May 2015 Zika Partial Sequence From Brazil

[niman]

LOCUS       KU232289                 663 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232289
VERSION     KU232289.1  GI:987894977
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 663)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 663)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..663
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="020ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>663
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17074.1"
                     /db_xref="GI:987894978"
                     /translation="LNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDT
                     AGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDI
                     ISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSN
                     GWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPF
                     CS"
ORIGIN      
        1 tcttgaacga ggatcactgg atggggagag agaactcagg aggtggtgtt gaagggctgg
       61 gattacaaag actcggatat gtcctagaag agatgagtcg cataccagga ggaaggatgt
      121 atgcagatga cactgctggc tgggacaccc gcatcagcag gtttgatctg gagaatgaag
      181 ctctaatcac caaccaaatg gagaaagggc acagggcctt ggcattggcc ataatcaagt
      241 acacatacca aaacaaagtg gtaaaggtcc ttagaccagc tgaaaaaggg aaaacagtta
      301 tggacattat ttcgagacaa gaccaaaggg ggagcggaca agttgtcact tacgctctta
      361 acacatttac caacctagtg gtgcaactca ttcggaatat ggaggctgag gaagttctag
      421 agatgcaaga cttgtggctg ctgcggaggt cagagaaagt gaccaactgg ttgcagagca
      481 acggatggga taggctcaaa cgaatggcag tcagtggaga tgattgcgtt gtgaagccaa
      541 ttgatgatag gtttgcacat gccctcaggt tcttgaatga tatgggaaaa gttaggaagg
      601 acacacaaga gtggaaaccc tcaactggat gggacaactg ggaagaagtt ccgttttgct
      661 ccc

http://www.ncbi.nlm.nih.gov/nuccore/KU232289.1

 

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1225	1225	100%	0.0	100%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1225	1225	100%	0.0	100%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1219	1219	100%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1219	1219	100%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1219	1219	100%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1219	1219	100%	0.0	99%	KJ776791.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1218	1218	99%	0.0	99%	KJ873160.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1216	1216	100%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1214	1214	100%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1214	1214	100%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1214	1214	100%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1214	1214	100%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1214	1214	100%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1214	1214	100%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1214	1214	100%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1210	1210	100%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1210	1210	100%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1210	1210	100%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1208	1208	100%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1208	1208	100%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1208	1208	100%	0.0	99%	KM078929.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1197	1197	100%	0.0	99%	KF993678.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1158	1158	100%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1153	1153	100%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1136	1136	93%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1020	1020	100%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	922	922	77%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	894	894	77%	0.0	98%	KM851038.1

[niman]

LOCUS       KU232288                 665 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232288
VERSION     KU232288.1  GI:987894975
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 665)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 665)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..665
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="001ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>665
                     /codon_start=3
                     /product="NS5 protein"
                     /protein_id="AME17073.1"
                     /db_xref="GI:987894976"
                     /translation="LNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDT
                     AGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDI
                     ISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSN
                     GWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPF
                     CSH"
ORIGIN      
        1 tcttgaacga ggatcactgg atggggagag agaactcagg aggtggtgtt gaagggctgg
       61 gattacaaag actcggatat gtcctagaag agatgagtcg cataccagga ggaaggatgt
      121 atgcagatga cactgctggc tgggacaccc gcatcagcag gtttgatctg gagaatgaag
      181 ctctaatcac caaccaaatg gagaaagggc acagggcctt ggcattggcc ataatcaagt
      241 acacatacca aaacaaagtg gtaaaggtcc ttagaccagc tgaaaaaggg aaaacagtta
      301 tggacattat ttcgagacaa gaccaaaggg ggagcggaca agttgtcact tacgctctta
      361 acacatttac caacctagtg gtgcaactca ttcggaatat ggaggctgag gaagttctag
      421 agatgcaaga cttgtggctg ctgcggaggt cagagaaagt gaccaactgg ttgcagagca
      481 acggatggga taggctcaaa cgaatggcag tcagtggaga tgattgcgtt gtgaagccaa
      541 ttgatgatag gtttgcacat gccctcaggt tcttgaatga tatgggaaaa gttaggaagg
      601 acacacaaga gtggaaaccc tcaactggat gggacaactg ggaagaagtt ccgttttgct
      661 cccac

http://www.ncbi.nlm.nih.gov/nuccore/KU232288.1

 

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU556802.1|	Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds	1229	1229	100%	0.0	100%	KU556802.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	1229	1229	100%	0.0	100%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	1223	1223	100%	0.0	99%	KU509998.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	1223	1223	100%	0.0	99%	KU321639.1
Select seq gb|KM078936.1|	Zika virus strain CHI1410214 NS5 protein gene, partial cds	1223	1223	100%	0.0	99%	KM078936.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	1223	1223	100%	0.0	99%	KJ776791.1
Select seq gb|KJ873160.1|	Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds	1221	1221	99%	0.0	99%	KJ873160.1
Select seq gb|KM078961.1|	Zika virus strain CHI2612114 NS5 protein gene, partial cds	1219	1219	100%	0.0	99%	KM078961.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	1218	1218	100%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	1218	1218	100%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	1218	1218	100%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	1218	1218	100%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	1218	1218	100%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	1218	1218	100%	0.0	99%	KU365777.1
Select seq gb|KM078930.1|	Zika virus strain CHI2283714 NS5 protein gene, partial cds	1218	1218	100%	0.0	99%	KM078930.1
Select seq gb|KM078971.1|	Zika virus strain CHI2613014 NS5 protein gene, partial cds	1214	1214	100%	0.0	99%	KM078971.1
Select seq gb|KM078970.1|	Zika virus strain CHI2490414 NS5 protein gene, partial cds	1214	1214	100%	0.0	99%	KM078970.1
Select seq gb|KM078933.1|	Zika virus strain CHI1058514 NS5 protein gene, partial cds	1214	1214	100%	0.0	99%	KM078933.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	1212	1212	100%	0.0	99%	KU365778.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	1212	1212	100%	0.0	99%	KU312312.1
Select seq gb|KM078929.1|	Zika virus strain CHI1805214 NS5 protein gene, partial cds	1212	1212	100%	0.0	99%	KM078929.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	1201	1201	100%	0.0	99%	KF993678.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	1162	1162	100%	0.0	98%	JN860885.1
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	1157	1157	100%	0.0	98%	EU545988.1
Select seq gb|KJ873161.1|	Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds	1140	1140	93%	0.0	99%	KJ873161.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	1022	1022	99%	0.0	94%	HQ234499.1
Select seq gb|KM851039.1|	Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds	926	926	77%	0.0	99%	KM851039.1
Select seq gb|KM851038.1|	Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds	898	898	77%	0.0	98%	KM851038.1