Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

2016 Philippines Zika Related To 2012 Philippines Sequence

Featured Replies

  • Author
LOCUS       KY003152                1862 bp    RNA     linear   VRL 25-OCT-2016
DEFINITION  Zika virus isolate ZIKV/Homo sapiens/PHL/2016/ZK16-0128 envelope
            protein E gene, partial cds.
ACCESSION   KY003152
VERSION     KY003152.1
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 1862)
  AUTHORS   Foronda,J.L.M. and Sy,A.K.D.
  TITLE     Zika outbreak in the Philippines, 2016
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1862)
  AUTHORS   Foronda,J.L.M. and Sy,A.K.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-OCT-2016) Virology, Research Institute for Tropical
            Medicine, 9002 Research Drive, Filinvest Corporate City, Alabang,
            Muntinlupa City, Metro Manila 1781, Philippines
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1862
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="ZIKV/Homo sapiens/PHL/2016/ZK16-0128"
                     /isolation_source="urine"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Philippines: Iloilo City"
                     /collection_date="01-Sep-2016"
     CDS             <1..>1862
                     /codon_start=1
                     /product="envelope protein E"
                     /protein_id="AOX24134.1"
                     /translation="GTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQTWLESREYTKHL
                     IRVENWIFRNPGFALAAAAIAWLLGSSTSQKVIYLVMILLIAPAYSIRCIGVSNRDFV
                     EGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMAS
                     DSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGK
                     SIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSL
                     GLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVE
                     FKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKG
                     VSYSLCAAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLIT
                     ANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGA
                     KRMAVLGDTAWDFGSVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQILIGTLLVWLG
                     LNTKNGSISLACLALGGVLIFLSTAVSADVGCSVDFSKKETRCGTGVFVYNDVEA"
ORIGIN      
        1 ggaacctgcc accacaaaaa aggtgaagca cggagatcta gaagagctgt gacgctcccc
       61 tcccattcca ctaggaagct gcaaacgcgg tcgcagacct ggttggaatc aagagaatac
      121 acaaagcacc tgattagagt cgagaattgg atattcagga accccggctt cgcgttagca
      181 gcagctgcca tcgcttggct tttgggaagt tcaacgagcc aaaaagtcat atatttggtc
      241 atgatactgc tgattgcccc ggcatacagc atcaggtgca taggagtcag caatagggac
      301 tttgtggaag gtatgtcagg tgggacttgg gttgatgttg tcttggaaca tggaggctgt
      361 gttaccgtaa tggcacagga caaaccgact gtcgacatag agctggttac aacaacagtt
      421 agcaacatgg cggaggtaag atcctactgc tatgaggcat caatatcgga tatggcttcg
      481 gacagccgct gcccaacaca aggtgaggcc taccttgaca agcagtcaga cactcaatat
      541 gtctgcaaaa gaacgttagt ggatagaggc tggggaaatg gatgtggact ttttggaaaa
      601 gggagcctgg tgacatgcgc taagtttgca tgctccaaga aaatgaccgg gaagagcatc
      661 cagccagaga acctggagta ccggataatg ctgtcagttc atggctccca gcacagtggg
      721 atgatcgtta atgacacagg acatgaaact gatgagaata gagcgaaggt tgagataacg
      781 cccaattcac caagagccga agccaccctg gggggttttg gaagcctagg acttgattgt
      841 gaaccgagga caggccttga cttttcagat ttgtattacc tgactatgaa taacaagcac
      901 tggttggttc acaaggagtg gttccacgac attccattac cttggcatgc tggggcagac
      961 actggaactc cacattggaa caacaaagaa gcactggtag agttcaagga cgcacatgcc
     1021 aaaaggcaaa ctgtcgtggt tctagggagt caagaaggag cagttcacac ggcccttgct
     1081 ggagctctgg aggctgagat ggatggtgca aagggaaggc tgtcctctgg ccacttgaaa
     1141 tgtcgcctga aaatggataa actcagattg aagggtgtgt catactcctt gtgtgctgca
     1201 gcgttcacat tcaccaagat cccggctgaa acactgcacg ggacagtcac agtggaggta
     1261 cagtacgcag ggacagatgg accttgcaag gttccagctc agatggcggt ggatatgcaa
     1321 actctgaccc cagttgggag gttgataacc gctaaccctg taatcactga aagcaccgag
     1381 aactctaaga tgatgctgga acttgatcca ccatttgggg actcttacat tgtcatagga
     1441 gtcggggaga agaagatcac ccaccactgg cacaggagtg gcagcaccat tggaaaagca
     1501 tttgaagcca ctgtgagagg tgccaagaga atggcagtct tgggagacac agcctgggac
     1561 tttggatcag ttggaggtgc tctcaactca ttgggcaagg gcatccatca aatttttgga
     1621 gcagctttca aatcattgtt tggaggaatg tcctggttct cacaaattct catcggaacg
     1681 ttgctggtgt ggttgggtct gaatacaaag aatggatcta tttcccttgc atgcttggct
     1741 ttagggggag tgttgatctt cttatccaca gccgtctctg ctgatgtggg gtgctcggtg
     1801 gacttctcaa agaaggaaac gagatgcggt acaggggtgt tcgtctataa cgacgttgaa
     1861 gc
  • Author
Sequences producing significant alignments:

Select:AllNone Selected:0

Sequences producing significant alignments:
Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession
3241 3241 100% 0.0 99% KU681082.3
3200 3200 100% 0.0 98% EU545988.1
3196 3196 100% 0.0 98% KX447521.1
3196 3196 100% 0.0 98% KX447517.1
3196 3196 100% 0.0 98% KX447509.1
3196 3196 100% 0.0 98% KU955593.1
3196 3196 100% 0.0 98% JN860885.1
3191 3191 100% 0.0 98% KJ776791.2
3191 3191 100% 0.0 98% KX447520.1
3191 3191 100% 0.0 98% KX447519.1
3191 3191 100% 0.0 98% KX447518.1
3191 3191 100% 0.0 98% KX447516.1
3191 3191 100% 0.0 98% KX447513.1
3191 3191 100% 0.0 98% KX447510.1
3191 3191 100% 0.0 98% KU758877.1
3191 3191 100% 0.0 98% KU758871.1
3191 3191 100% 0.0 98% KU758870.1
3191 3191 100% 0.0 98% KX262887.1
3191 3191 100% 0.0 98% KU870645.1
3189 3189 100% 0.0 98% KY014315.1
3187 3187 100% 0.0 98% KX856011.1
3187 3187 100% 0.0 98% KX694534.1
3187 3187 100% 0.0 98% KX447515.1
3187 3187 100% 0.0 98% KX447514.1
3187 3187 100% 0.0 98% KU758873.1
3187 3187 100% 0.0 98% KX247632.1
3187 3187 100% 0.0 98% KU937936.1
3187 3187 100% 0.0 98% KX051563.1
3187 3187 100% 0.0 98% KU509998.3
3187 3187 100% 0.0 98% KU365778.1
3187 3187 100% 0.0 98% KU312314.1
3182 3182 100% 0.0 98% KY014317.1
3182 3182 100% 0.0 98% KY014306.1
3182 3182 100% 0.0 98% KY014301.1
3182 3182 100% 0.0 98% KX806557.2
3182 3182 100% 0.0 98% KX879604.1
3182 3182 100% 0.0 98% KX197205.1
3182 3182 100% 0.0 98% KX447511.1
3182 3182 100% 0.0 98% KX576684.1
3182 3182 100% 0.0 98% KX369547.1
3182 3182 100% 0.0 98% KX446951.1
3182 3182 100% 0.0 98% KU758868.1
3182 3182 100% 0.0 98% KX280026.1
3182 3182 100% 0.0 98% KX197192.1
3182 3182 100% 0.0 98% KU729218.1
3182 3182 100% 0.0 98% KU707826.1
3182 3182 100% 0.0 98% KU527068.1
3182 3182 100% 0.0 98% KU365779.1
3182 3182 100% 0.0 98% KU321639.1
3180 3180 100% 0.0 98% KY014310.1
3180 3180 99% 0.0 98% KY014307.1
3180 3180 100% 0.0 98% KY014297.1
3180 3180 100% 0.0 98% KX766028.1
3178 3178 100% 0.0 98% KY014327.1
3178 3178 100% 0.0 98% KY014319.1
3178 3178 100% 0.0 98% KY014304.1
3178 3178 100% 0.0 98% KX922707.1
3178 3178 100% 0.0 98% KX879603.1
3178 3178 100% 0.0 98% KX766029.1
3178 3178 100% 0.0 98% KX447512.1
3178 3178 100% 0.0 98% KX266255.1
3178 3178 100% 0.0 98% KX446950.1
3178 3178 100% 0.0 98% KX377337.1
3178 3178 100% 0.0 98% KU866423.2
3178 3178 100% 0.0 98% KU758872.1
3178 3178 100% 0.0 98% KU758869.1
3178 3178 100% 0.0 98% KX253996.1
3178 3178 100% 0.0 98% KX185891.1
3178 3178 100% 0.0 98% KX117076.1
3178 3178 100% 0.0 98% KU963796.1
3178 3178 100% 0.0 98% KU991811.1
3178 3178 100% 0.0 98% KU940228.1
3178 3178 100% 0.0 98% KU955589.1
3178 3178 100% 0.0 98% KU820899.2
3178 3178 100% 0.0 98% KU501217.1
3178 3178 100% 0.0 98% KU501216.1
3178 3178 100% 0.0 98% KU501215.1
3178 3178 100% 0.0 98% KU365780.1
3178 3178 100% 0.0 98% KU365777.1
3177 3177 100% 0.0 98% KY014309.1
3173 3173 100% 0.0 98% KY014321.1
3173 3173 100% 0.0 98% KY014316.1
3173 3173 100% 0.0 98% KY014300.1
3173 3173 100% 0.0 98% LC190723.1
3173 3173 100% 0.0 98% KX811222.1
3173 3173 100% 0.0 98% KX601168.1
3173 3173 100% 0.0 98% KX520666.1
3173 3173 100% 0.0 98% KU758876.1
3173 3173 100% 0.0 98% KU758875.1
3173 3173 100% 0.0 98% KX087101.2
3173 3173 100% 0.0 98% KU926309.1
3173 3173 100% 0.0 98% KU853013.1
3173 3173 100% 0.0 98% KU853012.1
3173 3173 100% 0.0 98% KU681081.3
3173 3173 100% 0.0 98% KU497555.1
3169 3169 100% 0.0 98% KY014326.1
3169 3169 100% 0.0 98% KY014324.1
3169 3169 100% 0.0 98% KY014323.1
3169 3169 100% 0.0 98% KY014322.1
3169 3169 100% 0.0 98% KY014298.1

Please sign in to comment

You will be able to leave a comment after signing in

Sign In Now

Recently Browsing 0

  • No registered users viewing this page.

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.