Jump to content

Mallard Alaska H5N2 Sequence At Genbank


niman

Recommended Posts

LOCUS       KX838899                1744 bp    cRNA    linear   VRL 08-OCT-2016
DEFINITION  Influenza A virus (A/mallard/Alaska/AH0088535/2016(H5N2)) segment 4
            hemagglutinin (HA) gene, complete cds.
ACCESSION   KX838899
VERSION     KX838899.1
KEYWORDS    .
SOURCE      Influenza A virus (A/mallard/Alaska/AH0088535/2016(H5N2))
  ORGANISM  Influenza A virus (A/mallard/Alaska/AH0088535/2016(H5N2))
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Orthomyxoviridae; Influenzavirus A.
REFERENCE   1  (bases 1 to 1744)
  AUTHORS   Killian,M.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-SEP-2016) Diagnostic Virology Laboratory, National
            Veterinary Services Laboratories (NVSL), USDA APHIS VS, 1920 Dayton
            Avenue, Ames, IA 50010, USA
COMMENT     GenBank Accession Numbers KX838896-KX838903 represent sequences
            from the 8 segments of Influenza A virus
            (A/mallard/Alaska/AH0088535/2016(H5N2)).
            
            ##Assembly-Data-START##
            Assembly Method       :: SeqMan NGen v. 12
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1744
                     /organism="Influenza A virus
                     (A/mallard/Alaska/AH0088535/2016(H5N2))"
                     /mol_type="viral cRNA"
                     /strain="A/mallard/Alaska/AH0088535/2016"
                     /serotype="H5N2"
                     /isolation_source="oropharyngeal/cloacal swab pool from
                     individual bird"
                     /host="mallard; live bird surveillance"
                     /db_xref="taxon:1899328"
                     /segment="4"
                     /country="USA: Alaska, Fairbanks North Star Borough"
                     /collection_date="12-Aug-2016"
                     /collected_by="Alaska Department of Fish and Game"
                     /note="NVSL 16-027072 original swab; Eurasian origin
                     (EA-H5 clade 2.3.4.4)-North American reassortant"
     gene            17..1720
                     /gene="HA"
     CDS             17..1720
                     /gene="HA"
                     /function="receptor binding and fusion protein"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="AOT22442.1"
                     /translation="MEKIVLLFAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
                     AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
                     NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASAFF
                     RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
                     STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
                     DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
                     NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
                     VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
                     RTLDFHDSNVRNLYDKARLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
                     EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
                     I"
     sig_peptide     17..64
                     /gene="HA"
     mat_peptide     65..1051
                     /gene="HA"
                     /product="HA1"
     mat_peptide     1052..1717
                     /gene="HA"
                     /product="HA2"
ORIGIN      
        1 ggttcaatct gtcaaaatgg agaaaatagt gcttcttttt gcagtgatta gccttgtcaa
       61 aagcgaccag atttgcattg gttaccatgc aaacaactca acaaagcagg ttgacacgat
      121 aatggagaaa aacgtcactg ttacacatgc ccaagacata ctggaaaaga cacacaacgg
      181 gaagctctgc gatcttaatg gagtgaagcc cctgattcta aaggattgta gcgtagctgg
      241 gtggctcctt ggaaatccaa tgtgcgacga gttcatcagg gtaccggaat ggtcttacat
      301 cgtggagagg gctaacccag ccaacgatct ctgttaccca gggaccctca atgactatga
      361 ggaactgaaa cacctattga gcagaataaa tcattttgag aaaactctga tcatccccag
      421 gagttcttgg cccaatcatg aaacatcatt aggggtgagc gcagcatgtc cataccaggg
      481 agcatccgca tttttcagaa atgtggtatg gctcatcaaa aagaacgatg catacccgac
      541 aataaagata agctacaata ataccaatcg ggaagatctt ttgatactgt gggggattca
      601 tcattccaac aatgcagcag agcagacaaa tctctataaa aacccagaca cttatgtttc
      661 cgttgggaca tcaacattaa accagagatt ggtgccaaaa atagctacta gatcccaagt
      721 aaacgggcag agtggaagaa tggatttctt ctggacaatt ttaaaaccga atgatgcaat
      781 ccactttgag agtaatggaa atttcattgc tccagaatat gcatacaaaa ttgtcaagaa
      841 aggggactca acaattatga aaagtgaaat ggagtatggc cactgcaaca ccaaatgtca
      901 aactccaata ggggcgataa actctagcat gccattccac aatatacacc ctctcaccat
      961 aggggaatgc cccaaatacg tgaagtcaaa caaattagtc cttgcgactg ggctcagaaa
     1021 tagtcctcta agagaaagaa gaagaaaaag aggactattt ggagctatag cagggtttat
     1081 agagggagga tggcagggaa tggtagacgg ttggtatggg tatcatcata gcaatgagca
     1141 ggggagtggg tacgctgcag acaaagaatc aacccaaaag gcaatagatg gagttaccaa
     1201 taaggtcaac tcaatcattg acaaaatgaa cactcaattt gaggccgttg gaagggagtt
     1261 taataactta gaaaggagaa tagagaattt aaacaagaaa atggaagacg gattcctaga
     1321 tgtctggact tataatgctg aacttttagt tctcatggaa aatgagagaa ctctagattt
     1381 ccatgactca aatgtcagaa acctttacga caaagcccga ctacagctta gggataatgc
     1441 aaaggagctg ggtaatggtt gtttcgagtt ctatcacaaa tgtgataacg aatgtatgga
     1501 gagcgtaaga aatgggacgt atgactaccc taagtattca gaagaagcaa tattaaaaag
     1561 agaagaaata agcggagtga aattagaatc aataggaact taccagatac tgtcaattta
     1621 ttcaacagtg gcgagttccc tagcactggc aatcatagtg gctggtctat ctttatggat
     1681 gtgctctaat gggtcgttac aatgcagaat ttgcatctaa atttgtgagc tcagattgta
     1741 atta
Link to comment
Share on other sites

Descriptions
Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI845368 A/mallard/Alaska/AH0088535/2016 (A/H5N2) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%)
text_code_colored.png EPI690363 A/mallard/Washington/196262/2015 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI690329 A/mallard/Oregon/AH0003821/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI690255 A/American green-winged teal/Oregon/AH0012403/2015 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI690248 A/American green-winged teal/Idaho/AH0011899/2015 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI690159 A/wood duck/Oregon/AH0007257/2015 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI690152 A/wood duck/Oregon/AH0007244/2015 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI690145 A/Northern pintail/Oregon/AH0003967/2015 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI690124 A/snow goose/Missouri/15-011246-1/2015 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI586550 A/chicken/BC/FAV24/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI586518 A/chicken/BC/FAV20/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI586509 A/poultry/BC/FAV19/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI584079 A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI573298 A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%)
text_code_colored.png EPI586534 A/chicken/BC/FAV22/2014 (A/H5N2) segment 4 (HA) 3088.7 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI690385 A/mallard/Washington/196865/2015 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI690350 A/mallard/Oregon/195547/2014 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI690212 A/mallard/Oregon/AH0008887/2015 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI690166 A/wood duck/Oregon/AH0007263/2015 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI662744 A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI662723 A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI590740 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI590733 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI590719 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI586542 A/chicken/BC/FAV23/2014 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI586526 A/chicken/BC/FAV21/2014 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI586493 A/poultry/BC/FAV15/2014 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI585092 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI576470 A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
text_code_colored.png EPI778498 A/turkey/Minnesota/15-012582-1/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI778490 A/turkey/South Dakota/15-012511-2/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI690461 A/Cooper's hawk/Minnesota/198225/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI690454 A/Canada goose/Washington/197619/2014 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI690447 A/mallard/Washington/195810/2014 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI690427 A/mallard/Washington/195246/2014 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI690180 A/Northern shoveler/Oregon/AH0007337/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI662737 A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI662701 A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI620408 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI590726 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI590712 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI590699 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI590692 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI587633 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI586501 A/poultry/BC/FAV17/2014 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI576477 A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI573281 A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI569383 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
text_code_colored.png EPI690468 A/snowy owl/Wisconsin/198399/2015 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI690343 A/Northern pintail/Washington/195365/2014 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI690241 A/mallard/Idaho/AH0007413/2015 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI690234 A/mallard/Idaho/AH0007412/2015 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI690219 A/Northern pintail/Oregon/AH0003871/2015 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI690173 A/Northern shoveler/Oregon/AH0007332/2015 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI690121 A/Northern shoveler/Oregon/AH0007339/2015 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI662709 A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI662688 A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI590685 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI586558 A/chicken/BC/FAV25/2014 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI573271 A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
text_code_colored.png EPI662716 A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%)
text_code_colored.png EPI573276 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%)
text_code_colored.png EPI690420 A/American wigeon/Washington/195205/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
text_code_colored.png EPI690413 A/American wigeon/Washington/195198/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
text_code_colored.png EPI690138 A/mallard/Oregon/AH0003952/2015 (A/H5N2) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
text_code_colored.png EPI569390 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
text_code_colored.png EPI569376 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
text_code_colored.png EPI569372 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
text_code_colored.png EPI690336 A/bald eagle/Idaho/15-002892-2/2015 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
text_code_colored.png EPI690322 A/mallard/Idaho/AH0005955/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
text_code_colored.png EPI690276 A/mallard/Nevada/AH0006855/2015 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
text_code_colored.png EPI690194 A/mallard/Idaho/AH0008597/2015 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
text_code_colored.png EPI690131 A/American wigeon/Utah/AH0007824/2015 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
text_code_colored.png EPI662730 A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
text_code_colored.png EPI662694 A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
text_code_colored.png EPI620422 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
text_code_colored.png EPI587521 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
text_code_colored.png EPI585084 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
text_code_colored.png EPI845956 A/tundra swan/Tottori/C6nk/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
text_code_colored.png EPI778506 A/chicken/Iowa/15-013388-1/2015 (A/H5N2) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
text_code_colored.png EPI690474 A/Canada goose/Kansas/197850/2015 (A/H5N2) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
text_code_colored.png EPI690269 A/American wigeon/Oregon/AH0012525/2015 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
text_code_colored.png EPI690262 A/Canada goose/Oregon/AH0012452/2015 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
text_code_colored.png EPI662681 A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
text_code_colored.png EPI620436 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
text_code_colored.png EPI750106 A/chicken/Taiwan/01174/2015 (A/H5N3) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI750098 A/goose/Taiwan/01038/2015 (A/H5N3) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI690406 A/mallard/Oregon/195536/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI690392 A/American wigeon/Washington/196336/2015 (A/H5N1) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI690315 A/mallard/Idaho/AH0005954/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI690286 A/chicken/California/15-004912/2015 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI620457 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI620450 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI620443 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI620415 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI588968 A/chicken/Taiwan/a174/2015 (A/H5N3) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI573638 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
text_code_colored.png EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3044.4 0.000000e+00 1685/1703 (98%)
text_code_colored.png EPI853979 A/chicken/BC/FAV2/2015 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
text_code_colored.png EPI750170 A/goose/Taiwan/01031/2015 (A/H5N2) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
text_code_colored.png EPI690648 A/goose/Taiwan/TNO3/2015 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
text_code_colored.png EPI690399 A/American wigeon/Washington/196340/2015 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
text_code_colored.png EPI690378 A/Northern pintail/Washington/196271/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
text_code_colored.png EPI620429 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
text_code_colored.png EPI588960 A/duck/Taiwan/a043/2015 (A/H5N2) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
text_code_colored.png EPI573286 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
text_code_colored.png EPI750178 A/goose/Taiwan/01040/2015 (A/H5N2) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI750162 A/goose/Taiwan/01023/2015 (A/H5N2) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI750154 A/goose/Taiwan/01022/2015 (A/H5N2) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI750138 A/goose/Taiwan/01039/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690776 A/goose/Taiwan/TNO19/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690768 A/goose/Taiwan/TNO18/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690760 A/goose/Taiwan/TNO17/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690728 A/goose/Taiwan/TNO13/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690720 A/goose/Taiwan/TNO12/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690712 A/goose/Taiwan/TNO11/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690688 A/goose/Taiwan/TNO8/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690632 A/goose/Taiwan/TNO1/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690624 A/goose/Taiwan/TNC14/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690608 A/goose/Taiwan/TNC12/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690592 A/goose/Taiwan/TNC10/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690576 A/goose/Taiwan/TNC8/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690568 A/goose/Taiwan/TNC7/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690560 A/goose/Taiwan/TNC6/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI690528 A/goose/Taiwan/TNC2/2015 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
text_code_colored.png EPI750146 A/duck/Taiwan/01006/2015 (A/H5N2) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
text_code_colored.png EPI750130 A/goose/Taiwan/01026/2015 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
text_code_colored.png EPI690736 A/goose/Taiwan/TNO14/2015 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
text_code_colored.png EPI690704 A/goose/Taiwan/TNO10/2015 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
text_code_colored.png EPI690680 A/goose/Taiwan/TNO7/2015 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
text_code_colored.png EPI690616 A/goose/Taiwan/TNC13/2015 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
text_code_colored.png EPI690584 A/goose/Taiwan/TNC9/2015 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
text_code_colored.png EPI690536 A/goose/Taiwan/TNC3/2015 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
text_code_colored.png EPI690520 A/goose/Taiwan/TNC1/2015 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
text_code_colored.png EPI690440 A/peregrine falcon/Washington/196426/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
text_code_colored.png EPI690356 A/American wigeon/Washington/195968/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
text_code_colored.png EPI588976 A/duck/Taiwan/a068/2015 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
text_code_colored.png EPI690784 A/goose/Taiwan/TNO20/2015 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
text_code_colored.png EPI690752 A/goose/Taiwan/TNO16/2015 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
text_code_colored.png EPI690744 A/goose/Taiwan/TNO15/2015 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
text_code_colored.png EPI690696 A/goose/Taiwan/TNO9/2015 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
text_code_colored.png EPI690672 A/goose/Taiwan/TNO6/2015 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
text_code_colored.png EPI690656 A/goose/Taiwan/TNO4/2015 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
text_code_colored.png EPI690640 A/goose/Taiwan/TNO2/2015 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
text_code_colored.png EPI690600 A/goose/Taiwan/TNC11/2015 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
text_code_colored.png EPI690552 A/goose/Taiwan/TNC5/2015 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
text_code_colored.png EPI690544 A/goose/Taiwan/TNC4/2015 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
text_code_colored.png EPI573208 A/gadwall/Korea/H1351/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1683/1706 (98%)
text_code_colored.png EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
text_code_colored.png EPI750122 A/goose/Taiwan/01019/2015 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1681/1705 (98%)
text_code_colored.png EPI588952 A/goose/Taiwan/a015/2015 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1681/1705 (98%)
text_code_colored.png EPI585595 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
text_code_colored.png EPI585589 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
text_code_colored.png EPI585586 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
text_code_colored.png EPI573242 A/Common Teal/Korea/H844/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
text_code_colored.png EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
text_code_colored.png EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
text_code_colored.png EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
text_code_colored.png EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
text_code_colored.png EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
text_code_colored.png EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
text_code_colored.png EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
text_code_colored.png EPI750114 A/duck/Taiwan/A3400/2015 (A/H5N8) segment 4 (HA) 3011.2 0.000000e+00 1683/1708 (98%)
text_code_colored.png EPI585594 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI585592 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI585591 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI585590 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI585582 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI585581 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI585579 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI585577 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI573199 A/breeder chicken/Korea/H1068/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI573197 A/chicken/Korea/H881/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
text_code_colored.png EPI585593 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1680/1706 (98%)
text_code_colored.png EPI585587 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1680/1706 (98%)
text_code_colored.png EPI585584 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1680/1706 (98%)
text_code_colored.png EPI585583 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1680/1706 (98%)
text_code_colored.png EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1680/1706 (98%)
text_code_colored.png EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1681/1707 (98%)
text_code_colored.png EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1680/1706 (98%)
text_code_colored.png EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1680/1706 (98%)
text_code_colored.png EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1680/1706 (98%)
text_code_colored.png EPI585580 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI573200 A/Korean native chicken/Korea/H1139/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI573196 A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI573194 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
text_code_colored.png EPI585588 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1678/1706 (98%)
text_code_colored.png EPI585585 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1678/1706 (98%)
text_code_colored.png EPI573192 A/breeder chicken/Korea/H503/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1678/1706 (98%)
text_code_colored.png EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1678/1706 (98%)
text_code_colored.png EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1678/1706 (98%)
text_code_colored.png EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1678/1706 (98%)
text_code_colored.png EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1678/1706 (98%)
text_code_colored.png EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1678/1706 (98%)
text_code_colored.png EPI585578 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1678/1707 (98%)
text_code_colored.png EPI573240 A/breeder duck/Korea/H345/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
text_code_colored.png EPI573203 A/chicken/Korea/H1292/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
text_code_colored.png EPI573195 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
text_code_colored.png EPI718280 A/ostrich/Korea/H829/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1677/1707 (98%)
text_code_colored.png EPI573207 A/chicken/Korea/H1350/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1676/1706 (98%)
text_code_colored.png EPI573201 A/chicken/Korea/H1236/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1676/1706 (98%)
text_code_colored.png EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1677/1707 (98%)
text_code_colored.png EPI573241 A/breeder duck/Korea/H566/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1676/1707 (98%)
text_code_colored.png EPI573204 A/goose/Korea/H1296/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1676/1707 (98%)
text_code_colored.png EPI573202 A/chicken/Korea/H1268/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
text_code_colored.png EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
text_code_colored.png EPI573213 A/broiler duck/Korea/H1556/2014 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1674/1706 (98%)
text_code_colored.png EPI573205 A/Korean native chicken/Korea/H1299/2014 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1674/1706 (98%)
text_code_colored.png EPI573198 A/broiler duck/Korea/H959/2014 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1674/1706 (98%)
text_code_colored.png EPI573212 A/Korean native chicken/Korea/H1554/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
text_code_colored.png EPI573211 A/goose/Korea/H1545/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
text_code_colored.png EPI573209 A/broiler duck/Korea/H1413/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
text_code_colored.png EPI573206 A/breeder duck/Korea/H1343/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
text_code_colored.png EPI550849 A/duck/England/36226/14 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
text_code_colored.png EPI550848 A/duck/England/36038/14 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
text_code_colored.png EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1672/1706 (98%)
text_code_colored.png EPI573218 A/Korean native chicken/Korea/H1687/2014 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1671/1706 (97%)
text_code_colored.png EPI573217 A/broiler duck/Korea/H1685/2014 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1671/1706 (97%)
text_code_colored.png EPI573216 A/broiler duck/Korea/H1683/2014 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1671/1706 (97%)
text_code_colored.png EPI573210 A/broiler duck/Korea/H1414/2014 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1671/1706 (97%)
text_code_colored.png EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1671/1706 (97%)
text_code_colored.png EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1671/1706 (97%)
text_code_colored.png EPI576384 A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 4 (HA) 2950.2 0.000000e+00 1670/1706 (97%)
text_code_colored.png EPI837544 A/broiler duck/Korea/H2194/2015 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1670/1706 (97%)
text_code_colored.png EPI576391 A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1670/1706 (97%)
text_code_colored.png EPI573239 A/mallard/Korea/H1924-6/2014 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1670/1706 (97%)
text_code_colored.png EPI573219 A/goose/Korea/H1689/2014 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1670/1706 (97%)
text_code_colored.png EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1670/1706 (97%)
text_code_colored.png EPI573228 A/broiler duck/Korea/H1755/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1669/1706 (97%)
text_code_colored.png EPI573227 A/breeder duck/Korea/H1752/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1669/1706 (97%)
text_code_colored.png EPI573222 A/broiler duck/Korea/H1733/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1669/1706 (97%)
text_code_colored.png EPI573220 A/goose/Korea/H1698/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1669/1706 (97%)
text_code_colored.png EPI573215 A/breeder duck/Korea/H1596/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1669/1706 (97%)
text_code_colored.png EPI573214 A/broiler duck/Korea/H1582/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1669/1706 (97%)
text_code_colored.png EPI573179 A/duck/Netherlands/14015898/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1669/1706 (97%)
text_code_colored.png EPI552746 A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1669/1706 (97%)
text_code_colored.png EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1669/1706 (97%)
text_code_colored.png EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1669/1706 (97%)
text_code_colored.png EPI837548 A/wild bird/Korea/H2291/2015 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1668/1706 (97%)
text_code_colored.png EPI837547 A/wild bird/Korea/H2290/2015 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1669/1707 (97%)
text_code_colored.png EPI837545 A/broiler duck/Korea/H2266/2015 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1669/1707 (97%)
text_code_colored.png EPI837542 A/mallard/Korea/H2102/2015 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1669/1707 (97%)
text_code_colored.png EPI837541 A/breeder duck/Korea/H2086/2015 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1668/1706 (97%)
text_code_colored.png EPI595055 A/common teal/Korea/KU-12/2015 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1669/1707 (97%)
text_code_colored.png EPI584823 A/domestic duck/Hungary/7341/2015 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1668/1706 (97%)
text_code_colored.png EPI573229 A/broiler duck/Korea/H1763/2014 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1668/1706 (97%)
text_code_colored.png EPI573226 A/Korean native chicken/Korea/H1747/2014 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1668/1706 (97%)
text_code_colored.png EPI573224 A/broiler duck/Korea/H1739/2014 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1668/1706 (97%)
text_code_colored.png EPI573187 A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1669/1707 (97%)
text_code_colored.png EPI573171 A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1668/1706 (97%)
text_code_colored.png EPI573163 A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1669/1707 (97%)
text_code_colored.png EPI554605 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 4 (HA) 2937.3 0.000000e+00 1668/1706 (97%)
text_code_colored.png EPI845903 A/mandarin duck/Gifu/2112D001/2014 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1668/1707 (97%)
text_code_colored.png EPI837565 A/duck/Korea/H2628/2015 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1667/1706 (97%)
text_code_colored.png EPI837564 A/duck/Korea/H2627/2015 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1667/1706 (97%)
text_code_colored.png EPI703601 A/duck/Eastern China/S0131/2014 (A/H5N2) segment 4 (HA) 2931.8 0.000000e+00 1668/1707 (97%)
text_code_colored.png EPI573235 A/Korean native chicken/Korea/H1903/2014 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1667/1706 (97%)
text_code_colored.png EPI573233 A/Korean native chicken/Korea/H1847/2014 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1667/1706 (97%)
text_code_colored.png EPI573231 A/broiler duck/Korea/H1839/2014 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1667/1706 (97%)
text_code_colored.png EPI573225 A/broiler duck/Korea/H1745/2014 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1667/1706 (97%)
text_code_colored.png EPI573223 A/broiler duck/Korea/H1734/2014 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1667/1706 (97%)
text_code_colored.png EPI573221 A/broiler duck/Korea/H1731/2014 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1667/1706 (97%)
text_code_colored.png EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1667/1706 (97%)
text_code_colored.png EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2931.8 0.000000e+00 1668/1707 (97%)
text_code_colored.png EPI837568 A/broiler duck/Korea/H2649/2015 (A/H5N8) segment 4 (HA) 2926.2 0.000000e+00 1666/1706 (97%)
text_code_colored.png EPI837567 A/broiler duck/Korea/H2641/2015 (A/H5N8) segment 4 (HA) 2926.2 0.000000e+00 1666/1706 (97%)
text_code_colored.png EPI837566 A/broildr duck/Korea/H2637/2015 (A/H5N8) segment 4 (HA) 2926.2 0.000000e+00 1666/1706 (97%)
text_code_colored.png EPI837563 A/broiler duck/Korea/H2618/2015 (A/H5N8) segment 4 (HA) 2926.2 0.000000e+00 1666/1706 (97%)
text_code_colored.png EPI837551 A/broiler duck/Korea/H2385/2015 (A/H5N8) segment 4 (HA) 2926.2 0.000000e+00 1667/1707 (97%)
text_code_colored.png EPI837546 A/broiler duck/Korea/H2278/2015 (A/H5N8) segment 4 (HA) 2926.2 0.000000e+00 1667/1707 (97%)
text_code_colored.png EPI837543 A/broiler duck/Korea/H2116/2015 (A/H5N8) segment 4 (HA) 2926.2 0.000000e+00 1666/1706 (97%)
text_code_colored.png EPI573654 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 4 (HA) 2926.2 0.000000e+00 1667/1707 (97%)
text_code_colored.png EPI573646 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 4 (HA) 2926.2 0.000000e+00 1667/1707 (97%)
text_code_colored.png EPI573230 A/broiler duck/Korea/H1803/2014 (A/H5N8) segment 4 (HA) 2926.2 0.000000e+00 1666/1706 (97%)
text_code_colored.png EPI837562 A/broiler duck/Korea/H2606/2015 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1665/1706 (97%)
text_code_colored.png EPI837557 A/broiler duck/Korea/H2531/2015 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1665/1706 (97%)
text_code_colored.png EPI837553 A/broiler duck/Korea/H2400/2015 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1665/1706 (97%)
text_code_colored.png EPI837550 A/mallard/Korea/H2321/2015 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1666/1707 (97%)
text_code_colored.png EPI837549 A/mallard/Korea/H2304/2015 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1667/1708 (97%)
text_code_colored.png EPI595079 A/mallard/Korea/N15-99/2015 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1666/1707 (97%)
text_code_colored.png EPI595066 A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1667/1708 (97%)
text_code_colored.png EPI573664 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1666/1707 (97%)
text_code_colored.png EPI573234 A/broiler duck/Korea/H1864/2014 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1665/1706 (97%)
text_code_colored.png EPI573232 A/broiler duck/Korea/H1840/2014 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1665/1706 (97%)
text_code_colored.png EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1657/1694 (97%)
text_code_colored.png EPI837554 A/broiler duck/Korea/H2405/2015 (A/H5N8) segment 4 (HA) 2915.1 0.000000e+00 1664/1706 (97%)
text_code_colored.png EPI573680 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 4 (HA) 2915.1 0.000000e+00 1665/1707 (97%)
text_code_colored.png EPI573672 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 4 (HA) 2915.1 0.000000e+00 1665/1707 (97%)
text_code_colored.png EPI573238 A/mallard/Korea/H2003/2014 (A/H5N8) segment 4 (HA) 2915.1 0.000000e+00 1665/1707 (97%)
text_code_colored.png EPI573237 A/mallard/Korea/H1991/2014 (A/H5N8) segment 4 (HA) 2915.1 0.000000e+00 1665/1707 (97%)
text_code_colored.png EPI573236 A/spot-billed duck/Korea/H1981/2014 (A/H5N8) segment 4 (HA) 2915.1 0.000000e+00 1665/1707 (97%)
text_code_colored.png EPI837569 A/breeder duck/Korea/H2675/2015 (A/H5N8) segment 4 (HA) 2909.6 0.000000e+00 1663/1706 (97%)
text_code_colored.png EPI595138 A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 4 (HA) 2909.6 0.000000e+00 1664/1707 (97%)
text_code_colored.png EPI595133 A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 4 (HA) 2909.6 0.000000e+00 1664/1707 (97%)
text_code_colored.png EPI595124 A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 4 (HA) 2909.6 0.000000e+00 1664/1707 (97%)
text_code_colored.png EPI595116 A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 4 (HA) 2909.6 0.000000e+00 1664/1707 (97%)
text_code_colored.png EPI595107 A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 4 (HA) 2909.6 0.000000e+00 1664/1707 (97%)
text_code_colored.png EPI595094 A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 4 (HA) 2909.6 0.000000e+00 1664/1707 (97%)
text_code_colored.png EPI595146 A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 4 (HA) 2905.9 0.000000e+00 1663/1707 (97%)
text_code_colored.png EPI595082 A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 4 (HA) 2905.9 0.000000e+00 1663/1707 (97%)
text_code_colored.png EPI837555 A/breeder chicken/Korea/H2496/2015 (A/H5N8) segment 4 (HA) 2904.1 0.000000e+00 1664/1708 (97%)
text_code_colored.png EPI837561 A/korean native chicken/Korea/H2598/2015 (A/H5N8) segment 4 (HA) 2898.5 0.000000e+00 1661/1706 (97%)
text_code_colored.png EPI837560 A/breeder chicken/Korea/H2590/2015 (A/H5N8) segment 4 (HA) 2898.5 0.000000e+00 1662/1707 (97%)
text_code_colored.png EPI837559 A/breeder chicken/Korea/H2565/2015 (A/H5N8) segment 4 (HA) 2898.5 0.000000e+00 1662/1707 (97%)
text_code_colored.png EPI837556 A/broiler duck/Korea/H2517/2015 (A/H5N8) segment 4 (HA) 2898.5 0.000000e+00 1662/1707 (97%)
text_code_colored.png EPI837552 A/broiler duck/Korea/H2393/2015 (A/H5N8) segment 4 (HA) 2898.5 0.000000e+00 1662/1707 (97%)
text_code_colored.png EPI590679 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 4 (HA) 2898.5 0.000000e+00 1653/1694 (97%)
text_code_colored.png EPI585111 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 4 (HA) 2898.5 0.000000e+00 1653/1694 (97%)
text_code_colored.png EPI568474 A/green-winged teal/Korea/KU-12/2015 (A/H5) segment 4 (HA) 2898.5 0.000000e+00 1652/1692 (97%)
text_code_colored.png EPI596301 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2896.7 0.000000e+00 1647/1685 (97%)
text_code_colored.png EPI596295 A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 4 (HA) 2896.7 0.000000e+00 1653/1694 (97%)
text_code_colored.png EPI552776 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2896.7 0.000000e+00 1647/1685 (97%)
text_code_colored.png EPI552768 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2896.7 0.000000e+00 1653/1694 (97%)
text_code_colored.png EPI837573 A/mallard/Korea/H2891/2015 (A/H5N8) segment 4 (HA) 2893.0 0.000000e+00 1660/1706 (97%)
text_code_colored.png EPI837571 A/broiler duck/Korea/H2827/2015 (A/H5N8) segment 4 (HA) 2893.0 0.000000e+00 1660/1706 (97%)
text_code_colored.png EPI837558 A/breeder chicken/Korea/H2553/2015 (A/H5N8) segment 4 (HA) 2893.0 0.000000e+00 1661/1707 (97%)
text_code_colored.png EPI837582 A/broiler duck/Korea/H3302/2015 (A/H5N8) segment 4 (HA) 2887.4 0.000000e+00 1659/1706 (97%)
text_code_colored.png EPI837577 A/broiler duck/Korea/H3093/2015 (A/H5N8) segment 4 (HA) 2887.4 0.000000e+00 1659/1706 (97%)
text_code_colored.png EPI837576 A/broiler duck/Korea/H3092/2015 (A/H5N8) segment 4 (HA) 2887.4 0.000000e+00 1659/1706 (97%)
text_code_colored.png EPI837575 A/broiler duck/Korea/H3078/2015 (A/H5N8) segment 4 (HA) 2887.4 0.000000e+00 1659/1706 (97%)
text_code_colored.png EPI837574 A/broiler duck/Korea/H2910/2015 (A/H5N8) segment 4 (HA) 2887.4 0.000000e+00 1659/1706 (97%)
text_code_colored.png EPI837572 A/broiler duck/Korea/15LBM334/2015 (A/H5N8) segment 4 (HA) 2887.4 0.000000e+00 1659/1706 (97%)
text_code_colored.png EPI837570 A/broiler duck/Korea/H2826/2015 (A/H5N8) segment 4 (HA) 2887.4 0.000000e+00 1659/1706 (97%)
text_code_colored.png EPI837584 A/duck/Korea/16A02/2016 (A/H5N8) segment 4 (HA) 2881.9 0.000000e+00 1658/1706 (97%)
text_code_colored.png EPI837583 A/breeder duck/Korea/16AQ17/2016 (A/H5N8) segment 4 (HA) 2881.9 0.000000e+00 1658/1706 (97%)
text_code_colored.png EPI837581 A/broiler duck/Korea/H3301/2015 (A/H5N8) segment 4 (HA) 2881.9 0.000000e+00 1658/1706 (97%)
text_code_colored.png EPI837579 A/broiler duck/Korea/H3104/2015 (A/H5N8) segment 4 (HA) 2881.9 0.000000e+00 1658/1706 (97%)
text_code_colored.png EPI837580 A/broiler duck/Korea/H3298/2015 (A/H5N8) segment 4 (HA) 2876.4 0.000000e+00 1658/1707 (97%)
text_code_colored.png EPI837578 A/broiler duck/Korea/H3098/2015 (A/H5N8) segment 4 (HA) 2870.8 0.000000e+00 1657/1707 (97%)
text_code_colored.png EPI596289 A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 4 (HA) 2870.8 0.000000e+00 1620/1652 (98%)
text_code_colored.png EPI552760 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2870.8 0.000000e+00 1620/1652 (98%)
text_code_colored.png EPI551149 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2856.0 0.000000e+00 1629/1669 (97%)
text_code_colored.png EPI823940 A/duck/Hubei/SZY250/2016 (A/H5N2) segment 4 (HA) 2826.5 0.000000e+00 1648/1706 (96%)
text_code_colored.png EPI543010 A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA) 2809.9 0.000000e+00 1579/1607 (98%)
text_code_colored.png EPI543002 A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA) 2798.8 0.000000e+00 1578/1608 (98%)
text_code_colored.png EPI542617 A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA) 2793.3 0.000000e+00 1575/1607 (98%)
text_code_colored.png EPI551143 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2787.7 0.000000e+00 1579/1613 (97%)
text_code_colored.png EPI703592 A/duck/Eastern China/L0423/2011 (A/H5N8) segment 4 (HA) 2782.2 0.000000e+00 1643/1709 (96%)
text_code_colored.png EPI593747 A/goose/Shandong/k1201/2009 (A/H5N1) segment 4 (HA) 2776.6 0.000000e+00 1643/1710 (96%)
text_code_colored.png EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2776.6 0.000000e+00 1643/1710 (96%)
text_code_colored.png EPI703591 A/duck/Eastern China/L0405/2010 (A/H5N8) segment 4 (HA) 2771.1 0.000000e+00 1641/1709 (96%)
text_code_colored.png EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2771.1 0.000000e+00 1642/1710 (96%)
text_code_colored.png EPI703594 A/duck/Eastern China/L0722/2012 (A/H5N8) segment 4 (HA) 2760.0 0.000000e+00 1640/1710 (95%)
text_code_colored.png EPI703595 A/duck/Eastern China/L1021/2012 (A/H5N8) segment 4 (HA) 2754.5 0.000000e+00 1639/1710 (95%)
text_code_colored.png EPI703593 A/duck/Eastern China/L0611/2011 (A/H5N8) segment 4 (HA) 2754.5 0.000000e+00 1639/1710 (95%)
text_code_colored.png EPI703597 A/goose/Eastern China/L1214/2012 (A/H5N8) segment 4 (HA) 2748.9 0.000000e+00 1638/1710 (95%)
text_code_colored.png EPI703598 A/goose/Eastern China/L1204/2012 (A/H5N8) segment 4 (HA) 2743.4 0.000000e+00 1636/1709 (95%)
text_code_colored.png EPI703596 A/duck/Eastern China/L1120/2012 (A/H5N8) segment 4 (HA) 2737.9 0.000000e+00 1635/1709 (95%)
text_code_colored.png EPI703590 A/duck/Eastern China/L0230/2010 (A/H5N2) segment 4 (HA) 2737.9 0.000000e+00 1636/1710 (95%)
text_code_colored.png EPI703589 A/duck/Eastern China/L0321/2010 (A/H5N2) segment 4 (HA) 2737.9 0.000000e+00 1636/1710 (95%)
text_code_colored.png EPI672795 A/duck/Guangdong/s14044/2014 (A/H5N8) segment 4 (HA) 2732.3 0.000000e+00 1635/1710 (95%)
text_code_colored.png EPI672787 A/goose/Guangdong/s13124/2013 (A/H5N8) segment 4 (HA) 2732.3 0.000000e+00 1635/1710 (95%)
text_code_colored.png EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2732.3 0.000000e+00 1636/1711 (95%)
text_code_colored.png EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2732.3 0.000000e+00 1635/1710 (95%)
text_code_colored.png EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2721.2 0.000000e+00 1633/1710 (95%)
text_code_colored.png EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2715.7 0.000000e+00 1632/1710 (95%)
text_code_colored.png EPI602028 A/chicken/Dongguan/4190/2013 (A/H0) segment 4 (HA) 2712.0 0.000000e+00 1630/1709 (95%)
text_code_colored.png EPI687498 A/Goose/ Guangdong /JG125/2013(H5N6) (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1630/1709 (95%)
text_code_colored.png EPI602419 A/chicken/Dongguan/3363/2013 (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1630/1709 (95%)
text_code_colored.png EPI602412 A/chicken/Dongguan/2690/2013 (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1630/1709 (95%)
text_code_colored.png EPI602045 A/chicken/Dongguan/2818/2013 (A/H0) segment 4 (HA) 2710.2 0.000000e+00 1630/1709 (95%)
text_code_colored.png EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2710.2 0.000000e+00 1632/1711 (95%)
text_code_colored.png EPI839170 A/Syrrhaptes paradoxus/Guangdong/ZH283/2015 (A/H5N6) segment 4 (HA) 2704.6 0.000000e+00 1627/1707 (95%)
text_code_colored.png EPI760097 A/feline/Guangdong/2/2015 (A/H5N6) segment 4 (HA) 2704.6 0.000000e+00 1627/1707 (95%)
text_code_colored.png EPI703600 A/goose/Eastern China/S0513/2013 (A/H5N6) segment 4 (HA) 2704.6 0.000000e+00 1629/1709 (95%)
text_code_colored.png EPI599662 A/goose/Shantou/1806/2014 (A/H5N6) segment 4 (HA) 2704.6 0.000000e+00 1630/1710 (95%)
text_code_colored.png EPI599655 A/goose/Shantou/1791/2014 (A/H5N6) segment 4 (HA) 2704.6 0.000000e+00 1630/1710 (95%)
text_code_colored.png EPI599648 A/goose/Shantou/1763/2014 (A/H5N6) segment 4 (HA) 2704.6 0.000000e+00 1630/1710 (95%)
text_code_colored.png EPI599339 A/duck/Dongguan/3069/2013 (A/H5N6) segment 4 (HA) 2704.6 0.000000e+00 1629/1709 (95%)
text_code_colored.png EPI599299 A/chicken/Shenzhen/1395/2013 (A/H5N6) segment 4 (HA) 2704.6 0.000000e+00 1629/1709 (95%)
text_code_colored.png EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2704.6 0.000000e+00 1629/1709 (95%)
text_code_colored.png EPI760089 A/feline/Guangdong/1/2015 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1626/1707 (95%)
text_code_colored.png EPI691378 A/ Guangdong /ZQ874/2015(H5N6) (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1626/1707 (95%)
text_code_colored.png EPI690800 A/goose/Shandong/WFSG1/2014 (A/H5N8) segment 4 (HA) 2699.1 0.000000e+00 1628/1709 (95%)
text_code_colored.png EPI687547 A/Goose/ Guangdong /SSZYP/2015(H5N6) (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1626/1707 (95%)
text_code_colored.png EPI682917 A/duck/Taizhou/TZYG12/2015 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1628/1709 (95%)
text_code_colored.png EPI681296 A/chicken/Zhejiang/727155/2014 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1628/1709 (95%)
text_code_colored.png EPI681288 A/goose/Zhejiang/925036/2014 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1626/1707 (95%)
text_code_colored.png EPI602484 A/chicken/Shenzhen/1061/2013 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1629/1710 (95%)
text_code_colored.png EPI602103 A/chicken/Shenzhen/2072/2013 (A/H0) segment 4 (HA) 2699.1 0.000000e+00 1628/1709 (95%)
text_code_colored.png EPI599346 A/chicken/Dongguan/4259/2013 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1628/1709 (95%)
text_code_colored.png EPI599333 A/silkie chicken/Dongguan/2809/2013 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1628/1709 (95%)
text_code_colored.png EPI599327 A/duck/Dongguan/2685/2013 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1628/1709 (95%)
text_code_colored.png EPI599292 A/chicken/Shenzhen/552/2013 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1628/1709 (95%)
text_code_colored.png EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1628/1709 (95%)
text_code_colored.png EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2699.1 0.000000e+00 1629/1710 (95%)
text_code_colored.png EPI553144 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA) 2695.4 0.000000e+00 1518/1547 (98%)
text_code_colored.png EPI762158 A/goose/Eastern China/CZ/2013 (A/H5N8) segment 4 (HA) 2693.5 0.000000e+00 1628/1710 (95%)
text_code_colored.png EPI681295 A/chicken/Zhejiang/727026/2014 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1627/1709 (95%)
text_code_colored.png EPI681294 A/chicken/Zhejiang/727022/2014 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1627/1709 (95%)
text_code_colored.png EPI681284 A/chicken/Zhejiang/727159/2014 (A/H5N2) segment 4 (HA) 2693.5 0.000000e+00 1627/1709 (95%)
text_code_colored.png EPI681283 A/chicken/Zhejiang/727079/2014 (A/H5N2) segment 4 (HA) 2693.5 0.000000e+00 1627/1709 (95%)
text_code_colored.png EPI602477 A/chicken/Shenzhen/715/2013 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1627/1709 (95%)
text_code_colored.png EPI599320 A/chicken/Shenzhen/2464/2013 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1627/1709 (95%)
text_code_colored.png EPI599313 A/chicken/Shenzhen/2396/2013 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1627/1709 (95%)
text_code_colored.png EPI599285 A/chicken/Shenzhen/433/2013 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1627/1709 (95%)
text_code_colored.png EPI591879 A/duck/Jiangxi/23970/2013 (A/H0) segment 4 (HA) 2693.5 0.000000e+00 1628/1710 (95%)
text_code_colored.png EPI645049 A/swine/Guangdong/1/2014 (A/H5N6) segment 4 (HA) 2691.7 0.000000e+00 1624/1705 (95%)
text_code_colored.png EPI690792 A/goose/Jiangsu/QD5/2014 (A/H5N8) segment 4 (HA) 2688.0 0.000000e+00 1628/1711 (95%)
text_code_colored.png EPI681300 A/goose/Zhejiang/925104/2014 (A/H5N8) segment 4 (HA) 2688.0 0.000000e+00 1627/1710 (95%)
text_code_colored.png EPI681299 A/goose/Zhejiang/925037/2014 (A/H5N8) segment 4 (HA) 2688.0 0.000000e+00 1627/1710 (95%)
text_code_colored.png EPI681287 A/goose/Zhejiang/727110/2014 (A/H5N6) segment 4 (HA) 2688.0 0.000000e+00 1626/1709 (95%)
text_code_colored.png EPI681286 A/goose/Zhejiang/727092/2014 (A/H5N6) segment 4 (HA) 2688.0 0.000000e+00 1626/1709 (95%)
text_code_colored.png EPI602491 A/chicken/Shenzhen/2269/2013 (A/H5N6) segment 4 (HA) 2688.0 0.000000e+00 1626/1709 (95%)
text_code_colored.png EPI602037 A/duck/Ningbo/3262/2013 (A/H0) segment 4 (HA) 2688.0 0.000000e+00 1628/1711 (95%)
text_code_colored.png EPI601941 A/chicken/Dongguan/1100/2014 (A/H0) segment 4 (HA) 2688.0 0.000000e+00 1627/1710 (95%)
text_code_colored.png EPI593896 A/duck/Guangzhou/41227/2014 (A/H5N6) segment 4 (HA) 2688.0 0.000000e+00 1624/1707 (95%)
text_code_colored.png EPI593889 A/Guangzhou/39715/2014 (A/H5N6) segment 4 (HA) 2688.0 0.000000e+00 1626/1709 (95%)
text_code_colored.png EPI590813 A/duck/Jiangxi/NCDZT1126/2014 (A/H5N6) segment 4 (HA) 2688.0 0.000000e+00 1626/1709 (95%)
text_code_colored.png EPI561495 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 4 (HA) 2688.0 0.000000e+00 1627/1710 (95%)
text_code_colored.png EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2688.0 0.000000e+00 1625/1708 (95%)
text_code_colored.png EPI645042 A/swine/Guangdong/2/2014 (A/H5N6) segment 4 (HA) 2686.1 0.000000e+00 1623/1705 (95%)
text_code_colored.png EPI839147 A/Gallinula chloropus/Guangdong/GZ174/2014 (A/H5N6) segment 4 (HA) 2682.5 0.000000e+00 1625/1709 (95%)
text_code_colored.png EPI775291 A/duck/Guangzhou/021/2014 (A/H5N6) segment 4 (HA) 2682.5 0.000000e+00 1625/1709 (95%)
text_code_colored.png EPI775283 A/duck/Guangzhou/018/2014 (A/H5N6) segment 4 (HA) 2682.5 0.000000e+00 1625/1709 (95%)
text_code_colored.png EPI768621 A/chicken/Wuxi/SC7393/2015(H5N6) (A/H5N6) segment 4 (HA) 2682.5 0.000000e+00 1625/1709 (95%)
text_code_colored.png EPI762150 A/duck/Eastern China/JY/2014 (A/H5N8) segment 4 (HA) 2682.5 0.000000e+00 1626/1710 (95%)
text_code_colored.png EPI703607 A/goose/Eastern China/S0408/2014 (A/H5N8) segment 4 (HA) 2682.5 0.000000e+00 1626/1710 (95%)
text_code_colored.png EPI703605 A/duck/Eastern China/S0908/2014 (A/H5N6) segment 4 (HA) 2682.5 0.000000e+00 1625/1709 (95%)
text_code_colored.png EPI690808 A/goose/Yangzhou/0420/2014 (A/H5N8) segment 4 (HA) 2682.5 0.000000e+00 1627/1711 (95%)
text_code_colored.png EPI681285 A/duck/Zhejiang/727158/2014 (A/H5N6) segment 4 (HA) 2682.5 0.000000e+00 1625/1709 (95%)
text_code_colored.png EPI645982 A/chicken/Jiangsu/WXS7393/2014 (A/H5N6) segment 4 (HA) 2682.5 0.000000e+00 1625/1709 (95%)
text_code_colored.png EPI590806 A/duck/Jiangxi/NCDZT1123/2014 (A/H5N6) segment 4 (HA) 2682.5 0.000000e+00 1625/1709 (95%)
text_code_colored.png EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2682.5 0.000000e+00 1626/1710 (95%)
text_code_colored.png EPI839139 A/Copsychus saularis/Guangdong/SW8/2014 (A/H5N6) segment 4 (HA) 2676.9 0.000000e+00 1624/1709 (95%)
text_code_colored.png EPI703602 A/duck/Eastern China/S0215/2014 (A/H5N8) segment 4 (HA) 2676.9 0.000000e+00 1625/1710 (95%)
text_code_colored.png EPI687144 A/peregrine_falcon/Hong_Kong/04955/2015 (A/H5N6) segment 4 (HA) 2676.9 0.000000e+00 1624/1709 (95%)
text_code_colored.png EPI583870 A/duck/Shaoxing/5240/2013 (A/H0) segment 4 (HA) 2676.9 0.000000e+00 1625/1710 (95%)
text_code_colored.png EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2676.9 0.000000e+00 1624/1709 (95%)
text_code_colored.png EPI736914 A/Changsha/1/2014 (A/H5N6) segment 4 (HA) 2673.2 0.000000e+00 1622/1707 (95%)
text_code_colored.png EPI682939 A/turtledove/Wuhan/HKBJ07/2015 (A/H5N6) segment 4 (HA) 2671.4 0.000000e+00 1626/1712 (94%)
text_code_colored.png EPI682938 A/turtledove/Wuhan/WHBJ26/2014 (A/H5N6) segment 4 (HA) 2671.4 0.000000e+00 1626/1712 (94%)
text_code_colored.png EPI682937 A/turtledove/Wuhan/HKBJ43/2015 (A/H5N6) segment 4 (HA) 2671.4 0.000000e+00 1626/1712 (94%)
text_code_colored.png EPI682936 A/turtledove/Wuhan/HKBJ27/2015 (A/H5N6) segment 4 (HA) 2671.4 0.000000e+00 1626/1712 (94%)
text_code_colored.png EPI682935 A/turtledove/Wuhan/WHBJ28/2014 (A/H5N6) segment 4 (HA) 2671.4 0.000000e+00 1626/1712 (94%)
text_code_colored.png EPI682915 A/duck/Wenzhou/YHQL22/2014 (A/H5N6) segment 4 (HA) 2671.4 0.000000e+00 1624/1710 (94%)
text_code_colored.png EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2671.4 0.000000e+00 1624/1710 (94%)
text_code_colored.png EPI596610 A/duck/Vietnam/LBM758/2014 (A/H5N6) segment 4 (HA) 2667.7 0.000000e+00 1623/1710 (94%)
text_code_colored.png EPI703599 A/duck/Eastern China/S1210/2013 (A/H5N8) segment 4 (HA) 2665.8 0.000000e+00 1624/1711 (94%)
text_code_colored.png EPI682934 A/turtledove/Wuhan/WHBJ12/2014 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1625/1712 (94%)
text_code_colored.png EPI682916 A/duck/Wuhan/JXYFB22/2015 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1622/1709 (94%)
text_code_colored.png EPI682912 A/duck/Wuhan/WHYF03/2015 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1625/1712 (94%)
text_code_colored.png EPI682911 A/duck/Wuhan/WHYF02/2015 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1625/1712 (94%)
text_code_colored.png EPI681290 A/goose/Zhejiang/925106/2014 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1623/1710 (94%)
text_code_colored.png EPI681279 A/duck/Zhejiang/727041/2014 (A/H5N2) segment 4 (HA) 2665.8 0.000000e+00 1622/1709 (94%)
text_code_colored.png EPI676398 A/environment/GZ/76/2014 (A/H5N2) segment 4 (HA) 2665.8 0.000000e+00 1621/1708 (94%)
text_code_colored.png EPI596598 A/muscovy duck/Vietnam/LBM756/2014 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1623/1710 (94%)
text_code_colored.png EPI596592 A/muscovy duck/Vietnam/LBM755/2014 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1623/1710 (94%)
text_code_colored.png EPI596586 A/muscovy duck/Vietnam/LBM754/2014 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1623/1710 (94%)
text_code_colored.png EPI596580 A/duck/Vietnam/LBM752/2014 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1623/1710 (94%)
text_code_colored.png EPI596574 A/duck/Vietnam/LBM751/2014 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1623/1710 (94%)
text_code_colored.png EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1623/1710 (94%)
text_code_colored.png EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1623/1710 (94%)
text_code_colored.png EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1623/1710 (94%)
text_code_colored.png EPI550757 A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA) 2665.8 0.000000e+00 1623/1710 (94%)
text_code_colored.png EPI493825 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA) 2665.8 0.000000e+00 1624/1711 (94%)
text_code_colored.png EPI681280 A/goose/Zhejiang/77166/2014 (A/H5N2) segment 4 (HA) 2664.0 0.000000e+00 1621/1707 (94%)
text_code_colored.png EPI431448 A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA) 2662.1 0.000000e+00 1622/1710 (94%)
text_code_colored.png EPI703606 A/duck/Eastern China/S0322/2014 (A/H5N6) segment 4 (HA) 2660.3 0.000000e+00 1623/1711 (94%)
text_code_colored.png EPI646024 A/chicken/Jiangsu/WXSB2/2014 (A/H5N6) segment 4 (HA) 2660.3 0.000000e+00 1621/1709 (94%)
text_code_colored.png EPI596622 A/duck/Vietnam/LBM760/2014 (A/H5N6) segment 4 (HA) 2660.3 0.000000e+00 1622/1710 (94%)
text_code_colored.png EPI596616 A/duck/Vietnam/LBM759/2014 (A/H5N6) segment 4 (HA) 2660.3 0.000000e+00 1622/1710 (94%)
text_code_colored.png EPI596604 A/muscovy duck/Vietnam/LBM757/2014 (A/H5N6) segment 4 (HA) 2660.3 0.000000e+00 1622/1710 (94%)
text_code_colored.png EPI586256 A/Little egret/Vietnam/WBT210/2014 (A/H5N6) segment 4 (HA) 2660.3 0.000000e+00 1622/1710 (94%)
text_code_colored.png EPI586255 A/Black-crowned night heron/Vietnam/WBT198/2014 (A/H5N6) segment 4 (HA) 2660.3 0.000000e+00 1622/1710 (94%)
text_code_colored.png EPI586254 A/Spotted dove/Vietnam/WBT191/2014 (A/H5N6) segment 4 (HA) 2660.3 0.000000e+00 1622/1710 (94%)
text_code_colored.png EPI550752 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA) 2660.3 0.000000e+00 1622/1710 (94%)
text_code_colored.png EPI682914 A/chicken/Wuhan/WHYJ02/2015 (A/H5N6) segment 4 (HA) 2654.8 0.000000e+00 1623/1712 (94%)
text_code_colored.png EPI682913 A/chicken/Wuhan/WHYJ01/2015 (A/H5N6) segment 4 (HA) 2654.8 0.000000e+00 1623/1712 (94%)
text_code_colored.png EPI646105 A/goose/Jiangsu/WX202/2014 (A/H5N8) segment 4 (HA) 2654.8 0.000000e+00 1621/1710 (94%)
text_code_colored.png EPI590116 A/chicken/Tonghai/802/2014 (A/H5N1) segment 4 (HA) 2654.8 0.000000e+00 1620/1709 (94%)
text_code_colored.png EPI590115 A/chicken/Tonghai/5/2014 (A/H5N1) segment 4 (HA) 2654.8 0.000000e+00 1620/1709 (94%)
text_code_colored.png EPI590114 A/chicken/Tonghai/3/2014 (A/H5N1) segment 4 (HA) 2654.8 0.000000e+00 1620/1709 (94%)
text_code_colored.png EPI590109 A/chicken/AnNing/1/2014 (A/H5N1) segment 4 (HA) 2654.8 0.000000e+00 1620/1709 (94%)
text_code_colored.png EPI586258 A/Chinese pond heron/Vietnam/WBT231/2014 (A/H5N6) segment 4 (HA) 2654.8 0.000000e+00 1621/1710 (94%)
text_code_colored.png EPI585951 A/chicken/TongHai/302/2014 (A/H5N1) segment 4 (HA) 2654.8 0.000000e+00 1620/1709 (94%)
text_code_colored.png EPI499478 A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA) 2654.8 0.000000e+00 1620/1709 (94%)
text_code_colored.png EPI760116 A/tiger/Yunnan/tig1404/2014 (A/H5N1) segment 4 (HA) 2649.2 0.000000e+00 1619/1709 (94%)
text_code_colored.png EPI758870 A/environment/Guangdong/GZ670/2015 (A/H5N6) segment 4 (HA) 2649.2 0.000000e+00 1618/1708 (94%)
text_code_colored.png EPI758867 A/environment/Guangdong/GZ693/2015 (A/H5N6) segment 4 (HA) 2649.2 0.000000e+00 1617/1707 (94%)
text_code_colored.png EPI681298 A/duck/Zhejiang/925169/2014 (A/H5N8) segment 4 (HA) 2649.2 0.000000e+00 1620/1710 (94%)
text_code_colored.png EPI590898 A/pigeon/Sichuan/NCXN29/2014 (A/H5N1) segment 4 (HA) 2649.2 0.000000e+00 1621/1711 (94%)
text_code_colored.png EPI590897 A/duck/Sichuan/NCXN11/2014 (A/H5N1) segment 4 (HA) 2649.2 0.000000e+00 1621/1711 (94%)
Link to comment
Share on other sites

Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI845370 A/mallard/Alaska/AH0088535/2016 (A/H5N2) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
text_code_colored.png EPI590721 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
text_code_colored.png EPI778500 A/turkey/Minnesota/15-012582-1/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI690470 A/snowy owl/Wisconsin/198399/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI690463 A/Cooper's hawk/Minnesota/198225/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI662746 A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI662739 A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI662725 A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI662718 A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI662711 A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI620410 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI590742 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI590714 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI590687 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
text_code_colored.png EPI778492 A/turkey/South Dakota/15-012511-2/2015 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
text_code_colored.png EPI690387 A/mallard/Washington/196865/2015 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
text_code_colored.png EPI690257 A/American green-winged teal/Oregon/AH0012403/2015 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
text_code_colored.png EPI690182 A/Northern shoveler/Oregon/AH0007337/2015 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
text_code_colored.png EPI662703 A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
text_code_colored.png EPI662683 A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
text_code_colored.png EPI590735 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
text_code_colored.png EPI590728 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
text_code_colored.png EPI573282 A/turkey/Washington/61-22/2014 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
text_code_colored.png EPI690352 A/mallard/Oregon/195547/2014 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI690331 A/mallard/Oregon/AH0003821/2014 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI690243 A/mallard/Idaho/AH0007413/2015 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI690236 A/mallard/Idaho/AH0007412/2015 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI690189 A/Northern shoveler/Oregon/AH0007339/2015 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI690126 A/snow goose/Missouri/15-011246-1/2015 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI662690 A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI586544 A/chicken/BC/FAV23/2014 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI586511 A/poultry/BC/FAV19/2014 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI584081 A/turkey/BC/FAV14/2014 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI573278 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI573273 A/chicken/Washington/61-9/2014 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
text_code_colored.png EPI778508 A/chicken/Iowa/15-013388-1/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI690456 A/Canada goose/Washington/197619/2014 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI690345 A/Northern pintail/Washington/195365/2014 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI690175 A/Northern shoveler/Oregon/AH0007332/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI690168 A/wood duck/Oregon/AH0007263/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI690154 A/wood duck/Oregon/AH0007244/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI690147 A/Northern pintail/Oregon/AH0003967/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI690140 A/mallard/Oregon/AH0003952/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI620459 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI620452 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI620445 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI620438 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI620431 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI620424 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI620417 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI590701 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI587635 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI586520 A/chicken/BC/FAV20/2014 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI585094 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
text_code_colored.png EPI690429 A/mallard/Washington/195246/2014 (A/H5N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI690250 A/American green-winged teal/Idaho/AH0011899/2015 (A/H5N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI690161 A/wood duck/Oregon/AH0007257/2015 (A/H5N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI689404 A/mallard/Southcentral Alaska/12ML00988_AAF1/2014 (A/H5N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI689379 A/mallard/Southcentral Alaska/12ML00991/2014 (A/H5N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI689372 A/mallard/Southcentral Alaska/12ML00985/2014 (A/H0) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI662732 A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI662696 A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI586552 A/chicken/BC/FAV24/2014 (A/H5N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI586528 A/chicken/BC/FAV21/2014 (A/H5N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI586495 A/poultry/BC/FAV15/2014 (A/H5N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI569385 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
text_code_colored.png EPI586536 A/chicken/BC/FAV22/2014 (A/H5N2) segment 6 (NA) 2534.7 0.000000e+00 1397/1410 (99%)
text_code_colored.png EPI690476 A/Canada goose/Kansas/197850/2015 (A/H5N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
text_code_colored.png EPI690221 A/Northern pintail/Oregon/AH0003871/2015 (A/H5N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
text_code_colored.png EPI690214 A/mallard/Oregon/AH0008887/2015 (A/H5N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
text_code_colored.png EPI689389 A/mallard/Southcentral Alaska/12ML01469/2014 (A/H0) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
text_code_colored.png EPI586560 A/chicken/BC/FAV25/2014 (A/H5N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
text_code_colored.png EPI586503 A/poultry/BC/FAV17/2014 (A/H5N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
text_code_colored.png EPI576479 A/chicken/BC/FAV9/2014 (A/H5N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
text_code_colored.png EPI576472 A/chicken/BC/FAV8/2014 (A/H5N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
text_code_colored.png EPI573300 A/turkey/BC/FAV10/2014 (A/H5N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
text_code_colored.png EPI590694 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 6 (NA) 2527.3 0.000000e+00 1396/1410 (99%)
text_code_colored.png EPI690449 A/mallard/Washington/195810/2014 (A/H5N2) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
text_code_colored.png EPI689364 A/mallard/Southcentral Alaska/12ML00977/2014 (A/H5N2) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
text_code_colored.png EPI729571 A/American green-winged teal/Alaska/472/2014 (A/H5N2) segment 6 (NA) 2520.0 0.000000e+00 1394/1410 (98%)
text_code_colored.png EPI690365 A/mallard/Washington/196262/2015 (A/H5N2) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
text_code_colored.png EPI418959 A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
text_code_colored.png EPI812758 A/American wigeon/California/LS257/2014 (A/H5N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
text_code_colored.png EPI512135 A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
text_code_colored.png EPI450007 A/blue-winged teal/Louisiana/AI09-5234/2009 (A/H11N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
text_code_colored.png EPI418609 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
text_code_colored.png EPI332004 A/blue-winged teal/Guatemala/CIP049-10/2009 (A/H11N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
text_code_colored.png EPI331988 A/blue-winged teal/Guatemala/CIP049-03/2009 (A/H11N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
text_code_colored.png EPI512150 A/northern shoveler/Mississippi/12OS456/2012 (A/H14N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
text_code_colored.png EPI420145 A/northern shoveler/California/3676/2010 (A/H8N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
text_code_colored.png EPI419288 A/American wigeon/Iowa/10OS2748/2010 (A/H2N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
text_code_colored.png EPI418807 A/American green-winged teal/Illinois/10OS3589/2010 (A/H6N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
text_code_colored.png EPI418497 A/blue-winged teal/Illinois/10OS3610/2010 (A/H6N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
text_code_colored.png EPI418472 A/mallard/Illinois/10OS3245/2010 (A/H0) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
text_code_colored.png EPI387177 A/mallard/California/2396/2010 (A/H5N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
text_code_colored.png EPI333605 A/American green-winged teal/Mississippi/404/2010 (A/H0) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
text_code_colored.png EPI331996 A/blue-winged teal/Guatemala/CIP049-11/2009 (A/H11N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
text_code_colored.png EPI774891 A/helmeted guineafowl/Colombia/2/2015 (A/H11N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
text_code_colored.png EPI758996 A/helmeted guineafowl/Colombia/2441/2015 (A/H11N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
text_code_colored.png EPI758986 A/helmeted guineafowl/Colombia/2440/2015 (A/H11N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
text_code_colored.png EPI512531 A/gadwall/Mississippi/11OS6084/2011 (A/H11N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
text_code_colored.png EPI512524 A/northern shoveler/Mississippi/11OS6077/2011 (A/H11N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
text_code_colored.png EPI418721 A/mallard/Wisconsin/10OS2538/2010 (A/H3N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
text_code_colored.png EPI512591 A/northern shoveler/Mississippi/11OS5875/2011 (A/H5N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
text_code_colored.png EPI419111 A/gadwall/Mississippi/10OS4531/2010 (A/H6N2) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
text_code_colored.png EPI419077 A/mallard/Wisconsin/10OS3066/2010 (A/H6N2) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
text_code_colored.png EPI616345 A/American green-winged teal/Mississippi/12OS5061/2012 (A/H5N2) segment 6 (NA) 2399.9 0.000000e+00 1373/1410 (97%)
text_code_colored.png EPI419138 A/northern shoveler/Mississippi/10OS4526/2010 (A/H6N2) segment 6 (NA) 2399.9 0.000000e+00 1373/1410 (97%)
text_code_colored.png EPI419118 A/mallard/Mississippi/10OS4593/2010 (A/H1N2) segment 6 (NA) 2399.9 0.000000e+00 1373/1410 (97%)
text_code_colored.png EPI221406 A/American green-winged teal/California/HKWF609/2007 (A/H5N2) segment 6 (NA) 2399.9 0.000000e+00 1373/1410 (97%)
text_code_colored.png EPI419654 A/gadwall/Missouri/10MO0280/2010 (A/H5N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
text_code_colored.png EPI419647 A/mallard/Missouri/10MO0253/2010 (A/H1N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
text_code_colored.png EPI413459 A/mallard/Ohio/11OS2213/2011 (A/H11N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
text_code_colored.png EPI328608 A/northern shoveler/California/8855/2008 (A/H5N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
text_code_colored.png EPI280744 A/avian/Missouri/466554-6/2006 (A/H5N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
text_code_colored.png EPI729672 A/glaucous-winged gull/Alaska/670/2014 (A/H11N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
text_code_colored.png EPI513011 A/northern pintail/Wisconsin/11OS4111/2011 (A/H6N2) segment 6 (NA) 2383.3 0.000000e+00 1371/1411 (97%)
text_code_colored.png EPI328639 A/mallard/California/11100/2008 (A/H11N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
text_code_colored.png EPI328582 A/northern shoveler/California/9680/2008 (A/H6N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
text_code_colored.png EPI328476 A/green-winged teal/California/11285/2008 (A/H0) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
text_code_colored.png EPI328156 A/mallard/California/11353/2008 (A/H10N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
text_code_colored.png EPI736370 A/mallard/Maryland/13OS0755/2013 (A/H9N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
text_code_colored.png EPI328489 A/green-winged teal/California/7972/2008 (A/H6N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
text_code_colored.png EPI328108 A/northern shoveler/California/9017/2008 (A/H11N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
text_code_colored.png EPI729657 A/northern pintail/Alaska/597/2014 (A/H0) segment 6 (NA) 2374.1 0.000000e+00 1369/1411 (97%)
text_code_colored.png EPI419755 A/northern shoveler/California/2815/2011 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
text_code_colored.png EPI327900 A/northern pintail/California/6791/2008 (A/H11N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
text_code_colored.png EPI420032 A/mallard/California/2571V/2011 (A/H0) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
text_code_colored.png EPI420024 A/mallard/California/2571P/2011 (A/H11N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
text_code_colored.png EPI418643 A/mallard/Illinois/10OS3249/2010 (A/H11N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
text_code_colored.png EPI334262 A/mallard/Iowa/3195/2009 (A/H0) segment 6 (NA) 2366.7 0.000000e+00 1368/1411 (96%)
text_code_colored.png EPI729471 A/emperor goose/Alaska/50/2014 (A/H11N2) segment 6 (NA) 2363.0 0.000000e+00 1367/1411 (96%)
text_code_colored.png EPI285601 A/wild bird/Wisconsin/433163-1/2006 (A/H5N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
text_code_colored.png EPI328316 A/mallard/California/6420/2008 (A/H6N2) segment 6 (NA) 2350.1 0.000000e+00 1365/1411 (96%)
text_code_colored.png EPI729541 A/emperor goose/Alaska/462/2014 (A/H0) segment 6 (NA) 2348.2 0.000000e+00 1364/1411 (96%)
text_code_colored.png EPI442430 A/brant/Alaska/44332-426/2007 (A/H10N2) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
text_code_colored.png EPI285602 A/wild bird/Wisconsin/439436-2/2006 (A/H5N2) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
text_code_colored.png EPI285592 A/wild bird/Wisconsin/439436/2006 (A/H5N2) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
text_code_colored.png EPI734845 A/mallard/Maryland/07OS1340/2007 (A/H4N2) segment 6 (NA) 2339.0 0.000000e+00 1362/1410 (96%)
text_code_colored.png EPI734824 A/mallard/Maryland/07OS1315/2007 (A/H4N2) segment 6 (NA) 2339.0 0.000000e+00 1362/1410 (96%)
text_code_colored.png EPI299469 A/American green-winged teal/Wisconsin/08OS2291/2008 (A/H3N2) segment 6 (NA) 2339.0 0.000000e+00 1362/1410 (96%)
text_code_colored.png EPI299389 A/gadwall/Wisconsin/08OS2293/2008 (A/H3N2) segment 6 (NA) 2339.0 0.000000e+00 1362/1410 (96%)
text_code_colored.png EPI299381 A/American green-winged teal/Wisconsin/08OS2292/2008 (A/H3N2) segment 6 (NA) 2339.0 0.000000e+00 1362/1410 (96%)
text_code_colored.png EPI280848 A/wild bird/Minnesota/460613-12/2006 (A/H5N2) segment 6 (NA) 2339.0 0.000000e+00 1362/1410 (96%)
text_code_colored.png EPI734838 A/mallard/Maryland/07OS1338/2007 (A/H4N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI734817 A/mallard/Maryland/07OS1309/2007 (A/H4N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI449517 A/mallard/Minnesota/Sg-00847/2008 (A/H0) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI413390 A/mallard/Ohio/10OS1470/2010 (A/H3N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI413383 A/mallard/Ohio/10OS1469/2010 (A/H3N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI413369 A/mallard/Ohio/10OS1467/2010 (A/H3N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI285597 A/mallard/NV/450206/2006 (A/H5N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI285595 A/mallard/NV/449567-4/2006 (A/H5N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI285594 A/mallard/NV/449567-2/2006 (A/H5N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI280656 A/mallard/Arkansas/473507-9/2006 (A/H5N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI280544 A/mallard/Nevada/450206-4/2006 (A/H5N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI222394 A/northern pintail/Saskatchewan/22910/2007 (A/H3N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
text_code_colored.png EPI187901 A/mallard/Minnesota/Sg-00129/2007 (A/H6N2) segment 6 (NA) 2329.7 0.000000e+00 1353/1399 (96%)
text_code_colored.png EPI449695 A/green-winged teal/Minnesota/Sg-01073/2008 (A/H6N2) segment 6 (NA) 2327.9 0.000000e+00 1360/1410 (96%)
text_code_colored.png EPI449653 A/mallard/Minnesota/Sg-01040/2008 (A/H3N2) segment 6 (NA) 2327.9 0.000000e+00 1360/1410 (96%)
text_code_colored.png EPI285593 A/mallard/NV/449567-1/2006 (A/H5N2) segment 6 (NA) 2327.9 0.000000e+00 1360/1410 (96%)
text_code_colored.png EPI280552 A/mallard/Nevada/449567-3/2006 (A/H5N2) segment 6 (NA) 2327.9 0.000000e+00 1360/1410 (96%)
text_code_colored.png EPI76383 A/mallard/Maryland/182/2006 (A/H5N2) segment 6 (NA) 2327.9 0.000000e+00 1360/1410 (96%)
text_code_colored.png EPI513071 A/American green-winged teal/Wisconsin/11OS3580/2011 (A/H12N2) segment 6 (NA) 2322.4 0.000000e+00 1359/1410 (96%)
text_code_colored.png EPI513025 A/blue-winged teal/Iowa/44555-551/2011 (A/H3N2) segment 6 (NA) 2322.4 0.000000e+00 1359/1410 (96%)
text_code_colored.png EPI512972 A/blue-winged teal/Wisconsin/11OS3052/2011 (A/H3N2) segment 6 (NA) 2322.4 0.000000e+00 1359/1410 (96%)
text_code_colored.png EPI512920 A/mallard/Wisconsin/11OS3106/2011 (A/H3N2) segment 6 (NA) 2322.4 0.000000e+00 1359/1410 (96%)
text_code_colored.png EPI512832 A/mallard/Wisconsin/11OS3491/2011 (A/H4N2) segment 6 (NA) 2322.4 0.000000e+00 1359/1410 (96%)
text_code_colored.png EPI512507 A/mallard/Wisconsin/11OS3171/2011 (A/H3N2) segment 6 (NA) 2322.4 0.000000e+00 1359/1410 (96%)
text_code_colored.png EPI419063 A/American green-winged teal/Wisconsin/10OS2955/2010 (A/H5N2) segment 6 (NA) 2322.4 0.000000e+00 1359/1410 (96%)
text_code_colored.png EPI334137 A/blue-winged teal/Wisconsin/3060/2009 (A/H3N2) segment 6 (NA) 2322.4 0.000000e+00 1359/1410 (96%)
text_code_colored.png EPI299648 A/American green-winged teal/Illinois/08OS2311/2008 (A/H0) segment 6 (NA) 2322.4 0.000000e+00 1360/1411 (96%)
text_code_colored.png EPI299477 A/gadwall/Wisconsin/08OS2296/2008 (A/H6N2) segment 6 (NA) 2322.4 0.000000e+00 1360/1411 (96%)
text_code_colored.png EPI285598 A/mallard/NV/453350-8/2006 (A/H5N2) segment 6 (NA) 2322.4 0.000000e+00 1359/1410 (96%)
text_code_colored.png EPI513085 A/mallard/Wisconsin/11OS4104/2011 (A/H1N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
text_code_colored.png EPI512986 A/mallard/Wisconsin/11OS3079/2011 (A/H3N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
text_code_colored.png EPI455888 A/mallard/New Jersey/Sg-00884/2008 (A/H11N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
text_code_colored.png EPI419090 A/mallard/Wisconsin/10OS3067/2010 (A/H4N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
text_code_colored.png EPI419070 A/mallard/Wisconsin/10OS3051/2010 (A/H4N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
text_code_colored.png EPI413404 A/mallard/Michigan/10OS1497/2010 (A/H3N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
text_code_colored.png EPI285578 A/northern pintail/Wisconsin/462764/2006 (A/H5N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
text_code_colored.png EPI220636 A/mallard/South Dakota/Sg-00457/2008 (A/H4N2) segment 6 (NA) 2315.0 0.000000e+00 1351/1400 (96%)
text_code_colored.png EPI734348 A/mallard/Maryland/10OS1094/2010 (A/H3N2) segment 6 (NA) 2311.3 0.000000e+00 1357/1410 (96%)
text_code_colored.png EPI734292 A/mallard/Maryland/10OS1087/2010 (A/H3N2) segment 6 (NA) 2311.3 0.000000e+00 1357/1410 (96%)
text_code_colored.png EPI513141 A/American green-winged teal/Wisconsin/11OS3069/2011 (A/H0) segment 6 (NA) 2311.3 0.000000e+00 1357/1410 (96%)
text_code_colored.png EPI513133 A/mallard/Wisconsin/11OS4085/2011 (A/H0) segment 6 (NA) 2311.3 0.000000e+00 1357/1410 (96%)
text_code_colored.png EPI513105 A/mallard/Wisconsin/11OS4492/2011 (A/H4N2) segment 6 (NA) 2311.3 0.000000e+00 1357/1410 (96%)
text_code_colored.png EPI512955 A/greater scaup/Wisconsin/11OS5760/2011 (A/H10N2) segment 6 (NA) 2311.3 0.000000e+00 1357/1410 (96%)
text_code_colored.png EPI418714 A/mallard/Wisconsin/10OS2524/2010 (A/H11N2) segment 6 (NA) 2311.3 0.000000e+00 1357/1410 (96%)
text_code_colored.png EPI512993 A/mallard/Wisconsin/11OS3092/2011 (A/H3N2) segment 6 (NA) 2305.7 0.000000e+00 1356/1410 (96%)
text_code_colored.png EPI734404 A/mallard/Maryland/10OS1953/2010 (A/H3N2) segment 6 (NA) 2300.2 0.000000e+00 1355/1410 (96%)
text_code_colored.png EPI512941 A/mallard/Illinois/11OS4311/2011 (A/H4N2) segment 6 (NA) 2300.2 0.000000e+00 1355/1410 (96%)
text_code_colored.png EPI455945 A/mallard/New Jersey/Sg-00942/2008 (A/H0) segment 6 (NA) 2300.2 0.000000e+00 1355/1410 (96%)
text_code_colored.png EPI448307 A/mallard/Minnesota/346250/2000 (A/H5N2) segment 6 (NA) 2300.2 0.000000e+00 1356/1411 (96%)
text_code_colored.png EPI327355 A/American black duck/Newfoundland and Labrador/26516/2007 (A/H3N2) segment 6 (NA) 2300.2 0.000000e+00 1355/1410 (96%)
text_code_colored.png EPI292632 A/mallard/Washington/44338-120/2007 (A/H6N2) segment 6 (NA) 2300.2 0.000000e+00 1355/1410 (96%)
text_code_colored.png EPI159142 A/mallard/MN/113/2000 (A/H5N2) segment 6 (NA) 2300.2 0.000000e+00 1356/1411 (96%)
text_code_colored.png EPI734391 A/mallard/Maryland/10OS1934/2010 (A/H3N2) segment 6 (NA) 2294.7 0.000000e+00 1354/1410 (96%)
text_code_colored.png EPI733525 A/mallard/Maryland/07OS2433/2007 (A/H5N2) segment 6 (NA) 2294.7 0.000000e+00 1354/1410 (96%)
text_code_colored.png EPI513093 A/long-tailed duck/Wisconsin/11OS4599/2011 (A/H4N2) segment 6 (NA) 2294.7 0.000000e+00 1354/1410 (96%)
text_code_colored.png EPI234273 A/blue-winged teal/Minnesota/Sg-00797/2008 (A/H3N2) segment 6 (NA) 2294.7 0.000000e+00 1340/1389 (96%)
text_code_colored.png EPI165988 A/mallard/MN/1/2000 (A/H5N2) segment 6 (NA) 2294.7 0.000000e+00 1355/1411 (96%)
text_code_colored.png EPI187967 A/mallard/Minnesota/Sg-00187/2007 (A/H11N2) segment 6 (NA) 2292.8 0.000000e+00 1331/1376 (96%)
text_code_colored.png EPI733532 A/mallard/Maryland/07OS2435/2007 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
text_code_colored.png EPI448776 A/mallard/Minnesota/355779/2000 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1354/1411 (95%)
text_code_colored.png EPI292624 A/mallard/Washington/44338-112/2007 (A/H6N2) segment 6 (NA) 2289.1 0.000000e+00 1354/1411 (95%)
text_code_colored.png EPI328100 A/northern shoveler/California/9187/2008 (A/H6N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
text_code_colored.png EPI486103 A/northern pintail/California/1865/2009 (A/H9N2) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
text_code_colored.png EPI290887 A/rock dove/Oregon/20547-004/2007 (A/H1N2) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
text_code_colored.png EPI290879 A/rock dove/Oregon/20547-003/2007 (A/H1N2) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
text_code_colored.png EPI391942 A/blue-winged teal/New Brunswick/03756/2009 (A/H4N2) segment 6 (NA) 2272.5 0.000000e+00 1350/1410 (95%)
text_code_colored.png EPI18635 A/turkey/CA/D0208652-C/02 (A/H5N2) segment 6 (NA) 2267.0 0.000000e+00 1350/1411 (95%)
text_code_colored.png EPI33729 A/blue-winged teal/Ohio/908/2002 (A/H3N2) segment 6 (NA) 2261.4 0.000000e+00 1349/1411 (95%)
text_code_colored.png EPI327964 A/green-winged teal/California/8326/2008 (A/H1N2) segment 6 (NA) 2255.9 0.000000e+00 1347/1410 (95%)
text_code_colored.png EPI447997 A/blue-winged teal/Texas/AI09-6182/2009 (A/H6N2) segment 6 (NA) 2250.3 0.000000e+00 1346/1410 (95%)
text_code_colored.png EPI327812 A/mallard/California/5250/2009 (A/H5N2) segment 6 (NA) 2250.3 0.000000e+00 1346/1410 (95%)
text_code_colored.png EPI327772 A/mallard/California/5495/2009 (A/H4N2) segment 6 (NA) 2250.3 0.000000e+00 1346/1410 (95%)
text_code_colored.png EPI327756 A/mallard/California/5149/2009 (A/H5N2) segment 6 (NA) 2250.3 0.000000e+00 1346/1410 (95%)
text_code_colored.png EPI476363 A/blue-winged teal/Canada/3296/2011 (A/H11N2) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
text_code_colored.png EPI456563 A/mallard/Arkansas/AI09-5649/2009 (A/H9N2) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
text_code_colored.png EPI328252 A/mallard/California/8035/2008 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
text_code_colored.png EPI327820 A/mallard/California/5222/2009 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
text_code_colored.png EPI327796 A/mallard/California/5276/2009 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
text_code_colored.png EPI327780 A/mallard/California/5296/2009 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
text_code_colored.png EPI327748 A/mallard/California/5174/2009 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
text_code_colored.png EPI327732 A/mallard/California/5205/2009 (A/H0) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
text_code_colored.png EPI327716 A/mallard/California/5319/2009 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
text_code_colored.png EPI327692 A/mallard/California/5386/2009 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
text_code_colored.png EPI327676 A/mallard/California/5191/2009 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
text_code_colored.png EPI162405 A/mallard/MD/185/2003 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1346/1411 (95%)
text_code_colored.png EPI387352 A/mallard/California/5197/2009 (A/H5N2) segment 6 (NA) 2239.3 0.000000e+00 1344/1410 (95%)
text_code_colored.png EPI327828 A/mallard/California/5212/2009 (A/H5N2) segment 6 (NA) 2239.3 0.000000e+00 1344/1410 (95%)
text_code_colored.png EPI327764 A/mallard/California/5502/2009 (A/H5N2) segment 6 (NA) 2239.3 0.000000e+00 1344/1410 (95%)
text_code_colored.png EPI327740 A/mallard/California/5192/2009 (A/H4N2) segment 6 (NA) 2239.3 0.000000e+00 1344/1410 (95%)
text_code_colored.png EPI327700 A/mallard/California/5359/2009 (A/H5N2) segment 6 (NA) 2239.3 0.000000e+00 1344/1410 (95%)
text_code_colored.png EPI280488 A/wild bird/Minnesota/459254-5/2006 (A/H5N2) segment 6 (NA) 2239.3 0.000000e+00 1345/1411 (95%)
text_code_colored.png EPI59460 A/environment/Ohio/1001/2005 (A/H3N2) segment 6 (NA) 2239.3 0.000000e+00 1345/1411 (95%)
text_code_colored.png EPI45682 A/gadwall/Ohio/37/1999 (A/H6N2) segment 6 (NA) 2239.3 0.000000e+00 1345/1411 (95%)
text_code_colored.png EPI414478 A/mallard/Interior Alaska/10BM02980R0/2010 (A/H9N2) segment 6 (NA) 2233.7 0.000000e+00 1343/1410 (95%)
text_code_colored.png EPI395064 A/northern pintail/Interior Alaska/10BM14807R2/2010 (A/H9N2) segment 6 (NA) 2233.7 0.000000e+00 1343/1410 (95%)
text_code_colored.png EPI395050 A/American green-winged teal/Interior Alaska/10BM16586R0/2010 (A/H0) segment 6 (NA) 2233.7 0.000000e+00 1343/1410 (95%)
text_code_colored.png EPI387219 A/American wigeon/California/3180/2010 (A/H5N2) segment 6 (NA) 2233.7 0.000000e+00 1343/1410 (95%)
text_code_colored.png EPI327684 A/mallard/California/5491/2009 (A/H5N2) segment 6 (NA) 2233.7 0.000000e+00 1343/1410 (95%)
text_code_colored.png EPI280856 A/waterfowl/Minnesota/459675/2006 (A/H5N2) segment 6 (NA) 2233.7 0.000000e+00 1344/1411 (95%)
text_code_colored.png EPI171087 A/environment/New York/11653-1/2005 (A/H5N2) segment 6 (NA) 2233.7 0.000000e+00 1344/1411 (95%)
text_code_colored.png EPI59840 A/green-winged teal/Ohio/1747/2005 (A/H11N2) segment 6 (NA) 2233.7 0.000000e+00 1344/1411 (95%)
text_code_colored.png EPI187903 A/green-winged teal/Minnesota/Sg-00131/2007 (A/H3N2) segment 6 (NA) 2230.0 0.000000e+00 1336/1400 (95%)
text_code_colored.png EPI645362 A/American green-winged teal/Ohio/13OS1769/2013 (A/H7N2) segment 6 (NA) 2228.2 0.000000e+00 1343/1411 (95%)
text_code_colored.png EPI595341 A/mallard/Maryland/06OS196/2006 (A/H6N2) segment 6 (NA) 2228.2 0.000000e+00 1343/1411 (95%)
text_code_colored.png EPI459696 A/northern shoveler/California/2696/2011 (A/H14N2) segment 6 (NA) 2228.2 0.000000e+00 1342/1410 (95%)
text_code_colored.png EPI420246 A/northern pintail/California/2548/2010 (A/H11N2) segment 6 (NA) 2228.2 0.000000e+00 1342/1410 (95%)
text_code_colored.png EPI419476 A/northern shoveler/Arkansas/11OS386/2011 (A/H9N2) segment 6 (NA) 2228.2 0.000000e+00 1342/1410 (95%)
text_code_colored.png EPI395071 A/northern shoveler/Interior Alaska/10BM16764R0/2010 (A/H9N2) segment 6 (NA) 2228.2 0.000000e+00 1342/1410 (95%)
text_code_colored.png EPI387226 A/northern shoveler/California/3183/2010 (A/H11) segment 6 (NA) 2228.2 0.000000e+00 1343/1411 (95%)
text_code_colored.png EPI280792 A/green winged teal/Ohio/464069/2006 (A/H5N2) segment 6 (NA) 2228.2 0.000000e+00 1343/1411 (95%)
text_code_colored.png EPI280776 A/mallard/Indiana/465297-2/2006 (A/H5N2) segment 6 (NA) 2228.2 0.000000e+00 1344/1412 (95%)
text_code_colored.png EPI227357 A/mallard/Quebec/16566/2005 (A/H11N2) segment 6 (NA) 2228.2 0.000000e+00 1343/1411 (95%)
text_code_colored.png EPI751977 A/blue-winged teal/Louisiana/UGAI14-2408/2014 (A/H4N2) segment 6 (NA) 2222.6 0.000000e+00 1342/1411 (95%)
text_code_colored.png EPI526285 A/blue-winged teal/Ohio/13OS1831/2013 (A/H3N2) segment 6 (NA) 2222.6 0.000000e+00 1342/1411 (95%)
text_code_colored.png EPI454861 A/American black duck/North Carolina/1321373/2004 (A/H3N2) segment 6 (NA) 2222.6 0.000000e+00 1342/1411 (95%)
text_code_colored.png EPI405105 A/American black duck/New Brunswick/02651/2007 (A/H3N2) segment 6 (NA) 2222.6 0.000000e+00 1342/1411 (95%)
text_code_colored.png EPI404704 A/American black duck/New Brunswick/02650/2007 (A/H3N2) segment 6 (NA) 2222.6 0.000000e+00 1342/1411 (95%)
text_code_colored.png EPI187907 A/northern shoveler/Minnesota/Sg-00138/2007 (A/H3N2) segment 6 (NA) 2222.6 0.000000e+00 1336/1402 (95%)
text_code_colored.png EPI173525 A/mallard/Maryland/897/2004 (A/H5N2) segment 6 (NA) 2222.6 0.000000e+00 1342/1411 (95%)
text_code_colored.png EPI55261 A/environment/Ohio/994/2005 (A/H3N2) segment 6 (NA) 2222.6 0.000000e+00 1342/1411 (95%)
text_code_colored.png EPI187902 A/green-winged teal/Minnesota/Sg-00130/2007 (A/H3N2) segment 6 (NA) 2218.9 0.000000e+00 1330/1394 (95%)
text_code_colored.png EPI762325 A/mallard/Southcentral Alaska/12ML01015/2014 (A/H9N2) segment 6 (NA) 2217.1 0.000000e+00 1340/1410 (95%)
text_code_colored.png EPI762239 A/mallard/Southcentral Alaska/12ML00951/2014 (A/H9N2) segment 6 (NA) 2217.1 0.000000e+00 1340/1410 (95%)
text_code_colored.png EPI596185 A/mallard/Maryland/13OS2946/2013 (A/H5N2) segment 6 (NA) 2217.1 0.000000e+00 1341/1411 (95%)
text_code_colored.png EPI449100 A/common murre/Newfoundland/AB341/2011 (A/H1N2) segment 6 (NA) 2217.1 0.000000e+00 1341/1411 (95%)
text_code_colored.png EPI280688 A/mallard/Kentucky/472048-2/2006 (A/H5N2) segment 6 (NA) 2217.1 0.000000e+00 1341/1411 (95%)
text_code_colored.png EPI526321 A/American green-winged teal/Ohio/13OS2056/2013 (A/H3N2) segment 6 (NA) 2211.6 0.000000e+00 1340/1411 (94%)
text_code_colored.png EPI510556 A/mallard/QC/2323-25/2006 (A/H5N2) segment 6 (NA) 2211.6 0.000000e+00 1339/1410 (94%)
text_code_colored.png EPI327469 A/unknown/New York/59316/2006 (A/H5N2) segment 6 (NA) 2211.6 0.000000e+00 1341/1412 (94%)
text_code_colored.png EPI280752 A/mallard/Michigan/466547-5/2006 (A/H5N2) segment 6 (NA) 2211.6 0.000000e+00 1340/1411 (94%)
text_code_colored.png EPI255437 A/chicken/New York/439235/2006 (A/H5N2) segment 6 (NA) 2211.6 0.000000e+00 1340/1411 (94%)
text_code_colored.png EPI178104 A/northern pintail/California/44242-758/2006 (A/H5N2) segment 6 (NA) 2211.6 0.000000e+00 1297/1347 (96%)
text_code_colored.png EPI167456 A/Muscovy duck/New York/62095-1/2006 (A/H5N2) segment 6 (NA) 2211.6 0.000000e+00 1340/1411 (94%)
text_code_colored.png EPI595369 A/mallard/Maryland/06OS2460/2006 (A/H2N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
text_code_colored.png EPI455908 A/mallard/New Jersey/Sg-00893/2008 (A/H3N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
text_code_colored.png EPI455895 A/mallard/New Jersey/Sg-00888/2008 (A/H3N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
text_code_colored.png EPI449126 A/common murre/Newfoundland/AB364/2011 (A/H1N2) segment 6 (NA) 2206.0 0.000000e+00 1341/1413 (94%)
text_code_colored.png EPI334336 A/mallard/Wisconsin/2543/2009 (A/H3N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
text_code_colored.png EPI280496 A/green winged teal/Delaware/458672-5/2006 (A/H5N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
text_code_colored.png EPI275225 A/thick-billed murre/Alaska/44085-155/2006 (A/H9N2) segment 6 (NA) 2206.0 0.000000e+00 1340/1412 (94%)
text_code_colored.png EPI255451 A/duck/New York/445743/2006 (A/H5N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
text_code_colored.png EPI177177 A/unknown/New York/78436/2006 (A/H5N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
text_code_colored.png EPI275226 A/thick-billed murre/Alaska/44145-186/2006 (A/H9N2) segment 6 (NA) 2202.3 0.000000e+00 1339/1412 (94%)
text_code_colored.png EPI812885 A/American wigeon/California/COL041/2014 (A/H5N2) segment 6 (NA) 2200.5 0.000000e+00 1337/1410 (94%)
text_code_colored.png EPI735373 A/mallard/Ohio/14OS0999/2014 (A/H3N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI735365 A/mallard/Ohio/14OS0992/2014 (A/H0) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI735275 A/mallard/Ohio/14OS0589/2014 (A/H3N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI735243 A/mallard/Ohio/14OS0570/2014 (A/H0) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI735234 A/mallard/Ohio/14OS0569/2014 (A/H3N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI735200 A/mallard/Ohio/14OS0554/2014 (A/H3N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI735172 A/mallard/Ohio/14OS0468/2014 (A/H3N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI734700 A/mallard/Maryland/06OS471/2006 (A/H5N2) segment 6 (NA) 2200.5 0.000000e+00 1340/1413 (94%)
text_code_colored.png EPI734613 A/mallard/Maryland/05OS694/2005 (A/H3N2) segment 6 (NA) 2200.5 0.000000e+00 1340/1413 (94%)
text_code_colored.png EPI734174 A/mallard/Maryland/09OS1351/2009 (A/H3N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI734167 A/mallard/Maryland/09OS1350/2009 (A/H3N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI731704 A/mallard/Ohio/14OS0560/2014 (A/H5N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI512927 A/mallard/Illinois/11OS4121/2011 (A/H6N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI419748 A/northern shoveler/California/2810/2011 (A/H11N2) segment 6 (NA) 2200.5 0.000000e+00 1337/1410 (94%)
text_code_colored.png EPI285567 A/chicken/Pennsylvania/446080-7/2006 (A/H5N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI280840 A/mallard/Oregon/461067-2/2006 (A/H5N2) segment 6 (NA) 2200.5 0.000000e+00 1339/1412 (94%)
text_code_colored.png EPI280712 A/green winged teal/Ohio/468160/2006 (A/H5N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI280640 A/Canada goose/New York/475813-2/2007 (A/H5N2) segment 6 (NA) 2200.5 0.000000e+00 1339/1412 (94%)
text_code_colored.png EPI280576 A/duck/Pennsylvania/446080-6/2006 (A/H5N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI280568 A/duck/Pennsylvania/446080-7/2006 (A/H5N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
text_code_colored.png EPI229366 A/chicken/PA/298101-4/2004 (A/H2N2) segment 6 (NA) 2200.5 0.000000e+00 1340/1413 (94%)
text_code_colored.png EPI60087 A/mallard/Maryland/631/2005 (A/H3N2) segment 6 (NA) 2200.5 0.000000e+00 1340/1413 (94%)
text_code_colored.png EPI812974 A/northern shoveler/California/LDC391/2015 (A/H11) segment 6 (NA) 2194.9 0.000000e+00 1338/1412 (94%)
text_code_colored.png EPI735352 A/mallard/Ohio/14OS0986/2014 (A/H3N2) segment 6 (NA) 2194.9 0.000000e+00 1337/1411 (94%)
text_code_colored.png EPI735290 A/mallard/Ohio/14OS0961/2014 (A/H3N2) segment 6 (NA) 2194.9 0.000000e+00 1337/1411 (94%)
text_code_colored.png EPI735179 A/mallard/Ohio/14OS0470/2014 (A/H3N2) segment 6 (NA) 2194.9 0.000000e+00 1337/1411 (94%)
text_code_colored.png EPI734632 A/mallard/Maryland/05OS693/2005 (A/H3N2) segment 6 (NA) 2194.9 0.000000e+00 1339/1413 (94%)
text_code_colored.png EPI734625 A/mallard/Maryland/05OS677/2005 (A/H3N2) segment 6 (NA) 2194.9 0.000000e+00 1339/1413 (94%)
text_code_colored.png EPI734618 A/mallard/Maryland/05OS630/2005 (A/H3N2) segment 6 (NA) 2194.9 0.000000e+00 1339/1413 (94%)
text_code_colored.png EPI645432 A/northern pintail/Wisconsin/13OS2778/2013 (A/H6N2) segment 6 (NA) 2194.9 0.000000e+00 1337/1411 (94%)
text_code_colored.png EPI486682 A/mallard/California/3070/2012 (A/H11N2) segment 6 (NA) 2194.9 0.000000e+00 1336/1410 (94%)
text_code_colored.png EPI290537 A/northern shoveler/Washington/44249-604/2006 (A/H9N2) segment 6 (NA) 2194.9 0.000000e+00 1338/1412 (94%)
text_code_colored.png EPI285582 A/Northern shoveler/Washington/467923/2006 (A/H5N2) segment 6 (NA) 2194.9 0.000000e+00 1338/1412 (94%)
text_code_colored.png EPI63472 A/mallard/Maryland/712/2005 (A/H3N2) segment 6 (NA) 2194.9 0.000000e+00 1339/1413 (94%)
text_code_colored.png EPI60505 A/mallard/Maryland/615/2005 (A/H3N2) segment 6 (NA) 2194.9 0.000000e+00 1339/1413 (94%)
text_code_colored.png EPI60068 A/mallard/Maryland/691/2005 (A/H3N2) segment 6 (NA) 2194.9 0.000000e+00 1339/1413 (94%)
text_code_colored.png EPI60049 A/mallard/Maryland/681/2005 (A/H3N2) segment 6 (NA) 2194.9 0.000000e+00 1339/1413 (94%)
text_code_colored.png EPI734652 A/mallard/Maryland/05OS713/2005 (A/H3N2) segment 6 (NA) 2189.4 0.000000e+00 1338/1413 (94%)
text_code_colored.png EPI290593 A/northern shoveler/Washington/44249-645/2006 (A/H5N2) segment 6 (NA) 2189.4 0.000000e+00 1337/1412 (94%)
text_code_colored.png EPI280696 A/northern pintail/California/469993/2006 (A/H5N2) segment 6 (NA) 2189.4 0.000000e+00 1337/1412 (94%)
text_code_colored.png EPI227317 A/mallard.Maryland/708/2005 (A/H3N2) segment 6 (NA) 2189.4 0.000000e+00 1338/1413 (94%)
text_code_colored.png EPI60524 A/mallard/Maryland/710/2005 (A/H3N2) segment 6 (NA) 2189.4 0.000000e+00 1338/1413 (94%)
text_code_colored.png EPI615682 A/duck/Peru-PuV196/2009 (A/H10N2) segment 6 (NA) 2185.7 0.000000e+00 1307/1369 (95%)
text_code_colored.png EPI734645 A/mallard/Maryland/05OS702/2005 (A/H3N2) segment 6 (NA) 2183.9 0.000000e+00 1337/1413 (94%)
text_code_colored.png EPI290681 A/northern shoveler/Washington/44249-675/2006 (A/H10N2) segment 6 (NA) 2183.9 0.000000e+00 1336/1412 (94%)
text_code_colored.png EPI512605 A/American widgeon/Mississippi/11OS6073/2011 (A/H6N2) segment 6 (NA) 2178.3 0.000000e+00 1333/1410 (94%)
text_code_colored.png EPI280704 A/northern pintail/Utah/469648/2006 (A/H5N2) segment 6 (NA) 2178.3 0.000000e+00 1335/1412 (94%)
text_code_colored.png EPI750378 A/greater white-fronted goose/Alaska/UGAI15-3913/2015 (A/H6N2) segment 6 (NA) 2172.8 0.000000e+00 1332/1410 (94%)
text_code_colored.png EPI442476 A/tundra swan/Alaska/44049-168/2006 (A/H5N2) segment 6 (NA) 2167.2 0.000000e+00 1332/1411 (94%)
text_code_colored.png EPI442449 A/greater white-fronted goose/Alaska/44065-031/2006 (A/H5N2) segment 6 (NA) 2167.2 0.000000e+00 1332/1411 (94%)
text_code_colored.png EPI442447 A/greater white-fronted goose/Alaska/44049-046/2006 (A/H5N2) segment 6 (NA) 2167.2 0.000000e+00 1332/1411 (94%)
text_code_colored.png EPI280600 A/white front goose/Alaska/477003/2007 (A/H5N2) segment 6 (NA) 2167.2 0.000000e+00 1332/1411 (94%)
text_code_colored.png EPI280584 A/tundra swan/Alaska/442960/2006 (A/H5N2) segment 6 (NA) 2167.2 0.000000e+00 1332/1411 (94%)
text_code_colored.png EPI280480 A/waterfowl/Colorado/443593/2006 (A/H5N2) segment 6 (NA) 2167.2 0.000000e+00 1332/1411 (94%)
text_code_colored.png EPI154587 A/northern shoveler/California/HKWF268/2007 (A/H6N2) segment 6 (NA) 2167.2 0.000000e+00 1333/1412 (94%)
text_code_colored.png EPI2451 A/duck/Hokkaido/5/1977 (A/H3N2) segment 6 (NA) 2167.2 0.000000e+00 1331/1410 (94%)
text_code_colored.png EPI750414 A/cackling goose/Alaska/UGAI15-3075/2015 (A/H9N2) segment 6 (NA) 2161.7 0.000000e+00 1330/1410 (94%)
text_code_colored.png EPI290823 A/northern shoveler/California/44363-062/2007 (A/H9N2) segment 6 (NA) 2161.7 0.000000e+00 1332/1412 (94%)
text_code_colored.png EPI285596 A/mallard/NV/449567-5/2006 (A/H5N2) segment 6 (NA) 2159.9 0.000000e+00 1261/1307 (96%)
text_code_colored.png EPI270365 A/thick-billed murre/Newfoundland/031/2007 (A/H11N2) segment 6 (NA) 2158.0 0.000000e+00 1318/1392 (94%)
text_code_colored.png EPI280504 A/waterfowl/Colorado/457952-2/2006 (A/H5N2) segment 6 (NA) 2156.2 0.000000e+00 1330/1411 (94%)
text_code_colored.png EPI3423 A/duck/Hong Kong/301/1978 (A/H7N2) segment 6 (NA) 2145.1 0.000000e+00 1327/1410 (94%)
text_code_colored.png EPI289817 A/mallard/Alaska/44430-052/2008 (A/H7N2) segment 6 (NA) 2141.4 0.000000e+00 1328/1412 (94%)
text_code_colored.png EPI547659 A/seagull/Chile/SAG14259/2007 (A/H13N2) segment 6 (NA) 2139.5 0.000000e+00 1327/1411 (94%)
text_code_colored.png EPI300721 A/swine/KU/16/2001 (A/H7N2) segment 6 (NA) 2139.5 0.000000e+00 1326/1410 (94%)
text_code_colored.png EPI328260 A/mallard/California/8028/2008 (A/H11N2) segment 6 (NA) 2134.0 0.000000e+00 1327/1412 (93%)
text_code_colored.png EPI290721 A/northern shoveler/Washington/44249-765/2006 (A/H10N2) segment 6 (NA) 2134.0 0.000000e+00 1329/1414 (93%)
text_code_colored.png EPI89425 A/duck/Hong Kong/293/1978 (A/H7N2) segment 6 (NA) 2134.0 0.000000e+00 1326/1411 (93%)
text_code_colored.png EPI100260 A/duck/BritishColumbia/CN26-6/05 (A/H5N2) segment 6 (NA) 2130.3 0.000000e+00 1295/1365 (94%)
text_code_colored.png EPI442448 A/greater white-fronted goose/Alaska/44064-108/2006 (A/H3N2) segment 6 (NA) 2128.5 0.000000e+00 1328/1414 (93%)
text_code_colored.png EPI403031 A/shorebird/Delaware Bay/208/2001 (A/H6N2) segment 6 (NA) 2128.5 0.000000e+00 1327/1413 (93%)
text_code_colored.png EPI343818 A/shorebird/Delaware Bay/113/2001 (A/H0) segment 6 (NA) 2128.5 0.000000e+00 1327/1413 (93%)
text_code_colored.png EPI299800 A/mallard/Interior Alaska/6MP0990R1/2006 (A/H0) segment 6 (NA) 2128.5 0.000000e+00 1328/1414 (93%)
text_code_colored.png EPI298684 A/mallard/Interior Alaska/6MP0988/2006 (A/H0) segment 6 (NA) 2128.5 0.000000e+00 1328/1414 (93%)
text_code_colored.png EPI298572 A/mallard/Interior Alaska/6MP0992/2006 (A/H3N2) segment 6 (NA) 2128.5 0.000000e+00 1328/1414 (93%)
text_code_colored.png EPI298564 A/mallard/Interior Alaska/6MP0991/2006 (A/H3N2) segment 6 (NA) 2128.5 0.000000e+00 1328/1414 (93%)
text_code_colored.png EPI289818 A/mallard/Alaska/44185-067/2006 (A/H3N2) segment 6 (NA) 2128.5 0.000000e+00 1328/1414 (93%)
text_code_colored.png EPI289816 A/mallard/Alaska/44187-131/2006 (A/H3N2) segment 6 (NA) 2128.5 0.000000e+00 1328/1414 (93%)
text_code_colored.png EPI289815 A/mallard/Alaska/44187-129/2006 (A/H3N2) segment 6 (NA) 2128.5 0.000000e+00 1328/1414 (93%)
text_code_colored.png EPI289814 A/mallard/Alaska/44185-078/2006 (A/H3N2) segment 6 (NA) 2128.5 0.000000e+00 1328/1414 (93%)
text_code_colored.png EPI289813 A/mallard/Alaska/44185-044/2006 (A/H3N2) segment 6 (NA) 2128.5 0.000000e+00 1328/1414 (93%)
text_code_colored.png EPI403024 A/shorebird/Delaware Bay/124/2001 (A/H6N2) segment 6 (NA) 2122.9 0.000000e+00 1326/1413 (93%)
text_code_colored.png EPI343828 A/shorebird/Delaware Bay/77/2001 (A/H6N2) segment 6 (NA) 2122.9 0.000000e+00 1326/1413 (93%)
text_code_colored.png EPI285566 A/duck/New York/440410/2006 (A/H5N2) segment 6 (NA) 2122.9 0.000000e+00 1288/1357 (94%)
text_code_colored.png EPI289819 A/mallard/Alaska/44185-043/2006 (A/H3N2) segment 6 (NA) 2121.1 0.000000e+00 1324/1410 (93%)
text_code_colored.png EPI454562 A/ruddy turnstone/Delaware/421731/2001 (A/H0) segment 6 (NA) 2117.4 0.000000e+00 1325/1413 (93%)
text_code_colored.png EPI285565 A/duck/New York/440409/2006 (A/H5N2) segment 6 (NA) 2117.4 0.000000e+00 1287/1357 (94%)
text_code_colored.png EPI774906 A/black-bellied whistling duck/Colombia/1/2011 (A/H5N2) segment 6 (NA) 2106.3 0.000000e+00 1321/1411 (93%)
text_code_colored.png EPI266390 A/great black-backed gull/Newfoundland/296/2008 (A/H13N2) segment 6 (NA) 2102.6 0.000000e+00 1317/1406 (93%)
text_code_colored.png EPI774898 A/white-faced whistling duck/Colombia/1/2011 (A/H5N2) segment 6 (NA) 2100.8 0.000000e+00 1320/1411 (93%)
text_code_colored.png EPI442445 A/emperor goose/Alaska/44297-269/2007 (A/H2N2) segment 6 (NA) 2100.8 0.000000e+00 1324/1415 (93%)
text_code_colored.png EPI442444 A/emperor goose/Alaska/44297-260/2007 (A/H2N2) segment 6 (NA) 2100.8 0.000000e+00 1324/1415 (93%)
text_code_colored.png EPI227390 A/northern shoveler/California/K138/2005 (A/H6N2) segment 6 (NA) 2100.8 0.000000e+00 1323/1414 (93%)
text_code_colored.png EPI178111 A/northern pintail/California/44221-692/2006 (A/H11N2) segment 6 (NA) 2100.8 0.000000e+00 1279/1349 (94%)
text_code_colored.png EPI285584 A/mallard/Mississippi/469988-2/2006 (A/H5N2) segment 6 (NA) 2089.7 0.000000e+00 1321/1414 (93%)
text_code_colored.png EPI178120 A/northern pintail/California/44221-797/2006 (A/H5N2) segment 6 (NA) 2089.7 0.000000e+00 1277/1349 (94%)
text_code_colored.png EPI178118 A/northern pintail/California/44221-789/2006 (A/H5N2) segment 6 (NA) 2089.7 0.000000e+00 1277/1349 (94%)
text_code_colored.png EPI178116 A/northern pintail/California/44249-053/2006 (A/H5N2) segment 6 (NA) 2089.7 0.000000e+00 1277/1349 (94%)
text_code_colored.png EPI178103 A/northern pintail/California/44242-732/2006 (A/H6N2) segment 6 (NA) 2089.7 0.000000e+00 1277/1349 (94%)
text_code_colored.png EPI442433 A/brant/Alaska/44339-481/2007 (A/H1N2) segment 6 (NA) 2084.1 0.000000e+00 1320/1414 (93%)
text_code_colored.png EPI296459 A/northern shoveler/California/JN1447/2007 (A/H7N2) segment 6 (NA) 2084.1 0.000000e+00 1320/1414 (93%)
text_code_colored.png EPI290895 A/western grebe/Washington/20569-004/2007 (A/H1N2) segment 6 (NA) 2084.1 0.000000e+00 1320/1414 (93%)
text_code_colored.png EPI285590 A/northern pintail/California/491335/2007 (A/H5N2) segment 6 (NA) 2084.1 0.000000e+00 1320/1414 (93%)
text_code_colored.png EPI285583 A/Northern shoveler/Mississippi/469987-3/2006 (A/H5N2) segment 6 (NA) 2084.1 0.000000e+00 1320/1414 (93%)
text_code_colored.png EPI442432 A/brant/Alaska/44339-464/2007 (A/H1N2) segment 6 (NA) 2080.4 0.000000e+00 1319/1414 (93%)
text_code_colored.png EPI234212 A/chicken/Pennsylvania/Sg-00427/2004 (A/H2N2) segment 6 (NA) 2080.4 0.000000e+00 1267/1336 (94%)
text_code_colored.png EPI285587 A/Canada goose/Colorado/474037-5/2006 (A/H5N2) segment 6 (NA) 2078.6 0.000000e+00 1320/1415 (93%)
text_code_colored.png EPI280528 A/mallard/Idaho/455398-2/2006 (A/H5N2) segment 6 (NA) 2078.6 0.000000e+00 1321/1416 (93%)
text_code_colored.png EPI234211 A/chicken/Pennsylvania/Sg-00426/2004 (A/H2N2) segment 6 (NA) 2078.6 0.000000e+00 1309/1399 (93%)
text_code_colored.png EPI285585 A/Canada goose/Colorado/473047-2/2006 (A/H5N2) segment 6 (NA) 2073.1 0.000000e+00 1319/1415 (93%)
text_code_colored.png EPI42116 A/duck/Hong Kong/784/1979 (A/H9N2) segment 6 (NA) 2073.1 0.000000e+00 1315/1411 (93%)
text_code_colored.png EPI2447 A/duck/Hokkaido/95/01 (A/H2N2) segment 6 (NA) 2073.1 0.000000e+00 1314/1410 (93%)
text_code_colored.png EPI615759 A/whimbrel/Peru/P41/2007 (A/H13N2) segment 6 (NA) 2071.2 0.000000e+00 1288/1371 (93%)
text_code_colored.png EPI442478 A/tundra swan/Alaska/44056-144/2006 (A/H5N2) segment 6 (NA) 2067.5 0.000000e+00 1319/1416 (93%)
text_code_colored.png EPI290508 A/mallard/Washington/44242-124/2006 (A/H3N2) segment 6 (NA) 2067.5 0.000000e+00 1319/1416 (93%)
text_code_colored.png EPI285589 A/tundra swan/Alaska//480410/2007 (A/H5N2) segment 6 (NA) 2067.5 0.000000e+00 1319/1416 (93%)
text_code_colored.png EPI280672 A/Canada goose/Wyoming/473197-12/2006 (A/H5N2) segment 6 (NA) 2067.5 0.000000e+00 1319/1416 (93%)
text_code_colored.png EPI280520 A/mallard/Washington/456277-7/2006 (A/H5N2) segment 6 (NA) 2067.5 0.000000e+00 1320/1417 (93%)
text_code_colored.png EPI280512 A/mallard/Washington/456277-2/2006 (A/H5N2) segment 6 (NA) 2067.5 0.000000e+00 1319/1416 (93%)
text_code_colored.png EPI2973 A/duck/Hokkaido/120/2001 (A/H6N2) segment 6 (NA) 2067.5 0.000000e+00 1314/1411 (93%)
text_code_colored.png EPI510510 A/swan/BC/2045/2008 (A/H5N2) segment 6 (NA) 2062.0 0.000000e+00 1317/1415 (93%)
text_code_colored.png EPI181647 A/duck/Tsukuba/28/2005 (A/H6N2) segment 6 (NA) 2062.0 0.000000e+00 1312/1410 (93%)
text_code_colored.png EPI442477 A/tundra swan/Alaska/44050-005/2006 (A/H5N2) segment 6 (NA) 2056.4 0.000000e+00 1318/1417 (93%)
text_code_colored.png EPI442475 A/tundra swan/Alaska/44049-099/2006 (A/H5N2) segment 6 (NA) 2056.4 0.000000e+00 1317/1416 (93%)
text_code_colored.png EPI280832 A/tundra swan/Alaska/462958/2006 (A/H5N2) segment 6 (NA) 2056.4 0.000000e+00 1317/1416 (93%)
text_code_colored.png EPI280680 A/Canada goose/Wyoming/473197-10/2006 (A/H5N2) segment 6 (NA) 2056.4 0.000000e+00 1317/1416 (93%)
text_code_colored.png EPI280536 A/tundra swan/Alaska/450959/2006 (A/H5N2) segment 6 (NA) 2056.4 0.000000e+00 1318/1417 (93%)
text_code_colored.png EPI326953 A/environment/Korea/ESD11/2003 (A/H3N2) segment 6 (NA) 2050.9 0.000000e+00 1304/1401 (93%)
text_code_colored.png EPI285599 A/Canada goose/Alaska//453648/2006 (A/H5N2) segment 6 (NA) 2050.9 0.000000e+00 1318/1418 (92%)
text_code_colored.png EPI178125 A/northern pintail/California/44291-447/2006 (A/H11N2) segment 6 (NA) 2050.9 0.000000e+00 1270/1349 (94%)
text_code_colored.png EPI133453 A/aquatic bird/Korea/KN-2/2005 (A/H3N2) segment 6 (NA) 2050.9 0.000000e+00 1310/1410 (92%)
text_code_colored.png EPI363657 A/duck/Shantou/7904/2006 (A/H6N2) segment 6 (NA) 2045.4 0.000000e+00 1309/1410 (92%)
text_code_colored.png EPI290524 A/mallard/Washington/44242-264/2006 (A/H5N2) segment 6 (NA) 2045.4 0.000000e+00 1315/1416 (92%)
text_code_colored.png EPI285600 A/mallard/Washington/456273-3/2006 (A/H5N2) segment 6 (NA) 2045.4 0.000000e+00 1315/1416 (92%)
text_code_colored.png EPI280560 A/white front goose/Alaska/446843/2006 (A/H5N2) segment 6 (NA) 2045.4 0.000000e+00 1315/1416 (92%)
text_code_colored.png EPI439820 A/white faced whistling duck/Colombia/1/2011 (A/H5N2) segment 6 (NA) 2038.0 0.000000e+00 1276/1362 (93%)
text_code_colored.png EPI470945 A/duck/Hong Kong/Y439/1997 (A/H9N2) segment 6 (NA) 2034.3 0.000000e+00 1308/1411 (92%)
text_code_colored.png EPI615842 A/gull/Peru/CH02/2009 (A/H13N2) segment 6 (NA) 2014.0 0.000000e+00 1280/1374 (93%)
text_code_colored.png EPI439813 A/black bellied whistling duck/Colombia/1/2011 (A/H5N2) segment 6 (NA) 2006.6 0.000000e+00 1255/1339 (93%)
text_code_colored.png EPI401265 A/feline/Korea/02/2011 (A/H3N2) segment 6 (NA) 2006.6 0.000000e+00 1304/1412 (92%)
text_code_colored.png EPI615765 A/gull/Peru/P43/2007 (A/H13N2) segment 6 (NA) 2004.7 0.000000e+00 1256/1341 (93%)
text_code_colored.png EPI573617 A/chicken/Pennsylvania/7659/1985 (A/H5N2) segment 6 (NA) 1990.0 0.000000e+00 1301/1412 (92%)
text_code_colored.png EPI314164 A/turkey/Massachusetts/3740/1965 (A/H6N2) segment 6 (NA) 1990.0 0.000000e+00 1302/1413 (92%)
text_code_colored.png EPI178123 A/northern pintail/California/44290-230/2006 (A/H5N2) segment 6 (NA) 1990.0 0.000000e+00 1260/1350 (93%)
text_code_colored.png EPI13142 A/turkey/Massachussetts/3740/65 (A/H6N2) segment 6 (NA) 1990.0 0.000000e+00 1302/1413 (92%)
text_code_colored.png EPI5923 A/Duck/Hong Kong/Y439/97 (A/H9N2) segment 6 (NA) 1990.0 0.000000e+00 1300/1410 (92%)
text_code_colored.png EPI615799 A/black skimmer/Peru/CH55/2010 (A/H13N2) segment 6 (NA) 1986.3 0.000000e+00 1267/1362 (93%)
text_code_colored.png EPI407903 A/turkey/Massachusetts/3740/1965 (A/H6N2) segment 6 (NA) 1984.4 0.000000e+00 1301/1413 (92%)
text_code_colored.png EPI327415 A/duck/Egypt/053/2005 (A/H6N2) segment 6 (NA) 1984.4 0.000000e+00 1301/1413 (92%)
text_code_colored.png EPI228509 A/whiskered tern/Egypt/04/2004 (A/H6N2) segment 6 (NA) 1984.4 0.000000e+00 1301/1413 (92%)
text_code_colored.png EPI3189 A/turkey/Massachusetts/3740/1965 (A/H6N2) segment 6 (NA) 1984.4 0.000000e+00 1301/1413 (92%)
text_code_colored.png EPI178105 A/northern pintail/California/44221-608/2006 (A/H1N2) segment 6 (NA) 1973.3 0.000000e+00 1259/1352 (93%)
text_code_colored.png EPI158516 A/turkey/CO/118899/1974 (A/H5N2) segment 6 (NA) 1973.3 0.000000e+00 1299/1413 (91%)
text_code_colored.png EPI25861 A/dove/Korea/S11/03 (A/H3N2) segment 6 (NA) 1973.3 0.000000e+00 1300/1414 (91%)
text_code_colored.png EPI25855 A/duck/Korea/S8/03 (A/H3N2) segment 6 (NA) 1973.3 0.000000e+00 1300/1414 (91%)
text_code_colored.png EPI25853 A/duck/Korea/S7/03 (A/H3N2) segment 6 (NA) 1973.3 0.000000e+00 1300/1414 (91%)
text_code_colored.png EPI470924 A/chicken/Korea/25232-MS96CE6/1996 (A/H9N2) segment 6 (NA) 1956.7 0.000000e+00 1295/1412 (91%)
text_code_colored.png EPI470906 A/turkey/Minnesota/511/1978 (A/H9N2) segment 6 (NA) 1956.7 0.000000e+00 1295/1412 (91%)
text_code_colored.png EPI326948 A/duck/Korea/JS53/2004 (A/H3N2) segment 6 (NA) 1956.7 0.000000e+00 1295/1412 (91%)
text_code_colored.png EPI251751 A/mallard/Sweden/55/2002 (A/H11N2) segment 6 (NA) 1956.7 0.000000e+00 1294/1411 (91%)
text_code_colored.png EPI251696 A/mallard/Sweden/3/2002 (A/H1N2) segment 6 (NA) 1956.7 0.000000e+00 1294/1411 (91%)
text_code_colored.png EPI42670 A/mallard duck/New York/189/1982 (A/H5N2) segment 6 (NA) 1956.7 0.000000e+00 1295/1412 (91%)
text_code_colored.png EPI25857 A/duck/Korea/S9/03 (A/H3N2) segment 6 (NA) 1956.7 0.000000e+00 1297/1414 (91%)
text_code_colored.png EPI178126 A/northern pintail/California/44345-820/2007 (A/H5N2) segment 6 (NA) 1953.0 0.000000e+00 1255/1352 (92%)
text_code_colored.png EPI243159 A/turkey/Minnesota/833/1980 (A/H4N2) segment 6 (NA) 1951.2 0.000000e+00 1294/1412 (91%)
text_code_colored.png EPI89212 A/duck/Nanchang/1749/1992 (A/H11N2) segment 6 (NA) 1951.2 0.000000e+00 1293/1411 (91%)
text_code_colored.png EPI86892 A/pintail duck/ALB/86/1976 (A/H3N2) segment 6 (NA) 1951.2 0.000000e+00 1296/1414 (91%)
text_code_colored.png EPI86264 A/mallard duck/ALB/57/1976 (A/H5N2) segment 6 (NA) 1951.2 0.000000e+00 1296/1414 (91%)
text_code_colored.png EPI42841 A/blue-winged teal/New York/370ac/1979 (A/H4N2) segment 6 (NA) 1951.2 0.000000e+00 1295/1413 (91%)
text_code_colored.png EPI370016 A/mallard/New York/6750/1978 (A/H2N2) segment 6 (NA) 1945.6 0.000000e+00 1294/1413 (91%)
text_code_colored.png EPI618943 A/mallard/Sweden/223/2002 (A/H10N2) segment 6 (NA) 1940.1 0.000000e+00 1291/1411 (91%)
text_code_colored.png EPI407875 A/mallard/New York/6750/1978 (A/H2N2) segment 6 (NA) 1940.1 0.000000e+00 1293/1413 (91%)
text_code_colored.png EPI251702 A/mallard/Sweden/4/2002 (A/H10N2) segment 6 (NA) 1940.1 0.000000e+00 1291/1411 (91%)
text_code_colored.png EPI42793 A/mallard duck/New York/170/1982 (A/H1N2) segment 6 (NA) 1934.6 0.000000e+00 1291/1412 (91%)
text_code_colored.png EPI618958 A/mallard/Sweden/737/2002 (A/H10N2) segment 6 (NA) 1929.0 0.000000e+00 1289/1411 (91%)
text_code_colored.png EPI618934 A/mallard/Sweden/831/2002 (A/H10N2) segment 6 (NA) 1929.0 0.000000e+00 1289/1411 (91%)
text_code_colored.png EPI171095 A/mallard/Wisconsin/944/1982 (A/H5N2) segment 6 (NA) 1929.0 0.000000e+00 1290/1412 (91%)
text_code_colored.png EPI158981 A/chicken/NJ/7207-4/2000 (A/H5N2) segment 6 (NA) 1929.0 0.000000e+00 1290/1412 (91%)
text_code_colored.png EPI3161 A/duck/Pennsylvania/10218/1984 (A/H5N2) segment 6 (NA) 1929.0 0.000000e+00 1291/1413 (91%)
text_code_colored.png EPI372385 A/teal/Egypt/13203-NAMRU3/2006 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1287/1410 (91%)
text_code_colored.png EPI13146 A/turkey/Minnesota/3689-1551/1981 (A/H5N2) segment 6 (NA) 1923.5 0.000000e+00 1289/1412 (91%)
text_code_colored.png EPI514914 A/mallard/Sweden/274/2002 (A/H4N2) segment 6 (NA) 1917.9 0.000000e+00 1287/1411 (91%)
text_code_colored.png EPI514876 A/mallard/Sweden/1195/2002 (A/H4N2) segment 6 (NA) 1917.9 0.000000e+00 1287/1411 (91%)
text_code_colored.png EPI468177 A/finch/England/2051/1991 (A/H5N2) segment 6 (NA) 1917.9 0.000000e+00 1288/1412 (91%)
text_code_colored.png EPI372370 A/shoveler/Egypt/13251-NAMRU3/2006 (A/H6N2) segment 6 (NA) 1917.9 0.000000e+00 1286/1410 (91%)
text_code_colored.png EPI169610 A/blue goose/WI/711/1975 (A/H5N2) segment 6 (NA) 1917.9 0.000000e+00 1288/1412 (91%)
text_code_colored.png EPI99872 A/duck/Denmark/65047/04 (A/H5N2) segment 6 (NA) 1917.9 0.000000e+00 1286/1410 (91%)
text_code_colored.png EPI33748 A/mallard/Ohio/275/1987 (A/H4N2) segment 6 (NA) 1917.9 0.000000e+00 1288/1412 (91%)
text_code_colored.png EPI485697 A/mallard/Sweden/7/2002 (A/H5N2) segment 6 (NA) 1912.4 0.000000e+00 1286/1411 (91%)
text_code_colored.png EPI267603 A/mallard/Netherlands/3/1999 (A/H5N2) segment 6 (NA) 1912.4 0.000000e+00 1286/1411 (91%)
text_code_colored.png EPI238601 A/mallard/Netherlands/3/1999 (A/H5N2) segment 6 (NA) 1912.4 0.000000e+00 1286/1411 (91%)
text_code_colored.png EPI236202 A/mallard/Sweden/7/2002 (A/H5N2) segment 6 (NA) 1912.4 0.000000e+00 1286/1411 (91%)
text_code_colored.png EPI25851 A/chicken/Korea/S6/03 (A/H3N2) segment 6 (NA) 1912.4 0.000000e+00 1290/1415 (91%)
text_code_colored.png EPI90096 A/duck/Minnesota/1516/1981 (A/H5N2) segment 6 (NA) 1906.9 0.000000e+00 1288/1414 (91%)
text_code_colored.png EPI87446 A/pintail duck/ALB/599/1979 (A/H4N2) segment 6 (NA) 1906.9 0.000000e+00 1286/1412 (91%)
text_code_colored.png EPI87429 A/blue-winged teal/ALB/580/1979 (A/H4N2) segment 6 (NA) 1906.9 0.000000e+00 1286/1412 (91%)
text_code_colored.png EPI87395 A/mallard duck/ALB/354/1978 (A/H4N2) segment 6 (NA) 1906.9 0.000000e+00 1286/1412 (91%)
text_code_colored.png EPI85601 A/pintail duck/ALB/367/1978 (A/H6N2) segment 6 (NA) 1906.9 0.000000e+00 1286/1412 (91%)
text_code_colored.png EPI85497 A/mallard duck/ALB/250/1978 (A/H6N2) segment 6 (NA) 1906.9 0.000000e+00 1286/1412 (91%)
text_code_colored.png EPI42167 A/duck/New Zealand/41/1984 (A/H5N2) segment 6 (NA) 1906.9 0.000000e+00 1287/1413 (91%)
text_code_colored.png EPI41987 A/mallard duck/Alberta/205/1978 (A/H6N2) segment 6 (NA) 1906.9 0.000000e+00 1286/1412 (91%)
text_code_colored.png EPI618518 A/mallard/Sweden/7146/2004 (A/H9N2) segment 6 (NA) 1901.3 0.000000e+00 1287/1414 (91%)
text_code_colored.png EPI251860 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 6 (NA) 1901.3 0.000000e+00 1284/1411 (90%)
text_code_colored.png EPI240865 A/Canada goose/Wisconsin/902/1975 (A/H5N2) segment 6 (NA) 1901.3 0.000000e+00 1286/1413 (91%)
text_code_colored.png EPI190310 A/mallard/Netherlands/1/2007 (A/H3N2) segment 6 (NA) 1901.3 0.000000e+00 1285/1412 (91%)
text_code_colored.png EPI181979 A/pink-footed goose/Netherlands/1/2006 (A/H9N2) segment 6 (NA) 1901.3 0.000000e+00 1287/1414 (91%)
text_code_colored.png EPI85592 A/pintail duck/ALB/133/1978 (A/H6N2) segment 6 (NA) 1901.3 0.000000e+00 1285/1412 (91%)
text_code_colored.png EPI85560 A/mallard duck/ALB/290/1978 (A/H6N2) segment 6 (NA) 1901.3 0.000000e+00 1285/1412 (91%)
text_code_colored.png EPI85543 A/mallard duck/ALB/280/1978 (A/H6N2) segment 6 (NA) 1901.3 0.000000e+00 1285/1412 (91%)
text_code_colored.png EPI48611 A/mallard/Ohio/424/1988 (A/H3N2) segment 6 (NA) 1901.3 0.000000e+00 1285/1412 (91%)
text_code_colored.png EPI44027 A/green-winged teal/Ohio/344/1986 (A/H4N2) segment 6 (NA) 1901.3 0.000000e+00 1285/1412 (91%)
text_code_colored.png EPI514862 A/mallard/Sweden/906/2002 (A/H4N2) segment 6 (NA) 1895.8 0.000000e+00 1283/1411 (90%)
Link to comment
Share on other sites

Descriptions
Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI845371 A/mallard/Alaska/AH0088535/2016 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
text_code_colored.png EPI778501 A/turkey/Minnesota/15-012582-1/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI690388 A/mallard/Washington/196865/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI690332 A/mallard/Oregon/AH0003821/2014 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI690251 A/American green-winged teal/Idaho/AH0011899/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI690190 A/Northern shoveler/Oregon/AH0007339/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI690183 A/Northern shoveler/Oregon/AH0007337/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI690176 A/Northern shoveler/Oregon/AH0007332/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI690148 A/Northern pintail/Oregon/AH0003967/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI662740 A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI662726 A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI662719 A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI662712 A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI662705 A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI662691 A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI620411 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI590743 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI590736 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI590729 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI590722 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI590708 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI590688 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI568701 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI568698 A/turkey/Washington/61-22/2014 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI568697 A/chicken/Washington/61-9/2014 (A/H5N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
text_code_colored.png EPI778509 A/chicken/Iowa/15-013388-1/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI778493 A/turkey/South Dakota/15-012511-2/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690471 A/snowy owl/Wisconsin/198399/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690464 A/Cooper's hawk/Minnesota/198225/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690457 A/Canada goose/Washington/197619/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690430 A/mallard/Washington/195246/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690353 A/mallard/Oregon/195547/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690346 A/Northern pintail/Washington/195365/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690272 A/American wigeon/Oregon/AH0012525/2015 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690244 A/mallard/Idaho/AH0007413/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690237 A/mallard/Idaho/AH0007412/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690222 A/Northern pintail/Oregon/AH0003871/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690162 A/wood duck/Oregon/AH0007257/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690155 A/wood duck/Oregon/AH0007244/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690141 A/mallard/Oregon/AH0003952/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI690127 A/snow goose/Missouri/15-011246-1/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI662747 A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI662733 A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI662697 A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI620460 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI620453 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI620446 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI620439 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI620432 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI620425 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI620418 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI590715 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI587636 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI586561 A/chicken/BC/FAV25/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI586553 A/chicken/BC/FAV24/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI586521 A/chicken/BC/FAV20/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI586504 A/poultry/BC/FAV17/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585651 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585650 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585649 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585647 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585646 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585645 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585644 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585643 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585642 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585641 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585639 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585638 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585637 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585635 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585634 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI585087 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI584082 A/turkey/BC/FAV14/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI576480 A/chicken/BC/FAV9/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI576473 A/chicken/BC/FAV8/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI573301 A/turkey/BC/FAV10/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI569386 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561700 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561693 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561684 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561677 A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561670 A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561656 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561649 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561636 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561629 A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561622 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561601 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561594 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561580 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561573 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561566 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561559 A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561552 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561532 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561525 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561511 A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561351 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561344 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561211 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561199 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI561190 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
text_code_colored.png EPI853982 A/chicken/BC/FAV2/2015 (A/H5N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI845975 A/tundra swan/Tottori/C6nk/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI845965 A/mandarin duck/Gifu/2112D001/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI750204 A/goose/Taiwan/01003/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI750165 A/goose/Taiwan/01023/2015 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI750149 A/duck/Taiwan/01006/2015 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI750125 A/goose/Taiwan/01019/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI750117 A/duck/Taiwan/A3400/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI750101 A/goose/Taiwan/01038/2015 (A/H5N3) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690787 A/goose/Taiwan/TNO20/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690755 A/goose/Taiwan/TNO16/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690747 A/goose/Taiwan/TNO15/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690699 A/goose/Taiwan/TNO9/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690675 A/goose/Taiwan/TNO6/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690659 A/goose/Taiwan/TNO4/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690651 A/goose/Taiwan/TNO3/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690643 A/goose/Taiwan/TNO2/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690603 A/goose/Taiwan/TNC11/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690555 A/goose/Taiwan/TNC5/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690547 A/goose/Taiwan/TNC4/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690477 A/Canada goose/Kansas/197850/2015 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690450 A/mallard/Washington/195810/2014 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690443 A/peregrine falcon/Washington/196426/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690423 A/American wigeon/Washington/195205/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690416 A/American wigeon/Washington/195198/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690402 A/American wigeon/Washington/196340/2015 (A/H5N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690395 A/American wigeon/Washington/196336/2015 (A/H5N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690289 A/chicken/California/15-004912/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690281 A/mallard/Nevada/AH0006855/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690265 A/Canada goose/Oregon/AH0012452/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690258 A/American green-winged teal/Oregon/AH0012403/2015 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690215 A/mallard/Oregon/AH0008887/2015 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690169 A/wood duck/Oregon/AH0007263/2015 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI690134 A/American wigeon/Utah/AH0007824/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI662684 A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI590695 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI587524 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI586545 A/chicken/BC/FAV23/2014 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI586537 A/chicken/BC/FAV22/2014 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI586529 A/chicken/BC/FAV21/2014 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI586513 A/poultry/BC/FAV19/2014 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI586496 A/poultry/BC/FAV15/2014 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI585652 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI585648 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI585640 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI585636 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI585095 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI573289 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI573164 A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI569393 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI568702 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI568699 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI561708 A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI561663 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI561615 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI561608 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI561545 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI561518 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI561363 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI561356 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI552749 A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI548627 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI547684 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
text_code_colored.png EPI588979 A/duck/Taiwan/a068/2015 (A/H5N8) segment 7 (MP) 1779.4 0.000000e+00 975/981 (99%)
text_code_colored.png EPI588955 A/goose/Taiwan/a015/2015 (A/H5N8) segment 7 (MP) 1779.4 0.000000e+00 975/981 (99%)
text_code_colored.png EPI750197 A/goose/Taiwan/01004/2015 (A/H5N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI750190 A/goose/Taiwan/01042/2015 (A/H5N3) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI750181 A/goose/Taiwan/01040/2015 (A/H5N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI750173 A/goose/Taiwan/01031/2015 (A/H5N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI750133 A/goose/Taiwan/01026/2015 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI750109 A/chicken/Taiwan/01174/2015 (A/H5N3) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690739 A/goose/Taiwan/TNO14/2015 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690707 A/goose/Taiwan/TNO10/2015 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690683 A/goose/Taiwan/TNO7/2015 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690619 A/goose/Taiwan/TNC13/2015 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690587 A/goose/Taiwan/TNC9/2015 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690539 A/goose/Taiwan/TNC3/2015 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690409 A/mallard/Oregon/195536/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690381 A/Northern pintail/Washington/196271/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690366 A/mallard/Washington/196262/2015 (A/H5N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690339 A/bald eagle/Idaho/15-002892-2/2015 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690325 A/mallard/Idaho/AH0005955/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690318 A/mallard/Idaho/AH0005954/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI690197 A/mallard/Idaho/AH0008597/2015 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI595144 A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI595136 A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI595131 A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI595122 A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI595114 A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI595105 A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI595097 A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI595085 A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI595077 A/mallard/Korea/N15-99/2015 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI584826 A/domestic duck/Hungary/7341/2015 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI573641 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI573190 A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI558012 A/duck/England/36038/14 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI558005 A/duck/England/36226/14 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI553365 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI548496 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI548488 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI547676 A/duck/England/36254/14 (A/H5N8) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
text_code_colored.png EPI588971 A/chicken/Taiwan/a174/2015 (A/H5N3) segment 7 (MP) 1773.9 0.000000e+00 974/981 (99%)
text_code_colored.png EPI588963 A/duck/Taiwan/a043/2015 (A/H5N2) segment 7 (MP) 1773.9 0.000000e+00 974/981 (99%)
text_code_colored.png EPI555124 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP) 1773.9 0.000000e+00 972/978 (99%)
text_code_colored.png EPI553181 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP) 1773.9 0.000000e+00 972/978 (99%)
text_code_colored.png EPI548426 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP) 1773.9 0.000000e+00 972/978 (99%)
text_code_colored.png EPI750157 A/goose/Taiwan/01022/2015 (A/H5N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI750141 A/goose/Taiwan/01039/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI703661 A/duck/Eastern China/S0131/2014 (A/H5N2) segment 7 (MP) 1770.2 0.000000e+00 975/983 (99%)
text_code_colored.png EPI690779 A/goose/Taiwan/TNO19/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690771 A/goose/Taiwan/TNO18/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690763 A/goose/Taiwan/TNO17/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690731 A/goose/Taiwan/TNO13/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690723 A/goose/Taiwan/TNO12/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690715 A/goose/Taiwan/TNO11/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690691 A/goose/Taiwan/TNO8/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690635 A/goose/Taiwan/TNO1/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690627 A/goose/Taiwan/TNC14/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690611 A/goose/Taiwan/TNC12/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690595 A/goose/Taiwan/TNC10/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690579 A/goose/Taiwan/TNC8/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690571 A/goose/Taiwan/TNC7/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690563 A/goose/Taiwan/TNC6/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690531 A/goose/Taiwan/TNC2/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690523 A/goose/Taiwan/TNC1/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI690359 A/American wigeon/Washington/195968/2014 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI595069 A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI576394 A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI576381 A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI573683 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI573675 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI573667 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI573657 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI573649 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI573182 A/duck/Netherlands/14015898/2014 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI573174 A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
text_code_colored.png EPI542997 A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 973/980 (99%)
text_code_colored.png EPI595061 A/common teal/Korea/KU-12/2015 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
text_code_colored.png EPI543005 A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 972/980 (99%)
text_code_colored.png EPI431451 A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP) 1742.5 0.000000e+00 970/983 (98%)
text_code_colored.png EPI703664 A/duck/Eastern China/S0808/2014 (A/H5N2) segment 7 (MP) 1737.0 0.000000e+00 969/983 (98%)
text_code_colored.png EPI414241 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP) 1737.0 0.000000e+00 969/983 (98%)
text_code_colored.png EPI398977 A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP) 1737.0 0.000000e+00 969/983 (98%)
text_code_colored.png EPI823943 A/duck/Hubei/SZY250/2016 (A/H5N2) segment 7 (MP) 1731.4 0.000000e+00 968/983 (98%)
text_code_colored.png EPI703649 A/duck/Eastern China/L0321/2010 (A/H5N2) segment 7 (MP) 1725.9 0.000000e+00 967/983 (98%)
text_code_colored.png EPI475582 A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 963/983 (97%)
text_code_colored.png EPI596292 A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 7 (MP) 1700.0 0.000000e+00 944/955 (98%)
text_code_colored.png EPI399963 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP) 1698.2 0.000000e+00 962/983 (97%)
text_code_colored.png EPI328891 A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 962/983 (97%)
text_code_colored.png EPI328875 A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP) 1698.2 0.000000e+00 962/983 (97%)
text_code_colored.png EPI328867 A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP) 1698.2 0.000000e+00 962/983 (97%)
text_code_colored.png EPI552763 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 7 (MP) 1694.5 0.000000e+00 943/955 (98%)
text_code_colored.png EPI703650 A/duck/Eastern China/L0230/2010 (A/H5N2) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
text_code_colored.png EPI328883 A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
text_code_colored.png EPI442028 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
text_code_colored.png EPI398978 A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
text_code_colored.png EPI431459 A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP) 1681.6 0.000000e+00 958/982 (97%)
text_code_colored.png EPI590682 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 7 (MP) 1676.0 0.000000e+00 925/934 (99%)
text_code_colored.png EPI585114 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 7 (MP) 1676.0 0.000000e+00 925/934 (99%)
text_code_colored.png EPI442004 A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP) 1676.0 0.000000e+00 959/984 (97%)
text_code_colored.png EPI442020 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
text_code_colored.png EPI597680 A/duck/Hunan/316/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
text_code_colored.png EPI493836 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
text_code_colored.png EPI493820 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
text_code_colored.png EPI442012 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP) 1659.4 0.000000e+00 957/985 (97%)
text_code_colored.png EPI280107 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
text_code_colored.png EPI280099 A/Guangdong/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
text_code_colored.png EPI227312 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
text_code_colored.png EPI164233 A/Sichuan/2/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
text_code_colored.png EPI164225 A/Sichuan/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
text_code_colored.png EPI111857 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
text_code_colored.png EPI106032 A/China/GD01/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
text_code_colored.png EPI596304 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1655.7 0.000000e+00 908/914 (99%)
text_code_colored.png EPI552779 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1655.7 0.000000e+00 908/914 (99%)
text_code_colored.png EPI703652 A/duck/Eastern China/L0423/2011 (A/H5N8) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI493828 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP) 1653.9 0.000000e+00 955/984 (97%)
text_code_colored.png EPI399889 A/duck/HuBei/03/2010 (A/H5N5) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI276073 A/shrike/Tibet/13/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI275985 A/duck/Hubei/49/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI275389 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI251445 A/Anhui/1/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI251424 A/Guangdong/2/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI251423 A/Sichuan/3/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI251419 A/Zhejiang/1/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI224780 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI167956 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI164241 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI164217 A/Anhui/1/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI127390 A/wild duck/Hunan/021/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI126692 A/human/China/GD02/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI113318 A/Shenzhen/406H/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI111872 A/duck/Guiyang/1558/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI111860 A/goose/Guiyang/4030/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI111674 A/duck/Hunan/5472/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI111656 A/goose/Shantou/3265/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI111644 A/goose/Guiyang/538/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI111632 A/chicken/Guiyang/4059/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
text_code_colored.png EPI111578 A/duck/Guangxi/4428/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 955/984 (97%)
text_code_colored.png EPI703653 A/duck/Eastern China/L0611/2011 (A/H5N8) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI506248 A/duck/Laos/3295/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 951/980 (97%)
text_code_colored.png EPI337321 A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI337314 A/environment/Xinjiang/6/2009 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 954/984 (96%)
text_code_colored.png EPI280267 A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI280259 A/environment/Xinjiang/6/2009 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 954/984 (96%)
text_code_colored.png EPI275961 A/duck/Anhui/1/06 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI275873 A/chicken/Sichuan/81/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI275769 A/chicken/Hunan/1/2009 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI251431 A/Guangdong/1/2008 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI251427 A/Anhui/1/2007 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI235901 A/duck/Zhejiang/bj/2002 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 954/984 (96%)
text_code_colored.png EPI222571 A/scaly-breasted munia/Hong Kong/2433/2007 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI221720 A/chestnut munia/Hong Kong/2442/2007 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI168003 A/little egret/Hong Kong/8863/2007 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI164267 A/Jiangxi/1/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI123805 A/Chicken/Laos/Xaythiani 32/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 954/984 (96%)
text_code_colored.png EPI111884 A/duck/Hunan/1204/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI111878 A/duck/Guiyang/1722/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI111641 A/duck/Guiyang/497/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
text_code_colored.png EPI111611 A/duck/Guangxi/288/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 954/984 (96%)
text_code_colored.png EPI111608 A/goose/Guangxi/224/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 954/984 (96%)
text_code_colored.png EPI111587 A/chicken/Guangxi/4989/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 954/984 (96%)
text_code_colored.png EPI135982 A/duck/Hunan/533/2004 (A/H5N1) segment 7 (MP) 1646.5 0.000000e+00 953/983 (96%)
text_code_colored.png EPI111659 A/goose/Shantou/3295/2006 (A/H5N1) segment 7 (MP) 1646.5 0.000000e+00 950/979 (97%)
text_code_colored.png EPI111527 A/common magpie/Hong Kong/645/2006 (A/H5N1) segment 7 (MP) 1646.5 0.000000e+00 950/979 (97%)
text_code_colored.png EPI596298 A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 7 (MP) 1644.6 0.000000e+00 904/911 (99%)
text_code_colored.png EPI552771 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 7 (MP) 1644.6 0.000000e+00 904/911 (99%)
text_code_colored.png EPI530991 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI408138 A/chicken/Hmawbi/517/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI406409 A/Muscovy duck/Ca Mau/22/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI406347 A/chicken/Hanoi/45/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI406339 A/duck/Soc Trang/31/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI361519 A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI350529 A/duck/Vietnam/NCVD-013/2008 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI337306 A/water/Xinjiang/3/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI280251 A/water/Xinjiang/3/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI280115 A/Hubei/1/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/983 (96%)
text_code_colored.png EPI280091 A/Hunan/1/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI276009 A/duck/Hunan/69/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI275777 A/chicken/Hunan/21/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI275465 A/Guangxi/1/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI251438 A/Xinjiang/1/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI227011 A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI225090 A/duck/Nam Dinh/218/2006 (A/H5) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI221900 A/duck/Hunan/3/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI180954 A/duck/Laos/25/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI175653 A/duck/Hubei/Hangmei01/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI174623 A/duck/Hunan/3315/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI174613 A/duck/Henan/1650/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI170659 A/chicken/Vietnam/209/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI170651 A/duck/Vietnam/210/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI170644 A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI170637 A/chicken/Vietnam/212/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI170630 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI170616 A/chicken/Vietnam/216/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI170608 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI170600 A/duck/Vietnam/218/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI170592 A/duck/Vietnam/219/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI168019 A/common buzzard/Hong Kong/9213/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI164384 A/goose/Yunnan/6384/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI164352 A/goose/Yunnan/5599/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI164344 A/goose/Yunnan/5540/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI164259 A/Guangxi/1/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI123811 A/Chicken/Laos/Xaythiani 37/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI123808 A/Chicken/Laos/Xaythiani 36/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111938 A/chicken/Fujian/12239/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI111929 A/goose/Guangxi/1898/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111920 A/duck/Guangxi/1550/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111917 A/goose/Guangxi/1458/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111722 A/chicken/Fujian/584/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI111695 A/chicken/Fujian/9821/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI111692 A/duck/Fujian/9713/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI111689 A/duck/Fujian/9651/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI111671 A/duck/Hunan/5152/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111668 A/duck/Hunan/5106/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111647 A/duck/Shantou/13323/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
text_code_colored.png EPI111635 A/chicken/Guiyang/29/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111614 A/duck/Guangxi/392/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111605 A/duck/Guangxi/150/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111575 A/goose/Guangxi/4289/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111533 A/chicken/Hong Kong/947/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111530 A/little egret/Hong Kong/718/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI111515 A/magpie robin/Hong Kong/75/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 953/984 (96%)
text_code_colored.png EPI136001 A/duck/Hunan/733/2004 (A/H5N1) segment 7 (MP) 1640.9 0.000000e+00 952/983 (96%)
text_code_colored.png EPI111716 A/chicken/Fujian/11933/2005 (A/H5N1) segment 7 (MP) 1640.9 0.000000e+00 947/976 (97%)
text_code_colored.png EPI111638 A/duck/Guiyang/293/2006 (A/H5N1) segment 7 (MP) 1640.9 0.000000e+00 947/976 (97%)
text_code_colored.png EPI762153 A/duck/Eastern China/JY/2014 (A/H5N8) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI703651 A/duck/Eastern China/L0405/2010 (A/H5N8) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI690795 A/goose/Jiangsu/QD5/2014 (A/H5N8) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI689448 A/duck/Hunan/S4020/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI583875 A/duck/Shaoxing/5240/2013 (A/H0) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI530992 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI500905 A/Chicken/Hunan/S3003/2009 (A/H6N6) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI408139 A/quail/Thanatpin/2283/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI280147 A/Jiangsu/2/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI280139 A/Jiangsu/1/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI270191 A/Vietnam/UT30850/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/981 (96%)
text_code_colored.png EPI251437 A/Shandong/1/2009 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI251428 A/Hunan/1/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI222587 A/scaly-breasted munia/Hong Kong/45/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI222029 A/environment/Hunan/5-25/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI222005 A/environment/Hunan/1-8/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI221747 A/chicken/Hunan/3/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI221583 A/Daurian starling/Hong Kong/1532/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI220541 A/environment/Hunan/7-73/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI220533 A/environment/Hunan/6-69/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI220525 A/environment/Hunan/6-45/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI220274 A/black-crowned night heron/Hong Kong/659/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI180930 A/chicken/Laos/33/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI180906 A/chicken/Laos/13/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI180858 A/chicken/Laos/A0464/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI180819 A/chicken/Laos/P0072/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI180808 A/chicken/Laos/P0001/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI174617 A/duck/Hunan/1964/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI174616 A/duck/Hunan/1930/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI174611 A/chicken/Henan/1362/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI174610 A/chicken/Anhui/1089/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI174609 A/duck/Hunan/689/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI170715 A/chicken/Vietnam/202/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI170691 A/duck/Vietnam/205/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI170675 A/duck/Vietnam/207/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI170667 A/duck/Vietnam/208/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI170623 A/duck/Vietnam/215/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI167987 A/house crow/Hong Kong/5288/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI164376 A/goose/Yunnan/6193/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI164368 A/goose/Yunnan/5979/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI164360 A/goose/Yunnan/5769/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI164336 A/goose/Yunnan/5141/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI164328 A/goose/Yunnan/4985/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI164304 A/goose/Yunnan/3798/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI164288 A/duck/Yunnan/5310/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI164280 A/duck/Yunnan/4873/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI141280 A/Jiangsu/1/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI141272 A/Jiangsu/2/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI139583 A/Ck/HK/YU22/2002 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI119147 A/duck/Hunan/15/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI111935 A/duck/Guangxi/2143/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI111923 A/goose/Guangxi/1633/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI111908 A/chicken/Guangxi/1212/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI111890 A/duck/Guiyang/1081/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI111887 A/goose/Guiyang/765/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI111875 A/goose/Guiyang/1636/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI111869 A/goose/Guiyang/1461/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI111863 A/duck/Fujian/10160/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI111731 A/duck/Fujian/720/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI111725 A/duck/Fujian/668/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI111719 A/duck/Fujian/12032/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI111710 A/duck/Fujian/11094/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
text_code_colored.png EPI111521 A/magpie robin/Hong Kong/366/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI100590 A/duck/Hunan/149/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI26407 A/Chicken/Henan/16/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI26395 A/chicken/Henan/01/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI20568 A/Ck/HK/61.9/02 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
text_code_colored.png EPI135640 A/silky chicken/Shantou/4071/2002 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 951/983 (96%)
text_code_colored.png EPI135621 A/chicken/Shantou/4059/2002 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 951/983 (96%)
text_code_colored.png EPI135583 A/quail/Shantou/3846/2002 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 951/983 (96%)
text_code_colored.png EPI111524 A/crested myna/Hong Kong/540/2006 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 946/976 (96%)
text_code_colored.png EPI22975 A/Dk/HN/5806/2003 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 951/983 (96%)
text_code_colored.png EPI167775 A/Muscovy duck/Vietnam/NCVD-46/2007 (A/H5N1) segment 7 (MP) 1633.6 0.000000e+00 948/979 (96%)
text_code_colored.png EPI167769 A/chicken/Vietnam/NCVD-45/2007 (A/H5N1) segment 7 (MP) 1633.6 0.000000e+00 948/979 (96%)
text_code_colored.png EPI123802 A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 7 (MP) 1633.6 0.000000e+00 951/984 (96%)
text_code_colored.png EPI764417 A/turtle dove/Guangdong/300/2005 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI561504 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI509701 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI504853 A/duck/Hubei/xn/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI448902 A/chicken/Bangladesh/3012/2011 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI406387 A/chicken/Ha Tay/44/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI355446 A/swan/Shanghai/10/2009 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI351431 A/muscovy duck/Vietnam/NCVD-079/2008 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI337274 A/environment/Guizhou/2/2009 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI286282 A/duck/Mong Cai/07-58/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI276025 A/duck/Jiangxi/80/2005 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI235899 A/duck/Shanghai/xj/2002 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI229699 A/crested eagle/Belgium/01/2004 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI222876 A/tree sparrow/Jiangsu/1/2008 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI180946 A/chicken/Laos/37/2008 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI180938 A/chicken/Laos/35/2008 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI180834 A/duck/Laos/P0117/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI174622 A/chicken/Hunan/3157/2006 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI174621 A/chicken/Hubei/3002/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI174619 A/chicken/Hubei/2856/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI174618 A/duck/Hunan/1994/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI174615 A/chicken/Hunan/1793/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI164320 A/goose/Yunnan/4389/2006 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI164312 A/goose/Yunnan/4371/2006 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI164296 A/duck/Yunnan/6490/2006 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI111914 A/duck/Guangxi/1436/2006 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI111881 A/goose/Guiyang/1794/2006 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
text_code_colored.png EPI111866 A/duck/Fujian/10389/2005 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
text_code_colored.png EPI111704 A/chicken/Fujian/10567/2005 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
Link to comment
Share on other sites

Descriptions
Align Segment-ID Name Score E-Value Identity
text_code_colored.png EPI845365 A/mallard/Alaska/AH0088535/2016 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
text_code_colored.png EPI778487 A/turkey/South Dakota/15-012511-2/2015 (A/H5N2) segment 1 (PB2) 4167.2 0.000000e+00 2272/2280 (99%)
text_code_colored.png EPI690185 A/Northern shoveler/Oregon/AH0007339/2015 (A/H5N2) segment 1 (PB2) 4167.2 0.000000e+00 2272/2280 (99%)
text_code_colored.png EPI662721 A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 1 (PB2) 4167.2 0.000000e+00 2272/2280 (99%)
text_code_colored.png EPI662699 A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 1 (PB2) 4167.2 0.000000e+00 2272/2280 (99%)
text_code_colored.png EPI590738 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 1 (PB2) 4167.2 0.000000e+00 2272/2280 (99%)
text_code_colored.png EPI778503 A/chicken/Iowa/15-013388-1/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI690459 A/Cooper's hawk/Minnesota/198225/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI690306 A/mallard/Oregon/AH0003821/2014 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI690202 A/mallard/Idaho/AH0007413/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI690201 A/mallard/Idaho/AH0007412/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI690157 A/wood duck/Oregon/AH0007257/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI690119 A/Northern shoveler/Oregon/AH0007332/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI690118 A/wood duck/Oregon/AH0007263/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI662704 A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI662686 A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI620455 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI620427 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI620420 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI620413 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI590731 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI587630 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
text_code_colored.png EPI690437 A/Canada goose/Kansas/197850/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI690436 A/snowy owl/Wisconsin/198399/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI690376 A/mallard/Washington/195246/2014 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI690369 A/mallard/Washington/196865/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI690308 A/Northern pintail/Washington/195365/2014 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI690204 A/American green-winged teal/Oregon/AH0012403/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI690178 A/Northern shoveler/Oregon/AH0007337/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI690116 A/wood duck/Oregon/AH0007244/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI690114 A/mallard/Oregon/AH0003952/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI662742 A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI662735 A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI662728 A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI662707 A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI662679 A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI620448 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI620441 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI620434 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI620406 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI590724 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI590710 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI590683 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI586531 A/chicken/BC/FAV22/2014 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI586498 A/poultry/BC/FAV17/2014 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI586490 A/poultry/BC/FAV15/2014 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI573296 A/turkey/BC/FAV10/2014 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI573279 A/turkey/Washington/61-22/2014 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI573274 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
text_code_colored.png EPI690312 A/mallard/Washington/196262/2015 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI690207 A/American wigeon/Oregon/AH0012525/2015 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI662714 A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI590717 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI586555 A/chicken/BC/FAV25/2014 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI586547 A/chicken/BC/FAV24/2014 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI586539 A/chicken/BC/FAV23/2014 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI586523 A/chicken/BC/FAV21/2014 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI585089 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI584076 A/turkey/BC/FAV14/2014 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI576475 A/chicken/BC/FAV9/2014 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI576468 A/chicken/BC/FAV8/2014 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI573269 A/chicken/Washington/61-9/2014 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI569380 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI569379 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
text_code_colored.png EPI778495 A/turkey/Minnesota/15-012582-1/2015 (A/H5N2) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690433 A/mallard/Washington/195810/2014 (A/H5N2) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690432 A/peregrine falcon/Washington/196426/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690375 A/American wigeon/Washington/195205/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690373 A/American wigeon/Washington/195198/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690368 A/Northern pintail/Washington/196271/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690310 A/American wigeon/Washington/195968/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690309 A/mallard/Oregon/195547/2014 (A/H5N2) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690206 A/Canada goose/Oregon/AH0012452/2015 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690203 A/American green-winged teal/Idaho/AH0011899/2015 (A/H5N2) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690200 A/Northern pintail/Oregon/AH0003871/2015 (A/H5N2) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690199 A/mallard/Oregon/AH0008887/2015 (A/H5N2) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI690115 A/Northern pintail/Oregon/AH0003967/2015 (A/H5N2) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI590697 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI586515 A/chicken/BC/FAV20/2014 (A/H5N2) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI585081 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI569369 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI569367 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
text_code_colored.png EPI586506 A/poultry/BC/FAV19/2014 (A/H5N2) segment 1 (PB2) 4141.3 0.000000e+00 2267/2280 (99%)
text_code_colored.png EPI845951 A/tundra swan/Tottori/C6nk/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
text_code_colored.png EPI690372 A/mallard/Oregon/195536/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
text_code_colored.png EPI690304 A/mallard/Idaho/AH0005954/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
text_code_colored.png EPI590690 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
text_code_colored.png EPI587519 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
text_code_colored.png EPI690370 A/American wigeon/Washington/196336/2015 (A/H5N1) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
text_code_colored.png EPI690283 A/chicken/California/15-004912/2015 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
text_code_colored.png EPI573283 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
text_code_colored.png EPI853976 A/chicken/BC/FAV2/2015 (A/H5N1) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
text_code_colored.png EPI690434 A/Canada goose/Washington/197619/2014 (A/H5N2) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
text_code_colored.png EPI690320 A/mallard/Idaho/AH0005955/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
text_code_colored.png EPI690307 A/bald eagle/Idaho/15-002892-2/2015 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
text_code_colored.png EPI690208 A/mallard/Nevada/AH0006855/2015 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
text_code_colored.png EPI690113 A/American wigeon/Utah/AH0007824/2015 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
text_code_colored.png EPI690371 A/American wigeon/Washington/196340/2015 (A/H5N1) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
text_code_colored.png EPI690733 A/goose/Taiwan/TNO14/2015 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI690701 A/goose/Taiwan/TNO10/2015 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI690677 A/goose/Taiwan/TNO7/2015 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI690581 A/goose/Taiwan/TNC9/2015 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI690122 A/mallard/Idaho/AH0008597/2015 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI585557 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI585556 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI585553 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI585543 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI585541 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI561702 A/bean goose/Korea/H40/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI561672 A/bean goose/Korea/H328/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI561631 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI561624 A/mallard/Korea/H207/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI561568 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI561540 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI561527 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI561506 A/bean goose/Korea/H53/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI561358 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
text_code_colored.png EPI690781 A/goose/Taiwan/TNO20/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690773 A/goose/Taiwan/TNO19/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690765 A/goose/Taiwan/TNO18/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690757 A/goose/Taiwan/TNO17/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690749 A/goose/Taiwan/TNO16/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690741 A/goose/Taiwan/TNO15/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690725 A/goose/Taiwan/TNO13/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690717 A/goose/Taiwan/TNO12/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690709 A/goose/Taiwan/TNO11/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690693 A/goose/Taiwan/TNO9/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690685 A/goose/Taiwan/TNO8/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690669 A/goose/Taiwan/TNO6/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690653 A/goose/Taiwan/TNO4/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690645 A/goose/Taiwan/TNO3/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690637 A/goose/Taiwan/TNO2/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690629 A/goose/Taiwan/TNO1/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690621 A/goose/Taiwan/TNC14/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690613 A/goose/Taiwan/TNC13/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690605 A/goose/Taiwan/TNC12/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690597 A/goose/Taiwan/TNC11/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690589 A/goose/Taiwan/TNC10/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690573 A/goose/Taiwan/TNC8/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690565 A/goose/Taiwan/TNC7/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690557 A/goose/Taiwan/TNC6/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690549 A/goose/Taiwan/TNC5/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690541 A/goose/Taiwan/TNC4/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690533 A/goose/Taiwan/TNC3/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690525 A/goose/Taiwan/TNC2/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI690517 A/goose/Taiwan/TNC1/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI588949 A/goose/Taiwan/a015/2015 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI585554 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI585551 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI585550 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI585548 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI585546 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI585545 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI585544 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI585539 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI561610 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI561603 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI561575 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI561561 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI561513 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI561353 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI561339 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI553205 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
text_code_colored.png EPI750199 A/goose/Taiwan/01003/2015 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI750135 A/goose/Taiwan/01039/2015 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI585555 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI585549 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI585542 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI585540 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561679 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561665 A/mallard/Korea/H297/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561651 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561644 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561596 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561589 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561554 A/Coot/Korea/H81/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561547 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561520 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561346 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561201 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561194 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI561185 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI542630 A/mallard/Korea/W452/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI509707 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI509702 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
text_code_colored.png EPI750119 A/goose/Taiwan/01019/2015 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
text_code_colored.png EPI585547 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
text_code_colored.png EPI561695 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
text_code_colored.png EPI561658 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
text_code_colored.png EPI561617 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
text_code_colored.png EPI517158 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
text_code_colored.png EPI573635 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 1 (PB2) 4089.6 0.000000e+00 2258/2280 (99%)
text_code_colored.png EPI561688 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 1 (PB2) 4089.6 0.000000e+00 2258/2280 (99%)
text_code_colored.png EPI750127 A/goose/Taiwan/01026/2015 (A/H5N8) segment 1 (PB2) 4084.1 0.000000e+00 2257/2280 (98%)
text_code_colored.png EPI595139 A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 1 (PB2) 4067.4 0.000000e+00 2254/2280 (98%)
text_code_colored.png EPI595125 A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 1 (PB2) 4067.4 0.000000e+00 2254/2280 (98%)
text_code_colored.png EPI595117 A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 1 (PB2) 4067.4 0.000000e+00 2254/2280 (98%)
text_code_colored.png EPI595109 A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 1 (PB2) 4067.4 0.000000e+00 2254/2280 (98%)
text_code_colored.png EPI595099 A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 1 (PB2) 4067.4 0.000000e+00 2254/2280 (98%)
text_code_colored.png EPI595090 A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 1 (PB2) 4067.4 0.000000e+00 2254/2280 (98%)
text_code_colored.png EPI595088 A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 1 (PB2) 4067.4 0.000000e+00 2254/2280 (98%)
text_code_colored.png EPI595056 A/common teal/Korea/KU-12/2015 (A/H5N8) segment 1 (PB2) 4067.4 0.000000e+00 2254/2280 (98%)
text_code_colored.png EPI573176 A/duck/Netherlands/14015898/2014 (A/H5N8) segment 1 (PB2) 4061.9 0.000000e+00 2253/2280 (98%)
text_code_colored.png EPI573169 A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 1 (PB2) 4061.9 0.000000e+00 2253/2280 (98%)
text_code_colored.png EPI553340 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 1 (PB2) 4061.9 0.000000e+00 2253/2280 (98%)
text_code_colored.png EPI547679 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 1 (PB2) 4061.9 0.000000e+00 2253/2280 (98%)
text_code_colored.png EPI573185 A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 1 (PB2) 4056.4 0.000000e+00 2252/2280 (98%)
text_code_colored.png EPI552743 A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 1 (PB2) 4056.4 0.000000e+00 2252/2280 (98%)
text_code_colored.png EPI548620 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 1 (PB2) 4056.4 0.000000e+00 2252/2280 (98%)
text_code_colored.png EPI547670 A/duck/England/36254/14 (A/H5N8) segment 1 (PB2) 4056.4 0.000000e+00 2252/2280 (98%)
text_code_colored.png EPI576396 A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 1 (PB2) 4052.7 0.000000e+00 2251/2280 (98%)
text_code_colored.png EPI576387 A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 1 (PB2) 4052.7 0.000000e+00 2251/2280 (98%)
text_code_colored.png EPI595063 A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 1 (PB2) 4050.8 0.000000e+00 2251/2280 (98%)
text_code_colored.png EPI573651 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 1 (PB2) 4050.8 0.000000e+00 2251/2280 (98%)
text_code_colored.png EPI573643 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 1 (PB2) 4050.8 0.000000e+00 2251/2280 (98%)
text_code_colored.png EPI573160 A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 1 (PB2) 4050.8 0.000000e+00 2251/2280 (98%)
text_code_colored.png EPI558008 A/duck/England/36038/14 (A/H5N8) segment 1 (PB2) 4050.8 0.000000e+00 2251/2280 (98%)
text_code_colored.png EPI558001 A/duck/England/36226/14 (A/H5N8) segment 1 (PB2) 4050.8 0.000000e+00 2251/2280 (98%)
text_code_colored.png EPI548490 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 1 (PB2) 4050.8 0.000000e+00 2251/2280 (98%)
text_code_colored.png EPI548482 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 1 (PB2) 4050.8 0.000000e+00 2251/2280 (98%)
text_code_colored.png EPI543007 A/duck/Beijing/CT01/2014 (A/H5N8) segment 1 (PB2) 4047.1 0.000000e+00 2247/2277 (98%)
text_code_colored.png EPI845897 A/mandarin duck/Gifu/2112D001/2014 (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2250/2280 (98%)
text_code_colored.png EPI585552 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2250/2280 (98%)
text_code_colored.png EPI573669 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2250/2280 (98%)
text_code_colored.png EPI573661 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2250/2280 (98%)
text_code_colored.png EPI573677 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 1 (PB2) 4039.7 0.000000e+00 2248/2279 (98%)
text_code_colored.png EPI542999 A/duck/Beijing/FS01/2014 (A/H5N8) segment 1 (PB2) 4037.9 0.000000e+00 2244/2277 (98%)
text_code_colored.png EPI595072 A/mallard/Korea/N15-99/2015 (A/H5N8) segment 1 (PB2) 4036.0 0.000000e+00 2248/2280 (98%)
text_code_colored.png EPI553359 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 1 (PB2) 4034.2 0.000000e+00 2248/2280 (98%)
text_code_colored.png EPI584820 A/domestic duck/Hungary/7341/2015 (A/H5N8) segment 1 (PB2) 4028.7 0.000000e+00 2247/2280 (98%)
text_code_colored.png EPI596299 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 1 (PB2) 4008.4 0.000000e+00 2226/2254 (98%)
text_code_colored.png EPI552773 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 1 (PB2) 4008.4 0.000000e+00 2226/2254 (98%)
text_code_colored.png EPI553186 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 1 (PB2) 4001.0 0.000000e+00 2227/2258 (98%)
text_code_colored.png EPI703527 A/duck/Eastern China/L1021/2012 (A/H5N8) segment 1 (PB2) 3995.4 0.000000e+00 2240/2278 (98%)
text_code_colored.png EPI555140 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 1 (PB2) 3995.4 0.000000e+00 2221/2250 (98%)
text_code_colored.png EPI823937 A/duck/Hubei/SZY250/2016 (A/H5N2) segment 1 (PB2) 3967.7 0.000000e+00 2237/2281 (98%)
text_code_colored.png EPI703526 A/duck/Eastern China/L0722/2012 (A/H5N8) segment 1 (PB2) 3967.7 0.000000e+00 2235/2278 (98%)
text_code_colored.png EPI596293 A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 1 (PB2) 3964.0 0.000000e+00 2198/2224 (98%)
text_code_colored.png EPI552765 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 1 (PB2) 3964.0 0.000000e+00 2198/2224 (98%)
text_code_colored.png EPI703525 A/duck/Eastern China/L0611/2011 (A/H5N8) segment 1 (PB2) 3962.2 0.000000e+00 2234/2278 (98%)
text_code_colored.png EPI590677 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 1 (PB2) 3960.3 0.000000e+00 2205/2236 (98%)
text_code_colored.png EPI585108 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 1 (PB2) 3960.3 0.000000e+00 2205/2236 (98%)
text_code_colored.png EPI703524 A/duck/Eastern China/L0423/2011 (A/H5N8) segment 1 (PB2) 3956.6 0.000000e+00 2233/2278 (98%)
text_code_colored.png EPI475576 A/wild duck/Shandong/628/2011 (A/H5N1) segment 1 (PB2) 3956.6 0.000000e+00 2234/2280 (97%)
text_code_colored.png EPI596287 A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 1 (PB2) 3954.8 0.000000e+00 2197/2225 (98%)
text_code_colored.png EPI552757 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 1 (PB2) 3954.8 0.000000e+00 2197/2225 (98%)
text_code_colored.png EPI703523 A/duck/Eastern China/L0405/2010 (A/H5N8) segment 1 (PB2) 3951.1 0.000000e+00 2232/2278 (97%)
text_code_colored.png EPI442014 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 1 (PB2) 3940.0 0.000000e+00 2221/2265 (98%)
text_code_colored.png EPI399957 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 1 (PB2) 3923.4 0.000000e+00 2228/2280 (97%)
text_code_colored.png EPI544889 A/duck/Shandong/Q1/2013 (A/H5N8) segment 1 (PB2) 3910.5 0.000000e+00 2225/2279 (97%)
text_code_colored.png EPI703528 A/duck/Eastern China/L1120/2012 (A/H5N8) segment 1 (PB2) 3906.8 0.000000e+00 2224/2278 (97%)
text_code_colored.png EPI703530 A/goose/Eastern China/L1204/2012 (A/H5N8) segment 1 (PB2) 3895.7 0.000000e+00 2222/2278 (97%)
text_code_colored.png EPI493814 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 1 (PB2) 3840.3 0.000000e+00 2214/2281 (97%)
text_code_colored.png EPI672792 A/duck/Guangdong/s14044/2014 (A/H5N8) segment 1 (PB2) 3834.8 0.000000e+00 2213/2281 (97%)
text_code_colored.png EPI672784 A/goose/Guangdong/s13124/2013 (A/H5N8) segment 1 (PB2) 3834.8 0.000000e+00 2213/2281 (97%)
text_code_colored.png EPI493822 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 1 (PB2) 3829.2 0.000000e+00 2211/2280 (96%)
text_code_colored.png EPI548431 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 1 (PB2) 3757.2 0.000000e+00 2085/2111 (98%)
text_code_colored.png EPI493830 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 1 (PB2) 3757.2 0.000000e+00 2198/2280 (96%)
text_code_colored.png EPI328897 A/duck/Eastern China/909/2009 (A/H5N1) segment 1 (PB2) 3701.8 0.000000e+00 2188/2280 (95%)
text_code_colored.png EPI328889 A/duck/Eastern China/108/2008 (A/H5N1) segment 1 (PB2) 3696.3 0.000000e+00 2187/2280 (95%)
text_code_colored.png EPI328881 A/duck/Eastern China/031/2009 (A/H5N5) segment 1 (PB2) 3696.3 0.000000e+00 2187/2280 (95%)
text_code_colored.png EPI328873 A/duck/Eastern China/008/2008 (A/H5N5) segment 1 (PB2) 3696.3 0.000000e+00 2187/2280 (95%)
text_code_colored.png EPI441998 A/goose/Shandong/k1204/2009 (A/H5N5) segment 1 (PB2) 3663.0 0.000000e+00 2182/2281 (95%)
text_code_colored.png EPI442006 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 1 (PB2) 3646.4 0.000000e+00 2178/2280 (95%)
text_code_colored.png EPI703522 A/duck/Eastern China/L0230/2010 (A/H5N2) segment 1 (PB2) 3629.8 0.000000e+00 2176/2281 (95%)
text_code_colored.png EPI703521 A/duck/Eastern China/L0321/2010 (A/H5N2) segment 1 (PB2) 3618.7 0.000000e+00 2174/2281 (95%)
text_code_colored.png EPI398954 A/goose/Eastern China/1112/2011 (A/H5N2) segment 1 (PB2) 3618.7 0.000000e+00 2174/2281 (95%)
text_code_colored.png EPI431453 A/duck/Hebei/3/2011 (A/H5N2) segment 1 (PB2) 3602.1 0.000000e+00 2172/2282 (95%)
text_code_colored.png EPI431445 A/duck/Hebei/2/2011 (A/H5N2) segment 1 (PB2) 3602.1 0.000000e+00 2171/2281 (95%)
text_code_colored.png EPI414235 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 1 (PB2) 3602.1 0.000000e+00 2172/2282 (95%)
text_code_colored.png EPI398953 A/duck/Eastern China/1111/2011 (A/H5N2) segment 1 (PB2) 3568.8 0.000000e+00 2166/2282 (94%)
text_code_colored.png EPI326731 A/environment/Korea/CSM3/2002 (A/H3N6) segment 1 (PB2) 3557.8 0.000000e+00 2159/2275 (94%)
text_code_colored.png EPI387471 A/canvasback/Mongolia/2-69/2007 (A/H10) segment 1 (PB2) 3554.1 0.000000e+00 2162/2280 (94%)
text_code_colored.png EPI387371 A/whooper swan/Mongolia/1-14/2007 (A/H3N8) segment 1 (PB2) 3554.1 0.000000e+00 2162/2280 (94%)
text_code_colored.png EPI692501 A/duck/Hunan/S1012/2009 (A/H4N6) segment 1 (PB2) 3552.2 0.000000e+00 2163/2282 (94%)
text_code_colored.png EPI387468 A/ruddy shelduck/Mongolia/2-29/2007 (A/H3N2) segment 1 (PB2) 3548.5 0.000000e+00 2161/2280 (94%)
text_code_colored.png EPI837861 A/environment/Korea/W169/2007 (A/H7N7) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
text_code_colored.png EPI837856 A/environment/Korea/W136/2006 (A/H7N7) segment 1 (PB2) 3541.1 0.000000e+00 2162/2283 (94%)
text_code_colored.png EPI387467 A/pintail/Mongolia/2-11/2007 (A/H4N2) segment 1 (PB2) 3541.1 0.000000e+00 2159/2279 (94%)
text_code_colored.png EPI387473 A/pintail/Mongolia/2-80/2007 (A/H4N6) segment 1 (PB2) 3539.3 0.000000e+00 2156/2275 (94%)
text_code_colored.png EPI837857 A/environment/Korea/W143/2006 (A/H7N7) segment 1 (PB2) 3535.6 0.000000e+00 2161/2283 (94%)
text_code_colored.png EPI527592 A/ruddy shelduck/Mongolia/961V/2009 (A/H3N8) segment 1 (PB2) 3530.1 0.000000e+00 2160/2283 (94%)
text_code_colored.png EPI272278 A/duck/Korea/A14/2008 (A/H5N2) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
text_code_colored.png EPI837858 A/environment/Korea/W148/2006 (A/H7N7) segment 1 (PB2) 3519.0 0.000000e+00 2158/2283 (94%)
text_code_colored.png EPI527543 A/ruddy shelduck/Mongolia/590C2/2009 (A/H11N2) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
text_code_colored.png EPI387375 A/whooper swan/Mongolia/1-25/2007 (A/H3N8) segment 1 (PB2) 3513.4 0.000000e+00 2155/2280 (94%)
text_code_colored.png EPI469140 A/duck/Guangdong/4323/2007 (A/H11N9) segment 1 (PB2) 3511.6 0.000000e+00 2155/2282 (94%)
text_code_colored.png EPI387376 A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 1 (PB2) 3506.1 0.000000e+00 2134/2251 (94%)
text_code_colored.png EPI231142 A/spot-billed duck/Korea/527/2008 (A/H6N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
text_code_colored.png EPI231150 A/spot-billed duck/Korea/528/2008 (A/H6N8) segment 1 (PB2) 3498.7 0.000000e+00 2150/2277 (94%)
text_code_colored.png EPI540396 A/duck/Bangladesh/1293/2008 (A/H6N1) segment 1 (PB2) 3496.8 0.000000e+00 2152/2281 (94%)
text_code_colored.png EPI508024 A/wild duck/Korea/CSM27-12/2009 (A/H7N6) segment 1 (PB2) 3496.8 0.000000e+00 2153/2282 (94%)
text_code_colored.png EPI401351 A/wild duck/Korea/SH5-60/2008 (A/H4N6) segment 1 (PB2) 3496.8 0.000000e+00 2154/2283 (94%)
text_code_colored.png EPI231206 A/spot-billed duck/Korea/619/2008 (A/H6N2) segment 1 (PB2) 3496.8 0.000000e+00 2153/2282 (94%)
text_code_colored.png EPI387374 A/whooper swan/Mongolia/1-23/2007 (A/H3N8) segment 1 (PB2) 3493.1 0.000000e+00 2152/2281 (94%)
text_code_colored.png EPI231182 A/spot-billed duck/Korea/540/2008 (A/H6N1) segment 1 (PB2) 3493.1 0.000000e+00 2145/2271 (94%)
text_code_colored.png EPI703536 A/duck/Eastern China/S0808/2014 (A/H5N2) segment 1 (PB2) 3491.3 0.000000e+00 2153/2282 (94%)
text_code_colored.png EPI527568 A/mallard /Mongolia/1551/2010 (A/H3N1) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
text_code_colored.png EPI508023 A/wild duck/Korea/SH20-27/2008 (A/H7N9) segment 1 (PB2) 3491.3 0.000000e+00 2153/2283 (94%)
text_code_colored.png EPI387907 A/wild bird/Korea/A323/2009 (A/H10N1) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
text_code_colored.png EPI284618 A/duck/Hunan/8-19/2009 (A/H4N2) segment 1 (PB2) 3491.3 0.000000e+00 2151/2281 (94%)
text_code_colored.png EPI231190 A/spot-billed duck/Korea/545/2008 (A/H6N1) segment 1 (PB2) 3487.6 0.000000e+00 2144/2271 (94%)
text_code_colored.png EPI231174 A/spot-billed duck/Korea/537/2008 (A/H6N1) segment 1 (PB2) 3487.6 0.000000e+00 2144/2271 (94%)
text_code_colored.png EPI586240 A/muskrat/Russia/63/2014 (A/H2N2) segment 1 (PB2) 3485.7 0.000000e+00 2149/2279 (94%)
text_code_colored.png EPI527548 A/northern shoveler/ Mongolia/973/2009 (A/H3N8) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI503958 A/wild duck/SH17-1/2008 (A/H2N3) segment 1 (PB2) 3485.7 0.000000e+00 2152/2283 (94%)
text_code_colored.png EPI469230 A/duck/Jiangxi/22041/2008 (A/H4N9) segment 1 (PB2) 3485.7 0.000000e+00 2152/2283 (94%)
text_code_colored.png EPI469202 A/duck/Jiangxi/3286/2009 (A/H7N9) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI469201 A/duck/Jiangxi/3230/2009 (A/H7N9) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI469200 A/duck/Jiangxi/3214/2009 (A/H7N9) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI469199 A/duck/Jiangxi/3190/2009 (A/H7N9) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI469198 A/duck/Jiangxi/3169/2009 (A/H7N9) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI469197 A/duck/Jiangxi/3141/2009 (A/H7N9) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI469196 A/duck/Jiangxi/3096/2009 (A/H7N9) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI469142 A/duck/Jiangxi/3257/2009 (A/H7N9) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI469141 A/duck/Jiangxi/3152/2009 (A/H7N9) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI469135 A/duck/Jiangxi/3283/2009 (A/H7N9) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI341923 A/chicken/Korea/KNUWSJ09/2009 (A/H9N2) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI272279 A/duck/Korea/A93/2008 (A/H5N2) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI272276 A/chicken/Korea/A170/2009 (A/H9N2) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
text_code_colored.png EPI21386 A/duck/Zhejiang/11/2000 (A/H5N1) segment 1 (PB2) 3485.7 0.000000e+00 2150/2281 (94%)
text_code_colored.png EPI118429 A/migratory duck/Hong Kong/MP206/2004 (A/H5N2) segment 1 (PB2) 3483.9 0.000000e+00 2119/2234 (94%)
text_code_colored.png EPI527560 A/ruddy shelduck/Mongolia/963V/2009 (A/H3N8) segment 1 (PB2) 3480.2 0.000000e+00 2151/2283 (94%)
text_code_colored.png EPI227118 A/duck/Beijing/61/05 (A/H3N8) segment 1 (PB2) 3480.2 0.000000e+00 2150/2282 (94%)
text_code_colored.png EPI837864 A/environment/Korea/W267/2007 (A/H7N4) segment 1 (PB2) 3474.7 0.000000e+00 2149/2282 (94%)
text_code_colored.png EPI837863 A/environment/Korea/W266/2007 (A/H7N4) segment 1 (PB2) 3474.7 0.000000e+00 2149/2282 (94%)
text_code_colored.png EPI641767 A/duck/Thailand/CU-11655T/2011 (A/H4N6) segment 1 (PB2) 3474.7 0.000000e+00 2149/2282 (94%)
text_code_colored.png EPI341932 A/duck/Nanjing/20/2010 (A/H1N3) segment 1 (PB2) 3474.7 0.000000e+00 2148/2281 (94%)
text_code_colored.png EPI341883 A/duck/Korea/KNUDPJ09/2009 (A/H9N2) segment 1 (PB2) 3474.7 0.000000e+00 2149/2282 (94%)
text_code_colored.png EPI306420 A/mallard/Korea/KNU YP09/2009 (A/H1N1) segment 1 (PB2) 3474.7 0.000000e+00 2144/2275 (94%)
text_code_colored.png EPI229247 A/duck/Beijing/40/04 (A/H3N8) segment 1 (PB2) 3474.7 0.000000e+00 2149/2282 (94%)
text_code_colored.png EPI540324 A/duck/Bangladesh/1575/2009 (A/H3N8) segment 1 (PB2) 3469.1 0.000000e+00 2150/2284 (94%)
text_code_colored.png EPI540316 A/duck/Bangladesh/1576/2009 (A/H3N8) segment 1 (PB2) 3469.1 0.000000e+00 2150/2284 (94%)
text_code_colored.png EPI540308 A/duck/Bangladesh/1574/2009 (A/H3N8) segment 1 (PB2) 3469.1 0.000000e+00 2150/2284 (94%)
text_code_colored.png EPI469148 A/duck/Jiangxi/3292/2009 (A/H7N9) segment 1 (PB2) 3469.1 0.000000e+00 2140/2270 (94%)
text_code_colored.png EPI401301 A/wild duck/Korea/CSM20-5/2009 (A/H4N6) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
text_code_colored.png EPI341939 A/duck/Nanjing/19/2010 (A/H1N3) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
text_code_colored.png EPI341891 A/chicken/Korea/KNUSWR09/2009 (A/H9N2) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
text_code_colored.png EPI272275 A/chicken/Korea/A146/2009 (A/H9N2) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
text_code_colored.png EPI269178 A/duck/Hunan/491/2005 (A/H6N2) segment 1 (PB2) 3469.1 0.000000e+00 2149/2283 (94%)
text_code_colored.png EPI231158 A/spot-billed duck/Korea/534/2008 (A/H6N1) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
text_code_colored.png EPI231134 A/mallard/Korea/L08-8/2008 (A/H6N1) segment 1 (PB2) 3469.1 0.000000e+00 2148/2281 (94%)
text_code_colored.png EPI219337 A/mallard/Hokkaido/24/2009 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2150/2284 (94%)
text_code_colored.png EPI231166 A/spot-billed duck/Korea/536/2008 (A/H6N1) segment 1 (PB2) 3465.4 0.000000e+00 2132/2259 (94%)
text_code_colored.png EPI703533 A/duck/Eastern China/S0131/2014 (A/H5N2) segment 1 (PB2) 3463.6 0.000000e+00 2148/2282 (94%)
text_code_colored.png EPI527580 A/velvet scoter/Mongolia/969V/2009 (A/H3N8) segment 1 (PB2) 3463.6 0.000000e+00 2148/2283 (94%)
text_code_colored.png EPI527562 A/mallard/Mongolia/651/2010 (A/H2N3) segment 1 (PB2) 3463.6 0.000000e+00 2147/2282 (94%)
text_code_colored.png EPI461800 A/environment/Hunan/S4304/2011 (A/H3N2) segment 1 (PB2) 3463.6 0.000000e+00 2147/2282 (94%)
text_code_colored.png EPI363928 A/duck/Guizhou/1560/2007 (A/H6N8) segment 1 (PB2) 3463.6 0.000000e+00 2148/2283 (94%)
text_code_colored.png EPI345513 A/duck/Eastern China/50/2002 (A/H6N8) segment 1 (PB2) 3463.6 0.000000e+00 2148/2283 (94%)
text_code_colored.png EPI272277 A/duck/Korea/A174/2009 (A/H9N2) segment 1 (PB2) 3459.9 0.000000e+00 2140/2272 (94%)
text_code_colored.png EPI500923 A/Chicken/Hunan/S4495/2010 (A/H6N6) segment 1 (PB2) 3458.0 0.000000e+00 2147/2283 (94%)
text_code_colored.png EPI438431 A/duck/Vietnam/LBM81/2012 (A/H11N9) segment 1 (PB2) 3458.0 0.000000e+00 2146/2282 (94%)
text_code_colored.png EPI416366 A/wild duck/Korea/SNU50-5/2009 (A/H5N1) segment 1 (PB2) 3458.0 0.000000e+00 2146/2282 (94%)
text_code_colored.png EPI416360 A/wild duck/Korea/SNU50-5/2009 (A/H5N1) segment 1 (PB2) 3458.0 0.000000e+00 2146/2282 (94%)
text_code_colored.png EPI296674 A/chicken/Korea/SH0902/2009 (A/H9N2) segment 1 (PB2) 3458.0 0.000000e+00 2146/2282 (94%)
text_code_colored.png EPI222161 A/mallard/Altai/1208/2007 (A/H3N6) segment 1 (PB2) 3458.0 0.000000e+00 2146/2282 (94%)
text_code_colored.png EPI222076 A/gadwall/Altai/1328/2007 (A/H3N8) segment 1 (PB2) 3458.0 0.000000e+00 2146/2282 (94%)
text_code_colored.png EPI296687 A/duck/Korea/SH0915/2009 (A/H9N2) segment 1 (PB2) 3456.2 0.000000e+00 2145/2281 (94%)
text_code_colored.png EPI296685 A/chicken/Korea/SH0913/2009 (A/H9N2) segment 1 (PB2) 3456.2 0.000000e+00 2145/2281 (94%)
text_code_colored.png EPI584050 A/environment/Kagoshima/KU-ngr-D/2012(H4N6) (A/H4N6) segment 1 (PB2) 3452.5 0.000000e+00 2144/2281 (93%)
text_code_colored.png EPI542394 A/muscovy duck/Vietnam/LBM687/2014 (A/H4N6) segment 1 (PB2) 3452.5 0.000000e+00 2144/2281 (93%)
text_code_colored.png EPI540356 A/duck/Bangladesh/1766/2010 (A/H4N6) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI527582 A/red-crested pochard/Mongolia/463V/2009 (A/H3N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI527559 A/mallard/Mongolia/1581/2010 (A/H3N8) segment 1 (PB2) 3452.5 0.000000e+00 2147/2284 (94%)
text_code_colored.png EPI432530 r8 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432522 r78 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432514 r7 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432506 r68 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432498 r678 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432490 r67 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432482 r6 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432474 r58 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432466 r578 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432458 r57 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432450 r568 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432442 r5678 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432434 r567 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432426 r56 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432418 r5 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432410 r38 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432402 r378 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432394 r37 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432386 r368 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432378 r3678 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432370 r367 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432362 r36 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432354 r358 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432346 r3578 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432338 r357 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432330 r3568 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432322 r35678 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432314 r3567 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432306 r356 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432298 r35 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432290 r3 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432282 r28 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432274 r278 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432266 r27 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432258 r268 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432250 r2678 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432242 r267 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432234 r26 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432226 r258 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432218 r2578 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432210 r257 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432202 r2568 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432194 r25678 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432186 r2567 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432178 r256 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432170 r25 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432162 r238 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432154 r2378 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432146 r237 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432138 r2368 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432130 r23678 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432122 r2367 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432114 r236 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432106 r2358 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432098 r23578 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432090 r2357 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432082 r23568 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432074 r235678 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432066 r23567 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432058 r2356 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432050 r235 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432042 r23 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI432034 r2 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI406486 A/baikal teal/Xianghai/421/2011 (A/H9N2) segment 1 (PB2) 3452.5 0.000000e+00 2146/2283 (93%)
text_code_colored.png EPI375120 A/wild bird/Korea/A72/10 (A/H7N7) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI296686 A/chicken/Korea/SH0914/2009 (A/H9N2) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI222092 A/garganey/Altai/1216/2007 (A/H3N6) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI222068 A/gadwall/Altai/1326/2007 (A/H3N8) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI222052 A/gadwall/Altai/1324/2007 (A/H3N8) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI21370 A/duck/Guangxi/35/2001 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI1644 A/duck/Hokkaido/Vac-1/04 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
text_code_colored.png EPI775003 A/duck/Hebei/B1645-2/2011 (A/H3N2) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
text_code_colored.png EPI540380 A/duck/Bangladesh/1784/2010 (A/H4N6) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
text_code_colored.png EPI461544 A/duck/Hunan/S11090/2012 (A/H4N6) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
text_code_colored.png EPI441049 A/muscovy duck/Vietnam/LBM198/2012 (A/H6N2) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
text_code_colored.png EPI438278 A/duck/Vietnam/LBM300/2012 (A/H10N2) segment 1 (PB2) 3447.0 0.000000e+00 2146/2284 (93%)
text_code_colored.png EPI418268 A/muscovy duck/Vietnam/LBM189/2012 (A/H3N2) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
text_code_colored.png EPI363556 A/duck/Jiangxi/5748/2006 (A/H6N2) segment 1 (PB2) 3447.0 0.000000e+00 2146/2284 (93%)
text_code_colored.png EPI269267 A/duck/Shantou/4534/2001 (A/H6N2) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
text_code_colored.png EPI243254 A/R(duck/Mongolia/54/01-duck/Mongolia/47/01) (A/H5N1) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
text_code_colored.png EPI21378 A/duck/Shanghai/13/2001 (A/H5N1) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
text_code_colored.png EPI3405 A/duck/Mongolia/54/01 (A/H5N2) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
text_code_colored.png EPI375122 A/mandarin duck/Korea/468/11 (A/H7N3) segment 1 (PB2) 3445.1 0.000000e+00 2141/2278 (93%)
text_code_colored.png EPI544764 A/environment/Shanghai/LPM1/2013 (A/H3N2) segment 1 (PB2) 3441.4 0.000000e+00 2142/2281 (93%)
text_code_colored.png EPI461552 A/duck/Hunan/S11200/2012 (A/H4N6) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
text_code_colored.png EPI441045 A/duck/Vietnam/LBM185/2012 (A/H6N6) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
text_code_colored.png EPI387908 A/mallard/Korea/1203/2010 (A/H10N8) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
text_code_colored.png EPI236709 A/goose/Hong Kong/668.1/2001 (A/H5N1) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
text_code_colored.png EPI236668 A/duck/Guangxi/xa/2001 (A/H5N1) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
text_code_colored.png EPI89224 A/duck/Nanchang/1749/1992 (A/H11N2) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
text_code_colored.png EPI89095 A/Chicken/Nanchang/2-0527/2000 (A/H4N6) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
text_code_colored.png EPI508030 A/wild duck/Korea/MHC40-28/2010 (A/H7N7) segment 1 (PB2) 3439.6 0.000000e+00 2141/2280 (93%)
text_code_colored.png EPI314196 A/wild duck/Taiwan/WB1162/2006 (A/H4N6) segment 1 (PB2) 3439.6 0.000000e+00 2108/2230 (94%)
text_code_colored.png EPI17806 A/Chicken/HongKong/YU822.2/01 (A/H5N1) segment 1 (PB2) 3439.6 0.000000e+00 2142/2281 (93%)
text_code_colored.png EPI540348 A/duck/Bangladesh/1783/2010 (A/H4N6) segment 1 (PB2) 3435.9 0.000000e+00 2142/2282 (93%)
text_code_colored.png EPI335318 A/Korean native chicken/Korea/K040110/2010 (A/H9N2) segment 1 (PB2) 3435.9 0.000000e+00 2142/2282 (93%)
text_code_colored.png EPI237967 A/duck/Hong Kong/2986.1-2/2000 (A/H5N1) segment 1 (PB2) 3435.9 0.000000e+00 2143/2283 (93%)
text_code_colored.png EPI236935 A/waterfowl/Hong Kong/378.5/2001 (A/H5N1) segment 1 (PB2) 3435.9 0.000000e+00 2142/2282 (93%)
text_code_colored.png EPI236555 A/Duck/Hong Kong/380.5/2001 (A/H5N1) segment 1 (PB2) 3435.9 0.000000e+00 2142/2282 (93%)
text_code_colored.png EPI108735 A/chicken/Jiangsu/cz1/2002 (A/H5N1) segment 1 (PB2) 3435.9 0.000000e+00 2143/2283 (93%)
text_code_colored.png EPI89120 A/Duck/Nanchang/4-165/2000 (A/H4N6) segment 1 (PB2) 3435.9 0.000000e+00 2142/2282 (93%)
text_code_colored.png EPI476580 A/duck/Thailand/CU-8319T/2010 (A/H9N7) segment 1 (PB2) 3432.2 0.000000e+00 2135/2272 (93%)
text_code_colored.png EPI600849 A/duck/Jiangxi/22960/2008 (A/H10N8) segment 1 (PB2) 3430.3 0.000000e+00 2142/2283 (93%)
text_code_colored.png EPI508021 A/mallard/Korea/NHG187/2008 (A/H7N7) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
text_code_colored.png EPI506533 A/duck/Thailand/CU-11869C/2011 (A/H1N9) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
text_code_colored.png EPI384004 A/duck/Thailand/CU-9744C /2010 (A/H7N4) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
text_code_colored.png EPI383958 A/duck/Thailand/CU-9754C/2010 (A/H7N4) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
text_code_colored.png EPI296688 A/chicken/Korea/HC0410/2009 (A/H9N2) segment 1 (PB2) 3430.3 0.000000e+00 2138/2277 (93%)
text_code_colored.png EPI228863 A/swine/Henan/wy/2004 (A/H5N1) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
text_code_colored.png EPI26502 A/swan/Guangxi/307/2004 (A/H5N1) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
text_code_colored.png EPI26498 A/Chicken/Henan/16/2004 (A/H5N1) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
text_code_colored.png EPI25322 A/chicken/Hubei/489/2004 (A/H5N1) segment 1 (PB2) 3430.3 0.000000e+00 2142/2283 (93%)
text_code_colored.png EPI24683 A/chicken/Hubei/327/2004 (A/H5N1) segment 1 (PB2) 3430.3 0.000000e+00 2143/2284 (93%)
text_code_colored.png EPI596387 A/muscovy duck/Vietnam/LBM201/2012 (A/H3N2) segment 1 (PB2) 3428.5 0.000000e+00 2139/2282 (93%)
text_code_colored.png EPI775004 A/duck/Hebei/B1646-2/2011 (A/H3N2) segment 1 (PB2) 3424.8 0.000000e+00 2138/2280 (93%)
text_code_colored.png EPI469168 A/northern shoveler/Hong Kong/MPE2984/2008 (A/H10N9) segment 1 (PB2) 3424.8 0.000000e+00 2141/2283 (93%)
text_code_colored.png EPI457918 A/duck/Guangxi/GXd-2/2012 (A/H1N2) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
text_code_colored.png EPI367586 A/mallard/Czech Republic/15008-11K/2009 (A/H5N3) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
text_code_colored.png EPI276133 A/pintail/Aomori/1130/2008 (A/H1N3) segment 1 (PB2) 3424.8 0.000000e+00 2139/2281 (93%)
text_code_colored.png EPI139856 A/Ck/HK/YU22/2002 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
text_code_colored.png EPI314220 A/wild duck/Taiwan/WB2/1998 (A/H4N6) segment 1 (PB2) 3423.0 0.000000e+00 2106/2231 (94%)
text_code_colored.png EPI375121 A/wild bird/Korea/A9/11 (A/H7N9) segment 1 (PB2) 3421.1 0.000000e+00 2134/2273 (93%)
text_code_colored.png EPI231198 A/spot-billed duck/Korea/546/2008 (A/H6N1) segment 1 (PB2) 3421.1 0.000000e+00 2108/2235 (94%)
text_code_colored.png EPI527585 A/ruddy shelduck/Mongolia/974/2010 (A/H10N7) segment 1 (PB2) 3419.3 0.000000e+00 2140/2283 (93%)
text_code_colored.png EPI508020 A/Northern shoveler/Korea/SD175/2008 (A/H7N3) segment 1 (PB2) 3419.3 0.000000e+00 2140/2283 (93%)
text_code_colored.png EPI503959 A/wild duck/SH17-34/2008 (A/H2N3) segment 1 (PB2) 3419.3 0.000000e+00 2140/2283 (93%)
text_code_colored.png EPI356360 A/wild duck/Korea/CSM4-12/2009 (A/H5N1) segment 1 (PB2) 3419.3 0.000000e+00 2113/2243 (94%)
text_code_colored.png EPI237905 A/Goose/Hong Kong/3014.5/2000 (A/H5N1) segment 1 (PB2) 3419.3 0.000000e+00 2139/2282 (93%)
text_code_colored.png EPI236725 A/goose/Viet Nam/324/2001 (A/H5N1) segment 1 (PB2) 3419.3 0.000000e+00 2139/2282 (93%)
text_code_colored.png EPI236717 A/goose/Viet Nam/113/2001 (A/H5N1) segment 1 (PB2) 3419.3 0.000000e+00 2139/2282 (93%)
text_code_colored.png EPI135190 A/duck/Shantou/1930/2001 (A/H5N1) segment 1 (PB2) 3419.3 0.000000e+00 2138/2281 (93%)
text_code_colored.png EPI135133 A/chicken/Shantou/904/2001 (A/H5N1) segment 1 (PB2) 3419.3 0.000000e+00 2139/2282 (93%)
text_code_colored.png EPI89277 A/duck/Hong Kong/7/1975 (A/H3N2) segment 1 (PB2) 3419.3 0.000000e+00 2139/2282 (93%)
text_code_colored.png EPI26496 A/Chicken/Henan/13/2004 (A/H5N1) segment 1 (PB2) 3419.3 0.000000e+00 2139/2282 (93%)
text_code_colored.png EPI26494 A/Chicken/Henan/12/2004 (A/H5N1) segment 1 (PB2) 3419.3 0.000000e+00 2139/2282 (93%)
Link to comment
Share on other sites

Please sign in to comment

You will be able to leave a comment after signing in



Sign In Now
  • Recently Browsing   0 members

    • No registered users viewing this page.
×
×
  • Create New...