonged detection of Zika virus RNA in urine samples during the ongoing Zika virus epidemic in Brazil. J. Clin. Virol. 2016; 77: 69–70DOI: http://dx.doi.org/10.1016/j.jcv.2016.02.009View in Article | Abstract | Full Text | Full Text PDF | PubMed | Scopus (7)Mansuy, J.M., Dutertre, M., Mengelle, C., fourcade, C., Marchou, B., Delobel, P. et al. Zika virus: high infectious viral load in semen, a new sexually transmitted pathogen?. Lancet Infect. Dis. 2016;DOI: http://dx.doi.org/10.1016/S1473-3099(16)00138-9View in Article | Abstract | Full Text | Full Text PDF | Scopus (10)Musso, D., Roche, C., Robin, E., Nhan, T., Teissier, A., and Cao-Lormeau, V.-M. Potential sexual transmission of Zika virus. Emerg. Infect. Dis. 2015; 21: 359–361DOI: http://dx.doi.org/10.3201/eid2102.141363View in Article | Crossref | PubMed | Scopus (103)Musso, D., Cao-Lormeau, Van Mai, and Gubler, D.J. Zika virus: following the path of dengue and chikungunya?. Lancet. 2015; 386: 243–244DOI: http://dx.doi.org/10.1016/S0140-6736(15)61273-9View in Article | Abstract | Full Text | Full Text PDF | PubMed | Scopus (51)
  6. 4. DiscussionJump to Section1. Why this case is important?2. Case description3. Other similar and contrasting published cases4. DiscussionCompeting interestsFundingEthical approvalReferencesIt is most important to know the duration of ZIKV viremia so as to be better prepared for disease control worldwide. ZIKV may be transmitted from viremic humans to vectors such as Aedes mosquito species under suitable climatic conditions, and some of these mosquitos are already established in Europe, where they could perpetuate local transmission cycles. Short-term low-level ZIKV viremia was considered to be common, lasting usually less than five days after the onset of symptoms [13]. The data from these 2 mildly symptomatic patients show that ZIKV RNA may remain in the plasma for about 2 weeks, although its concentration decreases, indicating that mosquito control measures should be continued for at least 2 weeks after symptom onset. On the other hand we found the anti-ZIKV IgM detection as a useful tool for an early biological diagnosis. The route of ZIKV virus shedding may also be relevant. There may be short-term ZIKV shedding into the saliva [13]. Greater virus loads of ZIKV that persist for longer can also be detected in the urine [[14], [15]]. But the finding that the man had a higher viral load in urine than the woman needs further investigations to evaluate if this is only casual or a tendency relative to man vs woman virus excretion in urine. Thus protection from in-situ vectors could include real-time RT-PCR screening for ZIKV of the urine of asymptomatic but “contagious” travelers returning from epidemic areas to regions where Aedes species are established. ZIKV shedding into the semen is a much greater problem [16]. Although almost all cases of ZIKV infection are transmitted by mosquito bites, rare cases of ZIKV shedding into the semen and its subsequent sexual transmission have been reported [17]. However, nothing is known about how long such shedding persists. Hence, women who are already pregnant or trying to conceive with men who have been exposed to ZIKV should be made aware of this risk. The trends towards urbanization and globalization both point to the potential for major urban epidemics of ZIKV. It is imperative that we delineate as precisely as possible the life cycle of ZIKV and virus shedding in order to develop effective mosquito control [18].
  7. 3. Other similar and contrasting published casesJump to Section1. Why this case is important?2. Case description3. Other similar and contrasting published cases4. DiscussionCompeting interestsFundingEthical approvalReferencesZika virus infection is an emerging arthropod-borne flavivirus that is transmitted by Aedes mosquito species. Sporadic cases were initially reported in Africa and Asia and the first outbreak occurred in 2007 on Yap Island (Micronesia) [4]. This was followed by a larger epidemic in 2013–2014 in French Polynesia [5]. The first evidence of a ZIKV infection in the Americas appeared in northeast Brazil in May 2015 [6]. An Asian lineage virus spread rapidly through South and Central America and the Caribbean islands a few months later. It eventually affected 42 countries worldwide [7]. Most recently, in the last week of 2015, 12 confirmed and 150 suspected cases of ZIKV infection were reported on the island of Martinique (French West Indies) [8]. Rash, fever, arthralgia and conjunctivitis are the most common symptoms and they usually last about a week [9]. The most severe risk posed by the disease is that of developing Guillain-Barré syndrome [1], and for pregnant women of fetal abnormalities and death [2]. Travel-related imported ZIKV infections were reported during the 2013 epidemic [[10], [11]]. Anti- ZIKV antibodies were detected, but they cross-reacted with Dengue antibodies [[10], [12]] and often required confirmation with neutralizing antibodies. A ZIKV infection is presently diagnosed within the first week after the symptom onset using RT-PCR to detect virus RNA in the blood and/or urine [[11], [13], [14], [15]]. The 157 blood samples tested during the Yap Island outbreak included 17 that were positive for ZIKV by real-time RT-PCR; most of the positive samples were collected within three days of symptom onset, although one positive specimen was collected 11 days after symptom onset [4]. A recent report of three imported cases returning from the Americas to France indicated that viremia was short, less than five days, in all cases and virus was detected in the urine and saliva eight days after symptom onset in one case, but not after two weeks in another [12]. In this report the serological response was also studied; IgM antibodies appeared between five to nine days after symptom onset whereas the IgG rise was delayed for one patient.
  8. Fig. 1 Phylogenetic tree constructed using the neighbor-joining method and based on a partial (1079 nt) sequence of the ZIKA virus NS5 gene that was imported to metropolitan France from Martinique. Phylogenetic analysis includes reference sequences of ZIKA viruses from Asian and African lineages. Sequences are indicated as GenBank accession numbers and countries. The imported ZIKA strain isolated in this study is indicated in boldface. Bootstrap support values (100 replicates) are indicated at major nodes. Scale bar indicates nucleotide substitutions per site.
  9. Table 1Kinetics of ZIKV RNA in plasma and urine, kinetics of ZIKV antibodies in plasma.Case 27 Jan 201630 Jan 201601 Feb 201604 Feb 201608 Feb 201617 Feb 2016ManDays after symptom onset257101423 RT-PCR plasma (copies/mL)100aNS75a2306300 RT-PCR urine (copies/mL)51,00074,000150034015600 Anti-ZIKV IgGNS––NS±+ Anti-ZIKV IgMNS++NS+± WomanDays after symptom onset479121625 RT-PCR plasma (copies/mL)180a270120a160a5600 RT-PCR urine (copies/mL)555018003402600670 Anti-ZIKV IgGNS+++++ Anti-ZIKV IgMNS+++++aEstimated values outside of the standard curve range, NS: not sampled, −: negative, ±: doubtful, +: positive.
  10. 2. Case descriptionJump to Section1. Why this case is important?2. Case description3. Other similar and contrasting published cases4. DiscussionCompeting interestsFundingEthical approvalReferencesA French couple living in of southwest France with no unusual medical history spent eight days in Martinique during January 2016. They showed no symptoms during their stay and returned to France on January 20. The 66-year-old woman immediately developed symptoms of intense fatigue and three days later, on January 23, she began to shiver, developed myalgia, arthralgia and a cutaneous rash. Two days later, on January 25, the 69-year-old man suddenly developed a fever with a cutaneous rash, myalgia and arthralgia. Both patients had begun to recover spontaneously from the fever when they were examined on January 27th, but they still had the remains of a maculo-papular rash. Neurological examination was normal. The man’s white blood cell count showed mild neutropenia (900 cells/μL, norm: >2000 cells/μL). Their blood hemoglobin, platelet counts, creatinine, C-reactive protein and hepatic enzyme activities were all normal. Their plasma and urine tested positive for ZIKV by real-time reverse transcriptase polymerase chain reaction (real-time RT-PCR) (Real Star Zika virus RT-PCR kit 1.0, Altona Diagnostic GmbH, Hamburg, Germany), while Chikungunya and Dengue virus RNAs were not detected by an in-house real-time RT-PCR system. Zika virus RNA was quantified using a synthetic RNA transcript (Altona Diagnostic GmbH, Hamburg, Germany). The range was 200–2.000.000 copies/mL. Serial samples of several body fluids were assayed for ZIKV by real-time RT-PCR until February 17 (Table 1). ZIKV RNA was detected in plasma and urine samples from both patients, but the rates of disappearance from these compartments differed; ZIKV RNA was found in the saliva of only the woman (data not shown in Table 1). ZIKV remained detectable in their plasma for about 2 weeks, while the urine of the man was consistently positive until day 14 and that of the woman until day 25. The greater virus load in the urine was observed in the man. While both patients recovered within a week, the woman developed unilateral conjunctivitis few days after the first examination. Real-time RT-PCR on her conjunctiva detected no ZIKV; those of her husband tested positive (detected but not quantified) but were asymptomatic. We identified the virus in a urine sample from the woman by sequencing a 1079-nt fragment within the NS5 gene of ZIKV and performing phylogenetic analyses using reference sequences. As expected the virus was an Asian lineage strain (Fig. 1). On the other hand serial samples of plasma from the two patients were tested for anti-ZIKV IgG and IgM (ELISA Anti-virus ZIKA, Euroimmun, Lübeck, Germany [3]). These assays detect antibodies against NS1 antigen and were used according to the manufacturer’s instructions. Anti-ZIKV IgM were positive for both patients and could be a diagnostic tool from nearly one week after symptom onset. Nevertheless the responses were different between the two patients; the man exhibited a doubtful reactivity from the 23rd day. Similarly the anti-ZIKV IgG responses varied but both patients were positive around three weeks after symptom onset (Table 1).
  11. 1. Why this case is important?Jump to Section1. Why this case is important?2. Case description3. Other similar and contrasting published cases4. DiscussionCompeting interestsFundingEthical approvalReferencesThe recent emergence of Zika virus (ZIKV) infections and the current outbreak in the Americas and Caribbean islands is of major concern. Links between ZIKV and neurological disorders and congenital malformations are now well established [[1], [2]], although most cases of ZIKV infection are asymptomatic or mild. While interest in ZIKV within the scientific community has increased exponentially, data on the viral load and specific antibodies kinetics in individual patients are still lacking. This report describes the kinetics of ZIKV decay in the body compartments and the kinetics of anti-ZIKV IgG and IgM of two people returning from Martinique, French West Indies.
  12. AbstractWhile the rapid spread of Zika virus (ZIKV) in South America has been declared a public health emergency few data are available on the kinetics of the virus load and the specific antibodies in individual patients. This report describes the kinetics of ZIKV decay in the body compartments and the kinetics of anti ZIKV IgG and IgM of two people returning from Martinique, French West Indies. ZIKV remained detectable in the plasma for roughly 2 weeks indicating that mosquito control measures should be prolonged accordingly. Remarkably, their urine samples consistently tested positive for even longer. The antibodies responses were different between the two patients but for both the rapid onset of IgM allowed a diagnosis from the end of the first week.
  13. Highlights •Data on the kinetics of Zika virus load and serology are provided.•Anti-Zika virus IgM detection could represent a useful tool for early diagnosis.•Zika virus remains detectable in the plasma for 2 weeks, and even longer in urine.•Mosquito control measures should be prolonged accordingly.
  14. Camille Fourcade1,, Jean-Michel Mansuy1,, Marine Dutertre, Marie Delpech, Bruno Marchou,Pierre Delobel, Jacques Izopet, Guillaume Martin-Blondel1These authors contributed equally to this article. DOI: http://dx.doi.org/10.1016/j.jcv.2016.06.011
  15. September 2016Volume 82, Pages 1–4 Viral load kinetics of Zika virus in plasma, urine and saliva in a couple returning from Martinique, French West Indieshttp://www.journalofclinicalvirology.com/article/S1386-6532(16)30144-5/fulltext
  16. Sequence Map Update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU
  17. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU886298.1|Zika virus isolate MN NS5 gene, partial cds19161916100%0.0100%KU886298.1Select seq gb|KX548902.1|Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds19161916100%0.099%KX548902.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome19161916100%0.099%KU497555.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds19161916100%0.099%KU647676.1Select seq gb|KX369547.1|Zika virus strain PF13/251013-18, complete genome19101910100%0.099%KX369547.1Select seq gb|KU820897.3|Zika virus isolate FLR polyprotein gene, complete cds19101910100%0.099%KU820897.3Select seq gb|KX280026.1|Zika virus isolate Paraiba_01, complete genome19101910100%0.099%KX280026.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome19101910100%0.099%KX262887.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome19101910100%0.099%KX247646.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome19101910100%0.099%KX197192.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome19101910100%0.099%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome19101910100%0.099%KX156775.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome19101910100%0.099%KX156774.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome19101910100%0.099%KX087102.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome19101910100%0.099%KX051563.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome19101910100%0.099%KU509998.3Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome19101910100%0.099%KU870645.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome19101910100%0.099%KU926310.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds19101910100%0.099%KU729217.2Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome19101910100%0.099%KU321639.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds19101910100%0.099%KJ776791.1Select seq gb|KX446951.1|Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome19051905100%0.099%KX446951.1Select seq gb|KX446950.1|Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome19051905100%0.099%KX446950.1Select seq gb|KX377337.1|Zika virus strain PRVABC-59, complete genome19051905100%0.099%KX377337.1Select seq gb|KU758877.1|Zika virus isolate 17271 polyprotein gene, complete cds19051905100%0.099%KU758877.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds19051905100%0.099%KX247632.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome19051905100%0.099%KX087101.2Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome19051905100%0.099%KX198135.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds19051905100%0.099%KU991811.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome19051905100%0.099%KU926309.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome19051905100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome19051905100%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome19051905100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome19051905100%0.099%KU853012.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome19051905100%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome19051905100%0.099%KU527068.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds19051905100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds19051905100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome19051905100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds19051905100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds19051905100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds19051905100%0.099%KU365777.1Select seq gb|KX520666.1|Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds18991899100%0.099%KX520666.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome18991899100%0.099%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome18991899100%0.099%KU940224.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds18991899100%0.099%KU820898.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds18991899100%0.099%KU729218.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds18991899100%0.099%KU312312.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds18931893100%0.099%KU937936.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds18931893100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds18931893100%0.099%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds18931893100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds18931893100%0.099%KU761564.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds18931893100%0.099%KU365778.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome18881888100%0.099%KX117076.1Select seq gb|KU866423.2|Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds18821882100%0.099%KU866423.2Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome18821882100%0.099%KX253996.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds18821882100%0.099%KX185891.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds1882188298%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds1882188298%0.099%KX059013.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds18821882100%0.099%KU963796.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds18821882100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome18821882100%0.099%KU820899.2Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome18821882100%0.099%KU744693.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds18771877100%0.099%KF993678.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome18601860100%0.099%KU681081.3Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome18211821100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds18211821100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds18211821100%0.098%EU545988.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds1805180596%0.099%KU179098.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome17941794100%0.098%KU681082.3Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1794179493%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1790179093%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1788178893%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1784178493%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1784178493%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1784178493%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1783178393%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1644164485%0.099%KJ873160.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds16221622100%0.095%HQ234499.1Select seq gb|KX377336.1|Zika virus strain P6-740, complete genome16161616100%0.095%KX377336.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1458145876%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds1410141075%0.099%KM851039.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds1389138972%0.099%KU985087.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1384138472%0.0100%KU556802.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds1365136575%0.098%KM851038.1Select seq gb|KU724096.1|Zika virus isolate 259249_2015_Panama NS5B gene, partial cds1336133669%0.099%KU724096.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds1273127366%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds1264126466%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds1260126066%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds1254125465%0.0100%KU232294.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome12511251100%0.088%KX198134.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds1251125165%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds1247124764%0.0100%KU232298.1Select seq gb|KX377335.1|Zika virus strain MR-766, complete genome12451245100%0.088%KX377335.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds12451245100%0.088%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome12451245100%0.088%KU955594.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds12451245100%0.088%KU720415.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID12451245100%0.088%LC002520.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds12451245100%0.088%HQ234498.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds12451245100%0.088%DQ859059.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome12451245100%0.088%AY632535.2Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds1243124364%0.0100%KU232296.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds1243124365%0.099%KU232293.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome12401240100%0.088%KU955595.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome12401240100%0.088%KU955591.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds1240124064%0.0100%KU232295.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds12401240100%0.088%KF268949.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome12341234100%0.088%KU955592.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds1229122964%0.0100%KU232288.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds12291229100%0.088%KF383116.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds1227122799%0.088%AF013415.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds1225122563%0.0100%KU232289.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds12231223100%0.088%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds12231223100%0.088%KF383119.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds1221122163%0.0100%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds1216121664%0.099%KU232291.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds12121212100%0.088%HQ234501.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds12081208100%0.088%KF268950.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds12081208100%0.088%KF268948.1Select seq gb|KU724097.1|Zika virus isolate 259250_2015_Panama NS5B gene, partial cds1206120662%0.0100%KU724097.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds12011201100%0.087%KU963574.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds12011201100%0.088%KF383118.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds12011201100%0.087%HQ234500.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds11951195100%0.087%KF383117.1Select seq gb|KU724098.1|Zika virus isolate 259060_2015_Panama NS5B gene, partial cds1194119462%0.099%KU724098.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds11361136100%0.086%KF383115.1Select seq gb|KU724099.1|Zika virus isolate 259032_2015_Panama NS5B gene, partial cds1127112758%0.099%KU724099.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds99899852%0.099%KU867812.1Select seq gb|KU724100.1|Zika virus isolate 259043_2015_Panama NS5B gene, partial cds96596550%0.099%KU724100.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence865865100%0.082%KF383120.1Select seq gb|KF383103.1|Zika virus strain ArA986 nonstructural protein 5 gene, partial cds84684668%0.088%KF383103.1Select seq gb|KF383086.1|Zika virus strain ArA975 nonstructural protein 5 gene, partial cds84684668%0.088%KF383086.1Select seq gb|KX253994.1|Zika virus strain ZIKV/Homo sapiens/GER/GER-BNI-P2/2016 polyprotein gene, partial cds82682643%0.0100%KX253994.1Select seq gb|KF383104.1|Zika virus strain ArA982 nonstructural protein 5 gene, partial cds81381368%0.087%KF383104.1Select seq gb|KF383085.1|Zika virus strain ArD9957 nonstructural protein 5 gene, partial cds80880868%0.087%KF383085.1Select seq gb|KF383106.1|Zika virus strain ArA27443 nonstructural protein 5 gene, partial cds80280268%0.087%KF383106.1Select seq gb|KF383114.1|Zika virus strain AnD30332 nonstructural protein 5 gene, partial cds79779768%0.087%KF383114.1Select seq gb|KF383107.1|Zika virus strain ArA27407 nonstructural protein 5 gene, partial cds79779768%0.087%KF383107.1Select seq gb|KF383088.1|Zika virus strain ArD30101 nonstructural protein 5 gene, partial cds79779768%0.087%KF383088.1Select seq gb|KF383087.1|Zika virus strain ArD30156 nonstructural protein 5 gene, partial cds79179168%0.087%KF383087.1Select seq gb|KX101064.1|Zika virus isolate Bahia11, partial genome77895349%0.0100%KX101064.1Select seq gb|KF383089.1|Zika virus strain ArD165531 nonstructural protein 5 gene, partial cds77477468%0.086%KF383089.1Select seq gb|KF383101.1|Zika virus strain ArD127710 nonstructural protein 5 gene, partial cds76976968%0.086%KF383101.1Select seq gb|KF383097.1|Zika virus strain ArD127994 nonstructural protein 5 gene, partial cds76976968%0.086%KF383097.1Select seq gb|KF383099.1|Zika virus strain ArD127987 nonstructural protein 5 gene, partial cds76376368%0.086%KF383099.1Select seq gb|KF383098.1|Zika virus strain ArD127988 nonstructural protein 5 gene, partial cds75875868%0.086%KF383098.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome734155481%0.099%KX101061.1Select seq gb|KF383113.1|Zika virus strain ArA1465 nonstructural protein 5 gene, partial cds71971968%0.085%KF383113.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome71771737%0.099%KX101060.1Select seq gb|KX253995.1|Zika virus strain ZIKV/Homo sapiens/PRI/PRI-BNI-P1/2016 polyprotein gene, partial cds69769736%0.0100%KX253995.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome61098951%2e-17099%KX101066.1Select seq gb|KF383092.1|Zika virus strain ArD147917 nonstructural protein 5 gene, partial cds55555568%1e-15381%KF383092.1Select seq gb|KF383093.1|Zika virus strain ArD149810 nonstructural protein 5 gene, partial cds55355368%3e-15381%KF383093.1Select seq gb|KF383091.1|Zika virus strain ArD149938 nonstructural protein 5 gene, partial cds54254268%7e-15081%KF383091.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome499124365%5e-137100%KU940227.1Select seq gb|KX101067.1|Zika virus isolate Bahia12, partial genome48348325%5e-132100%KX101067.1Select seq gb|KF258813.1|Zika virus isolate Java non-structural protein 5 mRNA, partial cds45545524%1e-12398%KF258813.1Select seq gb|KU752544.1|Zika virus isolate PoHuZV469196 nonstructural protein 5 gene, partial cds37937919%6e-101100%KU752544.1Select seq gb|KU752545.1|Zika virus isolate PoHuZV472846 nonstructural protein 5 gene, partial cds37437419%3e-9999%KU752545.1Select seq gb|KX358623.1|Zika virus isolate AF01 nonstructural protein 5 gene, partial cds35335318%4e-93100%KX358623.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds31631698%5e-8273%DQ859064.1Select seq gb|AF013406.1|Spondweni virus strain SAAR-94 NS5 protein (NS5) gene, partial cds31131197%2e-8072%AF013406.1Select seq gb|KX101065.1|Zika virus isolate Bahia15, partial genome30356830%4e-78100%KX101065.1Select seq gb|JX041632.1|West Nile virus strain Ig2266, complete genome23123198%2e-5671%JX041632.1Select seq gb|GQ851604.1|West Nile virus strain G15578 polyprotein gene, complete cds23123198%2e-5671%GQ851604.1Select seq gb|GQ851605.1|West Nile virus strain G16146 polyprotein gene, complete cds22222298%1e-5371%GQ851605.1Select seq gb|DQ256376.1|West Nile virus strain 804994, complete genome21121198%2e-5071%DQ256376.1Select seq gb|KX101063.1|Zika virus isolate Bahia05, partial genome19635018%7e-46100%KX101063.1Select seq gb|KX101062.1|Zika virus isolate Bahia04, partial genome16523112%2e-3698%KX101062.1
  18. LOCUS KU886298 1039 bp RNA linear VRL 18-JUL-2016 DEFINITION Zika virus isolate MN NS5 gene, partial cds. ACCESSION KU886298 VERSION KU886298.1 GI:1004613915 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 1039) AUTHORS Fourcade,C., Mansuy,J.M., Dutertre,M., Delpech,M., Marchou,B., Delobel,P., Izopet,J. and Martin-Blondel,G. TITLE Viral load kinetics of Zika virus in plasma, urine and saliva in a couple returning from Martinique, French West Indies JOURNAL J. Clin. Virol. 82 (2016) In press PUBMED 27389909 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 1039) AUTHORS Fourcade,C., Mansuy,J.-M., Dutertre,M., Delpech,M., Marchou,B., Delobel,P., Izopet,J. and Martin-Blondel,G. TITLE Direct Submission JOURNAL Submitted (10-MAR-2016) Virology, CHU Toulouse, 330 avenue de Grande Bretagne, Toulouse 31300, France COMMENT ##Assembly-Data-START## Assembly Method :: Seqscape v. 2.5 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1039 /organism="Zika virus" /mol_type="genomic RNA" /isolate="MN" /host="Homo sapiens" /db_xref="taxon:64320" /country="France" /collection_date="15-Feb-2016" CDS <1..>1039 /note="nonstructural protein" /codon_start=1 /product="NS5" /protein_id="AMP44573.1" /db_xref="GI:1004613916" /translation="EKKQGEFGKAKGSRAIWYMWLGARFLEFEALGFLNEDHWMGREN SGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWDTRISRFDLENEALITNQMEKG HRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQDQRGSGQVVTYALNTFTNLVV QLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDRLKRMAVSGDDCVVKPIDDRFA HALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDE LIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRRDLRLMANAICSSVPVDWVPTG XTTWSIHGKGEW" ORIGIN 1 gaaaagaaac aaggggaatt tggaaaggcc aagggcagcc gcgccatctg gtatatgtgg 61 ctaggggcta gatttctaga gttcgaagcc cttggattct tgaacgagga tcactggatg 121 gggagagaga actcaggagg tggtgttgaa gggctgggat tacaaagact cggatatgtc 181 ctagaagaga tgagtcgcat accaggagga aggatgtatg cagatgacac tgctggctgg 241 gacacccgca tcagcaggtt tgatctggag aatgaagctc taatcaccaa ccaaatggag 301 aaagggcaca gggccttggc attggccata atcaagtaca cataccaaaa caaagtggta 361 aaggtcctta gaccagctga aaaagggaaa acagttatgg acattatttc gagacaagac 421 caaaggggga gcggacaagt tgtcacttac gctcttaaca catttaccaa cctagtggtg 481 caactcattc ggaatatgga ggctgaggaa gttctagaga tgcaagactt gtggctgctg 541 cggaggtcag agaaagtgac caactggttg cagagcaacg gatgggatag gctcaaacga 601 atggcagtca gtggagatga ttgcgttgtg aagccaattg atgataggtt tgcacatgcc 661 ctcaggttct tgaatgatat gggaaaagtt aggaaggaca cacaagagtg gaaaccctca 721 actggatggg acaactggga agaagttccg ttttgctccc accacttcaa caagctccat 781 ctcaaggacg ggaggtccat tgtggttccc tgccgccacc aagatgaact gattggccgg 841 gcccgcgtct ctccaggggc gggatggagc atccgggaga ctgcttgcct agcaaaatca 901 tatgcgcaaa tgtggcagct cctttatttc cacagaaggg acctccgact gatggccaat 961 gccatttgtt catctgtgcc agttgactgg gttccaactg ggaraactac ctggtcaatc 1021 catggaaagg gagaatgga
  19. Viral load kinetics of Zika virus in plasma, urine and saliva in a couple returning from Martinique, French West Indieshttp://www.journalofclinicalvirology.com/article/S1386-6532(16)30144-5/abstract
  20. Officials investigating possible case of non-travel-related Zika virus in Miami-Dade CountyWPTV Webteam7:33 PM, Jul 19, 201653 mins agoAutoplay:XDOH: Possible Non-Travel Related Zika Case WPTVSHOW CAPTIONMIAMI - The Florida Department of Health is investigating a possible non-travel-related case of Zika virus in Miami-Dade County. RELATED: More Zika coverage According to a news release, the department is conducting an epidemiological investigation in collaboration with the Centers for Disease Control. Zika prevention kits and repellant will be available for pickup at DOH-Miami-Dade and distributed in the area under investigation, the release said. Zika kits are intended for pregnant women. Mosquito control has already conducted reduction and prevention activities in the area of investigation. Residents and visitors are reminded that the best way to protect themselves is to prevent mosquito bites through practicing good drain and cover methods: DRAIN standing water to stop mosquitoes from multiplying • Drain water from garbage cans, house gutters, buckets, pool covers, coolers, toys, flower pots or any other containers where sprinkler or rain water has collected.• Discard old tires, drums, bottles, cans, pots and pans, broken appliances and other items that aren't being used.• Empty and clean birdbaths and pet's water bowls at least once or twice a week.• Protect boats and vehicles from rain with tarps that don’t accumulate water.• Maintain swimming pools in good condition and appropriately chlorinated. Empty plastic swimming pools when not in use. COVER skin with clothing or repellent • CLOTHING - Wear shoes, socks, long pants and long-sleeves. This type of protection may be necessary for people who must work in areas where mosquitoes are present.• REPELLENT - Apply mosquito repellent to bare skin and clothing.o Always use repellents according to the label. Repellents with DEET, picaridin, oil of lemon eucalyptus, and IR3535 are effective.o EPA-approved repellent is safe for pregnant women to use.o Use mosquito netting to protect children younger than 2 months old. COVER doors and windows with screens to keep mosquitoes out of your house • Repair broken screening on windows, doors, porches and patios. http://www.wptv.com/news/state/officials-investigating-new-possible-case-of-non-travel-related-zika-virus-in-miami-dade-county
  21. Florida Investigating Whether Zika Case Came From Local MosquitoIf confirmed, it could be the beginning of a U.S.-based outbreak. posted on Jul. 20, 2016, at 7:53 a.m.Virginia HughesBuzzFeed News Science EditorTweetTumblr Felipe Dana / AP On Tuesday evening, Florida health officials announced that they are investigating what could be the first case of Zika in the continental U.S. that did not come from people traveling to other regions affected by the virus. The officials did not say whether the new case, in Miami-Dade County, came from a mosquito bite or sexual transmission. (Miami-Dade has reported 88 other Zika casesthat have come from travelers.) If it’s confirmed to have come from a local mosquito, it could be the beginning of a U.S.-based outbreak. In February, after Zika had caused a mysterious cluster of brain defects in babies in Brazil, the WHO announced a global public health emergency. Now, with the Rio Olympics looming, many athletes have decided not to attend, despite the fact that the winter season in Brazil means that mosquitos will be curbed and the virus unlikely to spread widely there. Even if the Florida case means that local mosquitoes are indeed spreading Zika, U.S. health officials have predicted that the disease isn’t likely to be as problematic in the U.S. as it has been in other countries because of screened windows and air conditioning. Florida is working with the CDC to further understand the new case. https://www.buzzfeed.com/virginiahughes/florida-investigating-zika-case?bftw&utm_term=.xxBnl9KYJ#.jiyJk70yA
  22. Zika Investigated in Florida; Possible First Homegrown Case in U.S.By SABRINA TAVERNISEJULY 19, 2016 Continue reading the main storyShare This PageShareTweetEmailMoreThe Florida Department of Health said Tuesday that it was investigating what could be the first homegrown case of the Zika virus in the United States. The department said in a statement that it was investigating a “possible non-travel-related” case in Miami-Dade County. The department is “actively conducting an epidemiological investigation” and is collaborating with theCenters for Disease Control and Prevention, the statement said. No further details were available. It would be the first time the Zika virus had been transmitted locally by mosquitoes in the United States. There are about 1,300 cases of Zika in the continental United States; nearly all were contracted by a mosquito bite abroad or through sex with someone who had become infected in another country. The virus, which has spread rapidly in Latin America and the Caribbean, can cause birth defects and brain damage in babies born to women infected with it during pregnancy. The C.D.C. said in a statement that public health officials in Florida had confirmed the Zika infection through laboratory testing. The agency said it would conduct additional laboratory testing if the state asked for it. A version of this article appears in print on July 20, 2016, on page A17 of the New York edition with the headline: Florida Examines Possible First Case of Native Zika. Order Reprints| Today's Paper|Subscribe http://www.nytimes.com/2016/07/20/health/zika-virus-florida.html?smprod=nytcore-ipad&smid=nytcore-ipad-share&_r=0
  23. Authorities investigate possible case of zika contracted in Florida EPA / ERIK S. LESSER So far there is no evidence that mosquitoes have come to the continental United StatesHealth authorities in Florida, the US Southeast, announced that they are considering a probable case Zika who have been contracted locally and not through travel to one of the areas infected by the virus. Health services of Florida "are actively conducting an epidemiological investigation," according to a statement from the Health Department in Florida, released on Tuesday, after a possible case have arisen in Miami-Dade. So far there is no evidence that mosquitoes "aedes aegypti" vectors of Zika virus, have come to the continental United States, but health officials have warned that this possibility is imminent.The US territory of Puerto Rico recorded an increase in cases in recent months. The statement said also that 'kits' prevention of the virus as well as anti mosquito products will be available in health services and be distributed in the area under observation. "The 'kits' Zika are intended for pregnant women," said health services. The fight against mosquitoes service "has carried out reduction actions and prevention in the area concerned," explained the health department of Florida. In mid-July, US health officials had recorded 1,306 cases of Zikano continental United States and Hawaii. None of these cases resulted from a mosquito bite occurred in this area. Fourteen of these individuals were infected via sexual intercourse and another by accidental contact with a blood sample in the laboratory. The Zika virus can cause a variety of symptoms including skin rash, muscle and joint pain, but in most cases, the infection goes unnoticed. The World Health Organization (WHO) predicted a sharp growth of the outbreak in the Americas, with up to four million people infected. The virus spread rapidly in Latin America, with a large number of cases in Brazil. The Zika virus is present in 60 countries and Brazil is the country most affected by the current epidemic, with 1.5 million registered cases. The Zika is a virus transmitted by mosquitoes and there is no treatment or vaccine for the disease. On Tuesday, a Canadian university announced that it will conduct the first test in the world in humans a vaccine against the Zika virus. The vaccine that is being developed will be administered to human beings "in the coming days," according to a statement from the University of Laval, located in Quebec City, in the province of the same name. "We are very proud to be part of the first international team in the world to complete all stages of the regulatory process" of the vaccine, said Gary Kobinger, PhD in microbiology and professor of medicine at the university, which is overseeing the study. Kobinger stressed that the development of this vaccine Zika was authorized by regulatory agencies of the sector in Canada (Health Canada) and the United States (FDA). http://www.dn.pt/mundo/interior/autoridades-investigam-possivel-caso-de-zika-contraido-na-florida-5295323.html?utm_source=dlvr.it&utm_medium=twitter
  24. Florida is checking possible local case of Zika By Lena H. Sun July 19 at 9:00 PM Aaedes aegypti mosquitoes. (Ricardo Mazalan/AP)The Florida health department said late Tuesday that it is investigating what could be the first case of locally spread Zika virus in the continental United States. In a brief statement, the department said it is "actively conducting an epidemiological investigation" of a non-travel-related case in Miami-Dade County in collaboration with the Centers for Disease Control and Prevention. The statement said additional details would be shared as they become available. The CDC said the state is the lead on the case, which involves someone with no travel history to a country with active Zika transmission. Florida public health officials have confirmed Zika infection through laboratory testing. Florida, Texas and other parts of the Gulf Coast are considered at highest risk of local transmission of the mosquito-borne virus. The region is home to the Aedes aegypti mosquito, the primary vector for transmitting Zika. Florida has also had local cases of dengue and chikungunya, related viruses that are spread by the same mosquito species. Florida already has 326 travel-related Zika cases, including 88 in Miami-Dade, the most in the state. None of the 1,306 cases of Zika that have been reported so far in the continental United States and Hawaii have been the result of local mosquitoes. But health officials have been bracing for local transmission of Zika across the South and parts of the Southwest during the peak summer months. Florida Gov. Rick Scott (R) has repeatedly appealed to the Obama administration for additional resources so his state could be prepared when cases began to surface. In a statement late Tuesday, the CDC said it has provided Florida more than $2 million in Zika-specific funding and about $27 million in emergency preparedness funding that can be used toward Zika response efforts. The virus can also be spread through sexual contact, but the health department statement did not specify how the individual involved was believed to have been infected. "We're looking into all non-travel related transmission at this point," said Mara Gambineri, a health department spokeswoman. The Zika virus, explained Play Video3:07 Everything you ever wanted to know about the Zika virus and its spread across North and South America. (Daron Taylor, Claritza Jimenez/The Washington Post)The statement said the department would be providing Zika prevention kits and repellent in the county and in the area of investigation. Congress left town last week without finalizing legislation to combat the virus, much to the dismay of public health officials, infectious disease experts and children's advocates. Health officials have warned that the $589 million the Obama administration redirected from fighting Ebola to combating Zika this year is insufficient and that lawmakers' failure to approve new funding is holding up work on a vaccine, improved diagnostics to test for Zika and research on the long-term consequences of the virus during pregnancy. CONTENT FROM ALLSTATEBalancing actWhy millennials are taking their time reaching financial milestonesHealth and Human Services Secretary Sylvia Burwell and Office of Management and Budget Director Shaun Donovan wrote Republican leaders last week saying that the inaction on a Zika package "will significantly impede the Administration’s ability to prepare for and respond to a possible local transmission in the United States and Hawaii and address a growing health crisis in Puerto Rico.” The Florida news comes one day after Utah officials said they were investigating possible person-to-person transmission from an elderly man to a caregiver. Most people infected with Zika have no symptoms or only mild ones. But the virus can cause severe birth defects in pregnant women, including microcephaly, a rare condition characterized by an abnormally small head and serious brain damage. https://www.washingtonpost.com/news/to-your-health/wp/2016/07/19/florida-is-checking-possible-local-case-of-zika/?postshare=3711469012060283&tid=ss_tw-bottom
  25. Florida investigates possible first case of indigenous zikaSource: EFE 20/07/2016 6:01 a.m. agenciesAddThis Sharing ButtonsThe Government of Florida (USA) discussed on Wednesday a possible first case of indigenous zika in the state, which so far have been reported 326 patients with the virus, including 43 pregnant women. The infected person under investigation corresponds to Miami-Dade county where has been detected most cases, with 88 in total until today, the Florida Department of Health reported. The state agency said that works in conjunction with the Centers for Disease Control and Prevention (CDC in English) in the epidemiological investigation. The other most affected counties in Florida, where state have so far been presented only cases infected people who traveled abroad, are Broward, with 50 infected and Orange, with 33. Last week the CDC reported the first documented case of sexual transmission of zika of a woman to a man, who until now had only checked in the opposite direction. The case, registered in New York (USA), extends the risk of sexual transmission so far known to zika virus. On the other hand, the CDC recommends that pregnant women not to travel to affected areas because of the risk that in case of infection, the fetus will develop serious complications, such as microcephaly. Also advise travelers returning to the United States from an area with presence of zika, and although they have not experienced symptoms of the disease, to take measures to prevent mosquito bites for 3 weeks, not spread the virus by this track. Zika virus is mainly transmitted through the bite of infected Aedes aegypti mosquito, although contagion has also proven through body fluids such as urine, blood, semen and amniotic fluid. http://globovision.com/article/florida-investiga-posible-primer-caso-de-zika-autoctono

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.