niman Posted June 11, 2016 Report Share Posted June 11, 2016 (edited) Volume 22, Number 8—August 2016LetterFebrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panamahttp://wwwnc.cdc.gov/eid/article/22/8/16-0292_article Edited June 11, 2016 by niman Link to comment Share on other sites More sharing options...
niman Posted June 11, 2016 Author Report Share Posted June 11, 2016 (edited) Dimelza Araúz1, Luis De Urriola1, José Jones, Marlene Castillo, Alexander Martínez, Edison Murillo, Leonidas Troncoso, María Chen, Leyda Abrego, Blas Armién, Juan M. Pascale, Néstor Sosa, Sandra López-Verges, and Brechla Moreno Author affiliations: Gorgas Memorial Institute for Health Studies, Panama City, Panama (D. Araúz, M. Castillo, M. Chen, L. Abrego, S. López-Verges, B. Moreno, A. Martinez, B. Armién, J.M. Pascale, N. Sosa); Panama Ministry of Health Department of Epidemiology, Guna Yala, Panama (L. De Urriola); Health Center Guna Yala, Guna Yala (J. Jones, E. Murillo, L. Troncoso) AcknowledgmentsWe thank the personnel of the Panama Ministry of Health for help with the epidemiologic surveillance program, all the personnel of the Gorgas Memorial Institute for Health Studies Department of Research in Virology and Biotechnology for continuous technical support, and Publio González for his assistance with the maps and graphics.This study was supported by the Gorgas Memorial Institute for Health Studies Department of Research in Virology and Biotechnology and by project 09.044.051 from the Panama Ministry of Economy and Finance (S.L.V.). A.M., B.A., J.M.P., and S.L.V. are members of Sistema Nacional de Investigación (SNI) of the Secretaría Nacional de Ciencia, Tecnología, e Innovación (SENACYT) in Panama. Edited June 11, 2016 by niman Link to comment Share on other sites More sharing options...
niman Posted June 11, 2016 Author Report Share Posted June 11, 2016 To the Editor: The earliest clinical cases of Zika virus infection were reported from continental South America in 2015 (1), after which the virus spread rapidly through the Americas (2). Here we describe an investigation of febrile or exanthematous illnesses for possible association with Zika, dengue, or chikungunya virus; these illnesses occurred in the Guna Yala region of eastern Panama, which borders northern Colombia (Figure).We collected and analyzed a convenience sample of 276 serum samples and 26 paired urine samples from 276 patients who sought care at clinics in Guna Yala during November 27, 2015–January 22, 2016, for reported fever or rash of <5 days’ duration in addition to 1 of the following: headache, malaise, arthralgia, myalgia, or conjunctivitis. We also collected data on clinical signs and symptoms, date of illness onset, age, sex, residence, and self-reported status of pregnancy.At first, we performed real-time reverse transcription PCR (rRT-PCR) tests specific for dengue (3) and chikungunya (4) viruses. However, because all the samples received during the week of November 27 were negative for those viruses and Zika virus was being reported in Colombia as of October 2015, we also tested the samples with a flavivirus-specific rRT-PCR (5), followed by amplicon sequencing; or with an rRT-PCR specific for Zika virus (6).Of the 276 patients whose samples were tested, 164 (60%) were female. A total of 22 (8%) samples were positive for dengue; 2 were positive for chikungunya. Of the remaining 252 patients, 50 (20%) had >1 sample that tested positive for Zika virus (50/252 serum samples, 4/26 paired urine samples). Of these 50 patients, 30 (60%) were female. Most of these patients reported illness onset during December 9–27, 2015 (Technical Appendix[PDF - 241 KB - 3 pages] Figure 1). Zika virus infection affected all age groups (median age 35 y, range 0.1–80 y).The most commonly reported signs and symptoms were fever (86%), exanthema (72%), and headache (62%). The clinical characteristics of these infections showed no statistically significant difference with those associated with dengue and chikungunya virus infections and with cases found to be negative for all 3 viruses, suggesting that the negative cases could represent Zika virus infections (Technical Appendix[PDF - 241 KB - 3 pages] Table). One of the patients with confirmed Zika virus infection reported being in her second trimester of pregnancy; she underwent a fetal ultrasound at 36 weeks’ gestation, which was interpreted as normal, and the infant was found to have no neurologic defects at birth.By using Vero E6 cells (American Type Culture Collection), we isolated Zika virus from 9 samples (8 serum, 1 urine). Phylogenetic analysis of 5 Zika virus sequences (a 428-nucleotide fragment encompassing a conserved region of the nonstructural protein 5 gene) placed these isolated (GenBank accession nos. KU724096–100) within the Asian lineage, the lineage involved in the spread of Zika virus in the Americas (Technical Appendix[PDF - 241 KB - 3 pages] Figure 2) (2,7).By using molecular methods, we confirmed diagnoses in 27% of patients during this outbreak. The distribution of positive results suggests that Zika virus was the predominant etiologic virus in this cohort, but we cannot firmly conclude this because most specimens tested negative for Zika, dengue, and chikungunya viruses.Although results from patient sampling and laboratory testing are not comparable, an assessment in Puerto Rico was able to detect Zika virus RNA by rRT-PCR or IgM by ELISA in 19% of 155 patients with suspected Zika virus infection (8). Despite the addition of IgM testing, most of the patients whose specimens were tested by rRT-PCR were negative for dengue and Zika viruses.Several reasons might exist for the high proportion of specimens testing negative for Zika virus. Viremia is often low and short-lived in persons infected with Zika virus (7); the PCR test might not be sensitive enough; some patients with Zika virus infection may have sought care after the virus had been cleared from the blood and urine; our diagnostic capacity was limited by the lack of reliable serologic tests for Zika virus; and we did not test for other viral, bacterial, or parasitic causes of fever or rash illness.The Panama Ministry of Health is following up with known pregnant women of the Guna Yala region who report Zika virus infection symptoms and is testing urine samples by using Zika virus–specific rRT-PCR within 14 days of symptom onset. Pregnant women confirmed to have Zika virus infection will receive ultrasound monitoring; however, the test has relatively low positive predictive value for detecting microcephaly (9). In Guna Yala, no symptoms of Guillain-Barré syndrome or other neurologic conditions have been detected; however, since January 2016, Zika virus has spread to other regions of Panama, and at least 1 case of Guillain-Barré syndrome has been reported (10). Our experience shows the challenge of diagnosing the causes of fever or rash by using only molecular methods, underscoring the need for diagnostic tools that are rapid and inexpensive but more sensitive and specific. Link to comment Share on other sites More sharing options...
niman Posted June 11, 2016 Author Report Share Posted June 11, 2016 FigureFigure. Locations in the Guna Yala region of eastern Panama with confirmed cases of Zika virus infection during November 27, 2015–January 22, 2016. Inset maps show locations of Guna Yala in Panama and of Panama in the Americas. Link to comment Share on other sites More sharing options...
niman Posted June 11, 2016 Author Report Share Posted June 11, 2016 Link to comment Share on other sites More sharing options...
niman Posted June 11, 2016 Author Report Share Posted June 11, 2016 (edited) GenBank accession nos. KU724096–100http://www.ncbi.nlm.nih.gov/nuccore/KU724096GenBank: 998178886This record has not yet been released. Please contact [email protected] with the publication details if the accession has been published. Edited June 11, 2016 by niman Link to comment Share on other sites More sharing options...
niman Posted June 11, 2016 Author Report Share Posted June 11, 2016 ReferencesZanluca C, Melo VC, Mosimann ALP, Santos GI, Santos CN, Luz K. First report of autochthonous transmission of Zika virus in Brazil. Mem Inst Oswaldo Cruz. 2015;110:569–72. DOIPubMedHennessey M, Fischer M, Staples JE. Zika virus spreads to new areas—region of the Americas, May 2015–January 2016. MMWR Morb Mortal Wkly Rep. 2016;65:55–8. DOIPubMedLanciotti RS, Calisher CH, Gubler DJ, Chang GJ, Vorndam AV. Rapid detection and typing of dengue viruses from clinical samples by using reverse transcriptase-polymerase chain reaction. J Clin Microbiol. 1992;30:545–51.PubMedLanciotti RS, Kosoy OL, Laven JJ, Panella AJ, Velez JO, Lambert AJ, Chikungunya virus in US travelers returning from India, 2006. Emerg Infect Dis. 2007;13:764–7. DOIPubMedAyers M, Adachi D, Johnson G, Andonova M, Drebot M, Tellier R. A single tube RT-PCR assay for the detection of mosquito-borne flaviviruses. J Virol Methods. 2006;135:235–9. DOIPubMedLanciotti RS, Kosoy OL, Laven JJ, Velez JO, Lambert AJ, Johnson AJ, Genetic and serologic properties of Zika virus associated with an epidemic, Yap State, Micronesia, 2007. Emerg Infect Dis. 2008;14:1232–9. DOIPubMedLanciotti RS, Lambert AJ, Holodniy M, Saavedra S, Signor LD. Phylogeny of Zika virus in Western Hemisphere, 2015.Emerg Infect Dis. 2016;22:933–5. DOIPubMedThomas DL, Sharp TM, Torres J, Armstrong PA, Munoz-Jordan J, Ryff KR, Local transmission of Zika virus—Puerto Rico, November 23, 2015–January 28, 2016. MMWR Morb Mortal Wkly Rep. 2016;65:154–8. DOIPubMedLeibovitz Z, Daniel-Spiegel E, Malinger G, Haratz K, Tamarkin M, Gindes L, Microcephaly at birth—the accuracy of three references for fetal head circumference. How can we improve prediction? Ultrasound Obstet Gynecol.2015;2:23.PubMedWorld Health Organization. Guillain-Barré syndrome—Panama [cited 2016 Mar 29]. http://www.who.int/csr/don/29-march-2016-gbs-panama/en/ Link to comment Share on other sites More sharing options...
niman Posted June 12, 2016 Author Report Share Posted June 12, 2016 GenBank accession nos. KU724096–100http://www.ncbi.nlm.nih.gov/nuccore/KU724096GenBank: 998178886This record has not yet been released. Please contact [email protected] with the publication details if the accession has been published.LOCUS KU724096 726 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259249_2015_Panama NS5B gene, partial cds. ACCESSION KU724096 VERSION KU724096.1 GI:998178886 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 726) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 726) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..726 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259249_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="11-Dec-2015" CDS <1..>726 /codon_start=1 /product="NS5B" /protein_id="AMK26952.1" /db_xref="GI:998178887" /translation="ISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAE KGKTVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEK VTNWLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGW DNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSY AQMWQLLYFHRRDLRLMANAICSS" ORIGIN 1 attagcaggt ttgatctgga gaatgaagct ctaatcacca accaaatgga gaaagggcac 61 agggccttgg cattggccat aatcaagtac acataccaaa acaaagtggt aaaggtcctt 121 agaccagctg aaaaagggaa aacagttatg gacattattt cgagacaaga ccaaaggggg 181 agcggacaag ttgtcactta cgctcttaac acatttacca acctagtggt gcaactcatt 241 cggaatatgg aggctgagga agttctagag atgcaagact tgtggctgct gcggaggtca 301 gagaaagtga ccaactggtt gcagagcaac ggatgggata ggctcaaacg aatggcagtc 361 agtggagatg attgcgttgt gaagccaatt gatgataggt ttgcacatgc cctcaggttc 421 ttgaatgata tgggaaaagt taggaaggac acacaagagt ggaaaccctc aactggatgg 481 gacaactggg aagaagttcc gttttgctcc caccacttca acaagctcca tctcaaggac 541 gggaggtcca ttgtggttcc ctgccgccac caagatgaac tgattggccg ggcccgcgtc 601 tctccagggg cgggatggag catccgggag actgcttgcc tagcaaaatc atatgcgcaa 661 atgtggcagc tcctttattt ccacagaagg gacctccgac tgatggccaa tgccatttgt 721 tcatct Link to comment Share on other sites More sharing options...
niman Posted June 12, 2016 Author Report Share Posted June 12, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU758877.1|Zika virus isolate 17271 polyprotein gene, complete cds13101310100%0.0100%KU758877.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome13101310100%0.0100%KX247646.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds13101310100%0.0100%KU820897.2Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome13101310100%0.0100%KX087101.2Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds13101310100%0.0100%KU937936.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome13101310100%0.0100%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome13101310100%0.0100%KX156775.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome13101310100%0.0100%KX156774.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome13101310100%0.0100%KX087102.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome13101310100%0.0100%KU501215.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome13051305100%0.099%KX262887.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds13051305100%0.099%KX247632.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome13051305100%0.099%KX198135.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds13051305100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds13051305100%0.099%KU955590.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome13051305100%0.099%KU870645.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome13051305100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome13051305100%0.099%KU922923.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds13051305100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds13051305100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds13051305100%0.099%KU761564.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome13051305100%0.099%KU497555.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds13051305100%0.099%KU647676.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds13051305100%0.099%KU312312.1Select seq gb|KX280026.1|Zika virus isolate Paraiba_01, complete genome13011301100%0.099%KX280026.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome13011301100%0.099%KX197192.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds13011301100%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds13011301100%0.099%KX059013.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome13011301100%0.099%KX051563.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome13011301100%0.099%KU509998.3Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds13011301100%0.099%KU991811.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome13011301100%0.099%KU926310.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome13011301100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome13011301100%0.099%KU853012.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds13011301100%0.099%KU729217.2Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome13011301100%0.099%KU707826.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds13011301100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds13011301100%0.099%KU501216.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds13011301100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds13011301100%0.099%KU365779.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds13011301100%0.099%KU365778.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds13011301100%0.099%KU365777.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome13011301100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds13011301100%0.099%KM078936.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds13011301100%0.099%KJ873160.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds13011301100%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds12971297100%0.099%KM078961.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome12961296100%0.099%KU926309.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome12961296100%0.099%KU527068.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds12961296100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds12941294100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds12941294100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds12941294100%0.099%KM078933.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome12921292100%0.099%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome12921292100%0.099%KU940224.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds12921292100%0.099%KU729218.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds12921292100%0.099%KM078929.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome12831283100%0.099%KX117076.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome12781278100%0.099%KX253996.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds12781278100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds12781278100%0.099%KU963796.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds12781278100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome12781278100%0.099%KU820899.2Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome12781278100%0.099%KU744693.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds12741274100%0.099%KU179098.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds12741274100%0.099%KF993678.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome12691269100%0.099%KU681081.3Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds12691269100%0.099%KM851039.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds12601260100%0.098%KU866423.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome12511251100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds12511251100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds12511251100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome12381238100%0.098%KU681082.3Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds12381238100%0.098%KM851038.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1227122794%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds11301130100%0.094%HQ234499.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds1059105981%0.099%KU985087.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1043104380%0.099%KU556802.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds95595599%0.089%KF268949.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds95195199%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome95195199%0.089%KU955594.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds95195199%0.089%KU720415.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID95195199%0.089%LC002520.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds95195199%0.089%KF383118.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds95195199%0.089%HQ234498.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome95195199%0.089%AY632535.2Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds95195199%0.089%AF013415.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds94694699%0.089%KU963574.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds94694699%0.089%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds94694699%0.089%KF383119.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds94694699%0.089%HQ234500.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds94294272%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds94094072%0.099%KU232290.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome93793799%0.089%KX198134.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome93393399%0.089%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome93393399%0.089%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome93393399%0.089%KU955591.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds93393399%0.089%DQ859059.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds93193172%0.099%KU232297.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds92692671%0.099%KU232298.1 Link to comment Share on other sites More sharing options...
niman Posted June 12, 2016 Author Report Share Posted June 12, 2016 Sequence Map updatehttps://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU Link to comment Share on other sites More sharing options...
niman Posted June 12, 2016 Author Report Share Posted June 12, 2016 LOCUS KU724097 653 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259250_2015_Panama NS5B gene, partial cds. ACCESSION KU724097 VERSION KU724097.1 GI:998178888 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 653) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 653) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..653 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259250_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="11-Dec-2015" Link to comment Share on other sites More sharing options...
niman Posted June 12, 2016 Author Report Share Posted June 12, 2016 Sequence Map Updatehttps://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU Link to comment Share on other sites More sharing options...
niman Posted June 12, 2016 Author Report Share Posted June 12, 2016 LOCUS KU724098 648 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259060_2015_Panama NS5B gene, partial cds. ACCESSION KU724098 VERSION KU724098.1 GI:998178890 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 648) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 648) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..648 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259060_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="29-Nov-2015" Link to comment Share on other sites More sharing options...
niman Posted June 12, 2016 Author Report Share Posted June 12, 2016 Sequence Map Updatehttps://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU Link to comment Share on other sites More sharing options...
niman Posted June 12, 2016 Author Report Share Posted June 12, 2016 LOCUS KU724099 612 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259032_2015_Panama NS5B gene, partial cds. ACCESSION KU724099 VERSION KU724099.1 GI:998178892 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 612) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 612) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..612 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259032_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="29-Nov-2015" Link to comment Share on other sites More sharing options...
niman Posted June 12, 2016 Author Report Share Posted June 12, 2016 Sequence Map Updatehttps://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU Link to comment Share on other sites More sharing options...
niman Posted June 12, 2016 Author Report Share Posted June 12, 2016 LOCUS KU724100 528 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259043_2015_Panama NS5B gene, partial cds. ACCESSION KU724100 VERSION KU724100.1 GI:998178894 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 528) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 528) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..528 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259043_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="29-Nov-2015" Link to comment Share on other sites More sharing options...
niman Posted June 12, 2016 Author Report Share Posted June 12, 2016 Sequence Map Updatehttps://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU Link to comment Share on other sites More sharing options...
niman Posted June 13, 2016 Author Report Share Posted June 13, 2016 1.Zika virus isolate 259249_2015_Panama NS5B gene, partial cds726 bp linear RNAAccession: KU724096.1 GI: 998178886GenBankFASTAGraphicsSelect item 9981788882.Zika virus isolate 259250_2015_Panama NS5B gene, partial cds653 bp linear RNAAccession: KU724097.1 GI: 998178888GenBankFASTAGraphicsSelect item 9981788903.Zika virus isolate 259060_2015_Panama NS5B gene, partial cds648 bp linear RNAAccession: KU724098.1 GI: 998178890GenBankFASTAGraphicsSelect item 9981788924.Zika virus isolate 259032_2015_Panama NS5B gene, partial cds612 bp linear RNAAccession: KU724099.1 GI: 998178892GenBankFASTAGraphicsSelect item 9981788945.Zika virus isolate 259043_2015_Panama NS5B gene, partial cds528 bp linear RNAAccession: KU724100.1 GI: 998178894GenBankFASTAGraphics Link to comment Share on other sites More sharing options...
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now