May 2015 Zika Partial Sequence From Brazil

[niman]

LOCUS       KU232301                 692 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 072ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232301
VERSION     KU232301.1  GI:987895001
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1

[niman]

LOCUS       KU232301                 692 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 072ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232301
VERSION     KU232301.1  GI:987895001
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..692
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="072ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>692
                     /codon_start=2
                     /product="NS5 protein"
                     /protein_id="AME17086.1"
                     /db_xref="GI:987895002"
                     /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM
                     YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK
                     TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN
                     WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW
                     EEVPFCSHHFNK"
ORIGIN      
        1 tgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg
       61 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc
      121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga
      181 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt
      241 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa
      301 agggaaaaca gtyatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt
      361 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc
      421 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa
      481 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg
      541 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg
      601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga
      661 agttccgttt tgctcccacc acttcaacaa gc

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1243	1243	99%	0.0	99%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1243	1243	99%	0.0	99%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1240	1240	99%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1240	1240	99%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1240	1240	99%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1240	1240	99%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1236	1236	99%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1234	1234	99%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1234	1234	99%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1232	1232	99%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1232	1232	99%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1232	1232	99%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1231	1231	99%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1231	1231	99%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1231	1231	99%	0.0	99%	KM078929.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1222	1222	99%	0.0	99%	KF993678.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1214	1214	97%	0.0	99%	KJ873160.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1189	1189	99%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1186	1186	99%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1135	1135	91%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1074	1074	100%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	930	930	76%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	902	902	76%	0.0	98%	KM851038.1

[niman]

Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds

GenBank: KU232300.1

FASTA Graphics

Go to:

LOCUS       KU232300                 692 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232300
VERSION     KU232300.1  GI:987894999
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..692
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="067ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>692
                     /codon_start=2
                     /product="NS5 protein"
                     /protein_id="AME17085.1"
                     /db_xref="GI:987895000"
                     /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM
                     YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK
                     TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN
                     WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW
                     EEVPFCSHHFNK"
ORIGIN      
        1 tgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg
       61 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc
      121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga
      181 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt
      241 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa
      301 agggaaaaca gtyatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt
      361 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc
      421 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa
      481 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg
      541 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg
      601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga
      661 agttccgttt tgctcccacc acttcaacaa gc

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1243	1243	99%	0.0	99%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1243	1243	99%	0.0	99%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1240	1240	99%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1240	1240	99%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1240	1240	99%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1240	1240	99%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1236	1236	99%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1234	1234	99%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1234	1234	99%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1232	1232	99%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1232	1232	99%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1232	1232	99%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1231	1231	99%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1231	1231	99%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1231	1231	99%	0.0	99%	KM078929.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1222	1222	99%	0.0	99%	KF993678.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1214	1214	97%	0.0	99%	KJ873160.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1189	1189	99%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1186	1186	99%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1135	1135	91%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1074	1074	100%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	930	930	76%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	902	902	76%	0.0	98%	KM851038.1

[niman]

LOCUS       KU232299                 661 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232299
VERSION     KU232299.1  GI:987894997
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 661)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 661)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..661
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="015ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>661
                     /codon_start=2
                     /product="NS5 protein"
                     /protein_id="AME17084.1"
                     /db_xref="GI:987894998"
                     /translation="LNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDT
                     AGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDI
                     ISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSN
                     GWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPF
                     CS"
ORIGIN      
        1 cttgaacgag gatcactgga tggggagaga gaactcagga ggtggtgttg aagggctggg
       61 attacaaaga ctcggatatg tcctagaaga gatgagtcgc ataccaggag gaaggatgta
      121 tgcagatgac actgctggct gggacacccg catcagcagg tttgatctgg agaatgaagc
      181 tctaatcacc aaccaaatgg agaaagggca cagggccttg gcattggcca taatcaagta
      241 cacataccaa aacaaagtgg taaaggtcct tagaccagct gaaaaaggga aaacagttat
      301 ggacattatt tcgagacaag accaaagggg gagcggacaa gttgtcactt acgctcttaa
      361 cacatttacc aacctagtgg tgcaactcat tcggaatatg gaggctgagg aagttctaga
      421 gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg accaactggt tgcagagcaa
      481 cggatgggat aggctcaaac gaatggcagt cagtggagat gattgcgttg tgaagccaat
      541 tgatgatagg tttgcacatg ccctcaggtt cttgaatgat atgggaaaag ttaggaagga
      601 cacacaagag tggaaaccct caactggatg ggacaactgg gaagaagttc cgttttgctc
      661 c

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1193	1193	100%	0.0	100%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1193	1193	100%	0.0	100%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1187	1187	100%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1187	1187	100%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1187	1187	100%	0.0	99%	KM078936.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1187	1187	100%	0.0	99%	KJ873160.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1187	1187	100%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1186	1186	100%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1184	1184	100%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1184	1184	100%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1184	1184	100%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1184	1184	100%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1184	1184	100%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1184	1184	100%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1184	1184	100%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1180	1180	100%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1180	1180	100%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1180	1180	100%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1178	1178	100%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1178	1178	100%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1178	1178	100%	0.0	99%	KM078929.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1169	1169	100%	0.0	99%	KF993678.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1139	1139	100%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1133	1133	100%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1108	1108	93%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1025	1025	100%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	902	902	77%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	881	881	77%	0.0	98%	KM851038.1

[niman]

LOCUS       KU232298                 678 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232298
VERSION     KU232298.1  GI:987894995
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 678)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 678)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..678
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="050ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>678
                     /codon_start=2
                     /product="NS5 protein"
                     /protein_id="AME17083.1"
                     /db_xref="GI:987894996"
                     /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA
                     DDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTV
                     MDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWL
                     QSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEE
                     VPFCSHH"
ORIGIN      
        1 ccttggattc ttgaacgagg atcactggat ggggagagag aactcaggag gtggtgttga
       61 agggctggga ttacaaagac tcggatatgt cctagaagag atgagtcgca taccaggagg
      121 aaggatgtat gcagatgaca ctgctggctg ggacacccgc atcagcaggt ttgatctgga
      181 gaatgaagct ctaatcacca accaaatgga gaaagggcac agggccttgg cattggccat
      241 aatcaagtac acataccaaa acaaagtggt aaaggtcctt agaccagctg aaaaagggaa
      301 aacagttatg gacattattt cgagacaaga ccaaaggggg agcggacaag ttgtcactta
      361 cgctcttaac acatttacca acctagtggt gcaactcatt cggaatatgg aggctgagga
      421 agttctagag atgcaagact tgtggctgct gcggaggtca gagaaagtga ccaactggtt
      481 gcagagcaac ggatgggata ggctcaaacg aatggcagtc agtggagatg attgcgttgt
      541 gaagccaatt gatgataggt ttgcacatgc cctcaggttc ttgaatgata tgggaaaagt
      601 taggaaggac acacaagagt ggaaaccctc aactggatgg gacaactggg aagaagttcc
      661 gttttgctcc caccattt

http://www.ncbi.nlm.nih.gov/nuccore/KU232298.1

 

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1218	1218	100%	0.0	99%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1218	1218	100%	0.0	99%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1214	1214	100%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1214	1214	100%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1214	1214	100%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1214	1214	100%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1211	1211	100%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1209	1209	100%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1209	1209	100%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1209	1209	100%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1209	1209	100%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1209	1209	100%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1209	1209	100%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1209	1209	100%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1207	1207	100%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1207	1207	100%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1207	1207	100%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1205	1205	100%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1205	1205	100%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1205	1205	100%	0.0	99%	KM078929.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1198	1198	98%	0.0	99%	KJ873160.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1196	1196	100%	0.0	99%	KF993678.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1164	1164	100%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1160	1160	100%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1119	1119	92%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1047	1047	100%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	913	913	76%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	890	890	76%	0.0	98%	KM851038.1

[niman]

LOCUS       KU232297                 693 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232297
VERSION     KU232297.1  GI:987894993
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 693)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 693)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..693
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="049ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>693
                     /codon_start=2
                     /product="NS5 protein"
                     /protein_id="AME17082.1"
                     /db_xref="GI:987894994"
                     /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM
                     YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK
                     TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN
                     WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW
                     EEVPFCSHHFNK"
ORIGIN      
        1 tgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg
       61 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc
      121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga
      181 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt
      241 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa
      301 agggaaaaca gtcatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt
      361 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc
      421 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa
      481 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg
      541 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg
      601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga
      661 ggttccgttt tgctcccacc atttcaacaa gca

http://www.ncbi.nlm.nih.gov/nuccore/KU232297.1

 

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1232	1232	99%	0.0	99%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1232	1232	99%	0.0	99%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1229	1229	99%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1229	1229	99%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1229	1229	99%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1229	1229	99%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1225	1225	99%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1223	1223	99%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1223	1223	99%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1223	1223	99%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1223	1223	99%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1223	1223	99%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1223	1223	99%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1223	1223	99%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1222	1222	99%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1222	1222	99%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1222	1222	99%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1220	1220	99%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1220	1220	99%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1220	1220	99%	0.0	99%	KM078929.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1211	1211	99%	0.0	99%	KF993678.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1204	1204	97%	0.0	99%	KJ873160.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1178	1178	99%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1175	1175	99%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1124	1124	91%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1063	1063	99%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	919	919	76%	0.0	98%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	892	892	76%	0.0	98%	KM851038.1

[niman]

LOCUS       KU232296                 676 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232296
VERSION     KU232296.1  GI:987894991
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 676)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 676)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..676
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="045ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>676
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17081.1"
                     /db_xref="GI:987894992"
                     /translation="GFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYAD
                     DTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVM
                     DIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQ
                     SNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEV
                     PFCSHH"
ORIGIN      
        1 ttggattctt gaacgaggat cactggatgg ggagagagaa ctcaggaggt ggtgttgaag
       61 ggctgggatt acaaagactc ggatatgtcc tagaagagat gagtcgcata ccaggaggaa
      121 ggatgtatgc agatgacact gctggctggg acacccgcat cagcaggttt gatctggaga
      181 atgaagctct aatcaccaac caaatggaga aagggcacag ggccttggca ttggccataa
      241 tcaagtacac ataccaaaac aaagtggtaa aggtccttag accagctgaa aaagggaaaa
      301 cagttatgga cattatttcg agacaagacc aaagggggag cggacaagtt gtcacttacg
      361 ctcttaacac atttaccaac ctagtggtgc aactcattcg gaatatggag gctgaggaag
      421 ttctagagat gcaagacttg tggctgctgc ggaggtcaga gaaagtgacc aactggttgc
      481 agagcaacgg atgggatagg ctcaaacgaa tggcagtcag tggagatgat tgcgttgtga
      541 agccaattga tgataggttt gcacatgccc tcaggttctt gaatgatatg ggaaaagtta
      601 ggaaggacac acaagagtgg aaaccctcaa ctggatggga caactgggaa gaagttccgt
      661 tttgctccca ccattt

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1243	1243	99%	0.0	100%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1243	1243	99%	0.0	100%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1238	1238	99%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1238	1238	99%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1238	1238	99%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1238	1238	99%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1234	1234	99%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1232	1232	99%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1232	1232	99%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1232	1232	99%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1232	1232	99%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1232	1232	99%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1232	1232	99%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1232	1232	99%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1229	1229	99%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1229	1229	99%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1229	1229	99%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1227	1227	99%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1227	1227	99%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1227	1227	99%	0.0	99%	KM078929.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1225	1225	98%	0.0	99%	KJ873160.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1216	1216	99%	0.0	99%	KF993678.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1177	1177	99%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1171	1171	99%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1144	1144	92%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1033	1033	99%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	929	929	76%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	902	902	76%	0.0	98%	KM851038.1

[niman]

LOCUS       KU232295                 672 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232295
VERSION     KU232295.1  GI:987894989
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 672)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 672)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..672
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="068ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>672
                     /codon_start=1
                     /product="NS5 protein"
                     /protein_id="AME17080.1"
                     /db_xref="GI:987894990"
                     /translation="GFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYAD
                     DTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVM
                     DIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQ
                     SNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEV
                     PFCSHH"
ORIGIN      
        1 ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg tgttgaaggg
       61 ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc aggaggaagg
      121 atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga tctggagaat
      181 gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt ggccataatc
      241 aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa agggaaaaca
      301 gttatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt cacttacgct
      361 cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc tgaggaagtt
      421 ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa ctggttgcag
      481 agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg cgttgtgaag
      541 ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg aaaagttagg
      601 aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga agttccgttt
      661 tgctcccacc at

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1240	1240	99%	0.0	100%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1240	1240	99%	0.0	100%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1234	1234	99%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1234	1234	99%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1234	1234	99%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1230	1230	99%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1229	1229	99%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1229	1229	99%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1229	1229	99%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1229	1229	99%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1229	1229	99%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1229	1229	99%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1229	1229	99%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1225	1225	99%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1225	1225	99%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1225	1225	99%	0.0	99%	KM078933.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1225	1225	99%	0.0	99%	KJ873160.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1223	1223	99%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1223	1223	99%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1223	1223	99%	0.0	99%	KM078929.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1212	1212	99%	0.0	99%	KF993678.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1173	1173	99%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1168	1168	99%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1144	1144	92%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1029	1029	99%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	929	929	77%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	902	902	77%	0.0	98%	KM851038.1

[niman]

LOCUS       KU232294                 679 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232294
VERSION     KU232294.1  GI:987894987
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 679)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 679)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..679
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="061ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>679
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17079.1"
                     /db_xref="GI:987894988"
                     /translation="ALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMY
                     ADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKT
                     VMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNW
                     LQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWE
                     EVPFCSH"
ORIGIN      
        1 aagcccttgg attcttgaac gaggatcact ggatggggag agagaactca ggaggtggtg
       61 ttgaagggct gggattacaa agactcggat atgtcctaga agagatgagt cgcataccag
      121 gaggaaggat gtatgcagat gacactgctg gctgggacac ccgcatcagc aggtttgatc
      181 tggagaatga agctctaatc accaaccaaa tggagaaagg gcacagggcc ttggcattgg
      241 ccataatcaa gtacacatac caaaacaaag tggtaaaggt ccttagacca gctgaaaaag
      301 ggaaaacagt tatggacatt atttcgagac aagaccaaag ggggagcgga caagttgtca
      361 cttacgctct taacacattt accaacctag tggtgcaact cattcggaat atggaggctg
      421 aggaagttct agagatgcaa gacttgtggc tgctgcggag gtcagagaaa gtgaccaact
      481 ggttgcagag caacggatgg gataggctca aacgaatggc agtcagtgga gatgattgcg
      541 ttgtgaagcc aattgatgat aggtttgcac atgccctcag gttcttgaat gatatgggaa
      601 aagttaggaa ggacacacaa gagtggaaac cctcaactgg atgggacaac tgggaagaag
      661 ttccgttttg ctcccacca

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1254	1254	100%	0.0	100%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1254	1254	100%	0.0	100%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1249	1249	100%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1249	1249	100%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1249	1249	100%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1249	1249	100%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1245	1245	100%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1243	1243	100%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1243	1243	100%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1243	1243	100%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1243	1243	100%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1243	1243	100%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1243	1243	100%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1243	1243	100%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1240	1240	100%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1240	1240	100%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1240	1240	100%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1238	1238	100%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1238	1238	100%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1238	1238	100%	0.0	99%	KM078929.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1227	1227	100%	0.0	99%	KF993678.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1225	1225	98%	0.0	99%	KJ873160.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1188	1188	100%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1182	1182	100%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1144	1144	91%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1044	1044	99%	0.0	95%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	929	929	76%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	902	902	76%	0.0	98%	KM851038.1

[niman]

LOCUS       KU232293                 679 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232293
VERSION     KU232293.1  GI:987894985
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 679)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 679)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..679
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="057ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>679
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17078.1"
                     /db_xref="GI:987894986"
                     /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA
                     DDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTV
                     MDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWL
                     QSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEE
                     VPFCSHH"
ORIGIN      
        1 cccttggatt cttgaacgag gatcactgga tggggagaga gaactcagga ggtggtgttg
       61 aagggctggg attacaaaga ctcggatatg tcctagaaga gatgagtcgc ataccaggag
      121 gaaggatgta tgcagatgac actgctggct gggacacccg catcagcagg tttgatctgg
      181 agaatgaagc cctaatcacc aaccaaatgg agaaagggca cagggccttg gcattggcca
      241 taatcaagta cacataccaa aacaaagtgg taaaggtcct tagaccagct gaaaaaggga
      301 aaacagttat ggacattatt tcgagacaag accaaagggg gagcggacaa gttgtcactt
      361 acgctcttaa cacatttacc aacctagtgg tgcaactcat tcggaatatg gaggctgagg
      421 aagttctaga gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg accaactggt
      481 tgcagagcaa cggatgggat aggctcaaac gaatggcagt cagtggagat gattgcgttg
      541 tgaagccaat tgatgatagg tttgcacatg ccctcaggtt cttgaatgat atgggaaaag
      601 ttaggaagga cacacaagag tggaaaccct caactggatg ggacaactgg gaagaagttc
      661 cgttttgctc ccaccattt

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1243	1243	99%	0.0	99%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1243	1243	99%	0.0	99%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1238	1238	99%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1238	1238	99%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1238	1238	99%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1238	1238	99%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1234	1234	99%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1232	1232	99%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1232	1232	99%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1232	1232	99%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1232	1232	99%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1232	1232	99%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1232	1232	99%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1232	1232	99%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1229	1229	99%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1229	1229	99%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1229	1229	99%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1227	1227	99%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1227	1227	99%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1227	1227	99%	0.0	99%	KM078929.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1219	1219	98%	0.0	99%	KJ873160.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1216	1216	99%	0.0	99%	KF993678.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1177	1177	99%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1171	1171	99%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1138	1138	91%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1033	1033	99%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	924	924	76%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	896	896	76%	0.0	98%	KM851038.

[niman]

LOCUS       KU232292                 682 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232292
VERSION     KU232292.1  GI:987894983
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 682)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 682)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..682
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="054ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>682
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17077.1"
                     /db_xref="GI:987894984"
                     /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM
                     YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK
                     TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN
                     WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW
                     EEVPFCSH"
ORIGIN      
        1 ttgaagccct tggattcttg aacgaggatc actggatggg gagagagaac tcaggaggtg
       61 gtgttgaagg gctgggatta caaagactcg gatatgtcct agaagagatg agtcgcatac
      121 caggaggaag gatgtatgca gatgacactg ctggctggga cacccgcatc agcaggtttg
      181 atctggagaa tgaagctcta atcaccaacc aaatggagaa agggcacagg gccttggcat
      241 tggccataat caagtacaca taccaaaaca aagtggtaaa ggtccttaga ccagctgaaa
      301 aagggaaaac agttatggac attatttcga gacaagacca aagggggagc ggacaagttg
      361 tcacttacgc tcttaacaca tttaccaacc tagtggtgca actcattcgg aatatggagg
      421 ctgaggaagt tctagagatg caagacttgt ggctgctgcg gaggtcagag aaagtgacca
      481 actggttgca gagcaacgga tgggataggc tcaaacgaat ggcagtcagt ggagatgatt
      541 gcgtcgtgaa gccaattgat gataggtttg cacatgccct caggttcttg aatgatatgg
      601 gaaaagttag gaaggacaca caagagtgga aaccctcaac tggatgggac aactgggaag
      661 aagttccgtt ttgctcccac ca

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1251	1251	99%	0.0	99%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1251	1251	99%	0.0	99%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1245	1245	99%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1245	1245	99%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1245	1245	99%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1245	1245	99%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1242	1242	99%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1240	1240	99%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1240	1240	99%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1240	1240	99%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1240	1240	99%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1240	1240	99%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1240	1240	99%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1240	1240	99%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1236	1236	99%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1236	1236	99%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1236	1236	99%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1234	1234	99%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1234	1234	99%	0.0	99%	KM078929.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1223	1223	99%	0.0	99%	KF993678.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1219	1219	97%	0.0	99%	KJ873160.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1184	1184	99%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1179	1179	99%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1138	1138	91%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1044	1044	99%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	924	924	75%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	896	896	75%	0.0	98%	KM851038.1

[niman]

Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds

GenBank: KU232291.1

FASTA Graphics

Go to:

LOCUS       KU232291                 667 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232291
VERSION     KU232291.1  GI:987894981
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 667)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 667)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..667
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="051ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>667
                     /codon_start=1
                     /product="NS5 protein"
                     /protein_id="AME17076.1"
                     /db_xref="GI:987894982"
                     /translation="FLNEDHWMGRENSGGGVEGLGLQKLGYVLEEMSRIPGGRMYADD
                     TAGWDTRISRFDLENEALVTNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMD
                     IISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQS
                     NGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVP
                     FCSH"
ORIGIN      
        1 ttcttgaacg aggatcactg gatgggaaga gagaactcag gaggtggtgt tgaagggctg
       61 ggattacaaa aactcggata tgtcctagaa gagatgagtc gcataccagg aggaaggatg
      121 tatgcagatg acactgctgg ctgggacacc cgcatcagca ggtttgatct ggagaatgaa
      181 gctctagtca ccaaccaaat ggagaaaggg cacagggcct tggcattggc cataatcaag
      241 tacacatacc aaaacaaagt ggtaaaggtc cttagaccag ctgaaaaagg gaaaacagtt
      301 atggacatta tttcgagaca agaccaaagg gggagcggac aagttgtcac ttacgctctt
      361 aacacattta ccaacctagt ggtgcaactc attcggaata tggaggctga ggaagttcta
      421 gagatgcaag acttgtggct gctgcggagg tcagagaaag tgaccaactg gttgcagagc
      481 aacggatggg ataggctcaa acgaatggca gtcagtggag atgattgcgt tgtgaagcca
      541 attgatgata ggtttgcaca tgccctcagg ttcttgaatg atatgggaaa agttaggaag
      601 gacacacaag agtggaaacc ctcaactgga tgggacaact gggaagaagt tccgttttgc
      661 tcccacc

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1216	1216	100%	0.0	99%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1216	1216	100%	0.0	99%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1210	1210	100%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1210	1210	100%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1210	1210	100%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1210	1210	100%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1206	1206	100%	0.0	99%	KM078961.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1206	1206	99%	0.0	99%	KJ873160.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1205	1205	100%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1205	1205	100%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1205	1205	100%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1205	1205	100%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1205	1205	100%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1205	1205	100%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1205	1205	100%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1201	1201	100%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1201	1201	100%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1201	1201	100%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1199	1199	100%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1199	1199	100%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1199	1199	100%	0.0	99%	KM078929.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1188	1188	100%	0.0	99%	KF993678.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1149	1149	100%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1144	1144	100%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1131	1131	93%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1007	1007	99%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	922	922	77%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	894	894	77%	0.0	98%	KM851038.1

[niman]

LOCUS       KU232290                 688 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232290
VERSION     KU232290.1  GI:987894979
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 688)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 688)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..688
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="036ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>688
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17075.1"
                     /db_xref="GI:987894980"
                     /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA
                     DDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTV
                     MDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWL
                     QSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEE
                     VPFCSHHFNK"
ORIGIN      
        1 cccttggatt cttgaacgag gatcactgga tggggagaga gaactcagga ggtggtgttg
       61 aagggctggg attacaaaga ctcggatatg tcctagaaga gatgagtcgc ataccaggag
      121 gaaggatgta tgcagatgac actgctggct gggacacccg catcagcagg tttgatctgg
      181 agaatgaagc tctaatcacc aaccaaatgg agaaagggca cagggccttg gcattggcca
      241 taatcaagta cacataccaa aacaaagtgg taaaggtcct tagaccagct gaaaaaggga
      301 aaacagttat ggacattatt tcgagacaag accaaagggg gagcggacaa gttgtcactt
      361 acgctcttaa cacatttacc aacctagtgg tgcaactcat tcggaatatg gaggctgagg
      421 aagttctaga gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg accaactggt
      481 tgcagagcaa cggatgggat aggctcaaac gaatggcagt cagtggagat gattgcgttg
      541 tgaagccaat tgatgatagg tttgcacatg ccctcaggtt cttgaatgat atgggaaaag
      601 ttaggaagga cacacaagag tggaaaccct caactggatg ggacaactgg gaagaagttc
      661 cgttttgctc ccaccatttc aacaagca

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1264	1264	99%	0.0	99%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1264	1264	99%	0.0	99%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1258	1258	99%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1258	1258	99%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1258	1258	99%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1258	1258	99%	0.0	99%	KJ776791.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1254	1254	99%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1253	1253	99%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1253	1253	99%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1253	1253	99%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1253	1253	99%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1253	1253	99%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1253	1253	99%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1253	1253	99%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1249	1249	99%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1249	1249	99%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1249	1249	99%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1247	1247	99%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1247	1247	99%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1247	1247	99%	0.0	99%	KM078929.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1240	1240	98%	0.0	99%	KJ873160.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1236	1236	99%	0.0	99%	KF993678.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1197	1197	99%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1192	1192	99%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1158	1158	92%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1053	1053	99%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	944	944	76%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	913	913	76%	0.0	98%	KM851038.1