niman Posted February 17, 2016 Report Posted February 17, 2016 (edited) LOCUS KM014700 281 bp RNA linear VRL 06-FEB-2015 DEFINITION Zika virus polyprotein gene, partial cds. ACCESSION KM014700 VERSION KM014700.1 GI:734568018 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 281) AUTHORS Musso,D., Roche,C., Robin,E., Nhan,T., Teissier,A. and Cao-Lormeau,V.M. TITLE Potential sexual transmission of zika virus JOURNAL Emerging Infect. Dis. 21 (2), 359-361 (2015) PUBMED 25625872 REFERENCE 2 (bases 1 to 281) AUTHORS Roche,C. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) PMIE, Institut Louis Malarde, BP 30, Papeete, Tahiti 98713, French Polynesia FEATURES Location/Qualifiers source 1..281 /organism="Zika virus" /mol_type="genomic RNA" /isolate="PF14-280114-118sp" /isolation_source="sperm" /host="Homo sapiens" /db_xref="taxon:64320" /country="French Polynesia" /collection_date="28-Jan-2014"http://www.ncbi.nlm.nih.gov/nuccore/KM014700.1 Edited February 17, 2016 by niman
niman Posted February 17, 2016 Author Report Posted February 17, 2016 LOCUS KM014700 281 bp RNA linear VRL 06-FEB-2015 DEFINITION Zika virus polyprotein gene, partial cds. ACCESSION KM014700 VERSION KM014700.1 GI:734568018 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 281) AUTHORS Musso,D., Roche,C., Robin,E., Nhan,T., Teissier,A. and Cao-Lormeau,V.M. TITLE Potential sexual transmission of zika virus JOURNAL Emerging Infect. Dis. 21 (2), 359-361 (2015) PUBMED 25625872 REFERENCE 2 (bases 1 to 281) AUTHORS Roche,C. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) PMIE, Institut Louis Malarde, BP 30, Papeete, Tahiti 98713, French Polynesia FEATURES Location/Qualifiers source 1..281 /organism="Zika virus" /mol_type="genomic RNA" /isolate="PF14-280114-118sp" /isolation_source="sperm" /host="Homo sapiens" /db_xref="taxon:64320" /country="French Polynesia" /collection_date="28-Jan-2014" CDS <1..>281 /codon_start=2 /product="polyprotein" /protein_id="AJA06126.1" /db_xref="GI:734568019" /translation="PAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPT VDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQ" ORIGIN 1 cccggcatac agcatcaggt gcataggagt cagcaatagg gactttgtgg aaggtatgtc 61 aggtgggact tgggttgatg ttgtcttgga acatggaggt tgtgtcaccg taatggcaca 121 ggacaaaccg actgtcgaca tagagctggt tacaacaaca gtcagcaaca tggcggaggt 181 aagatcctac tgctatgagg catcaatatc agacatggct tcggacagcc gctgcccaac 241 acaaggtgaa gcctaccttg acaagcaatc agacactcaa t
niman Posted February 17, 2016 Author Report Posted February 17, 2016 Map updatehttps://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
niman Posted February 17, 2016 Author Report Posted February 17, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds508508100%3e-140100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome508508100%3e-140100%KU509998.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds508508100%3e-140100%KU365778.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds508508100%3e-140100%KU312315.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds508508100%3e-140100%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds508508100%3e-140100%KU312313.1Select seq gb|KM212966.1|Zika virus isolate NC13(FP)-26112013-22072 glycoprotein gene, partial cds508508100%3e-140100%KM212966.1Select seq gb|KJ579441.1|Zika virus isolate PF13-CP221013c polyprotein gene, partial cds508508100%3e-140100%KJ579441.1Select seq dbj|AB908162.1|Zika virus gene for polyprotein, partial cds, strain: ZIKV Hu/Tahiti/01u/2014NIID508508100%3e-140100%AB908162.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds502502100%1e-13899%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds502502100%1e-13899%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome502502100%1e-13899%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds502502100%1e-13899%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds502502100%1e-13899%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds502502100%1e-13899%KU365777.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds502502100%1e-13899%KU312312.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome502502100%1e-13899%KU321639.1Select seq gb|KM212965.1|Zika virus isolate NC13(FP)-20112013-22015 glycoprotein gene, partial cds502502100%1e-13899%KM212965.1Select seq gb|KM212964.1|Zika virus isolate NC14-17042014-4554 glycoprotein gene, partial cds502502100%1e-13899%KM212964.1Select seq gb|KM212963.1|Zika virus isolate NC14-23012014-250 glycoprotein gene, partial cds502502100%1e-13899%KM212963.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds502502100%1e-13899%KJ776791.1Select seq gb|KJ680134.1|Zika virus strain PF13-091213-121 polyprotein gene, partial cds502502100%1e-13899%KJ680134.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds499499100%2e-13799%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds49149199%2e-13599%KF993678.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds48448495%4e-133100%KU646828.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds484484100%4e-13398%EU545988.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds47947995%2e-13199%KU646827.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds47947995%2e-13199%KJ634273.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds439439100%1e-11995%HQ234499.1
niman Posted February 17, 2016 Author Report Posted February 17, 2016 Volume 21, Number 2—February 2015DispatchPotential Sexual Transmission of Zika VirusOn This PageThe StudyConclusionsSuggested CitationDownloadsPDF[1.05 MB - 3 pgs]RIS[TXT - 2 KB]AltmetricDidier Musso , Claudine Roche, Emilie Robin, Tuxuan Nhan, Anita Teissier, and Van-Mai Cao-LormeauAuthor affiliations: Institut Louis Malardé, Papeete, Tahiti, French Polynesia http://wwwnc.cdc.gov/eid/article/21/2/14-1363_article
niman Posted February 17, 2016 Author Report Posted February 17, 2016 AbstractIn December 2013, during a Zika virus (ZIKV) outbreak in French Polynesia, a patient in Tahiti sought treatment for hematospermia, and ZIKV was isolated from his semen. ZIKV transmission by sexual intercourse has been previously suspected. This observation supports the possibility that ZIKV could be transmitted sexually.
niman Posted February 17, 2016 Author Report Posted February 17, 2016 Zika virus (ZIKV) is a mosquitoborne arbovirus in the family Flaviviridae, genus Flavivirus. It was first isolated in 1947 from a rhesus monkey in the Zika forest of Uganda (1). Sporadic human cases were reported from the 1960s in Asia and Africa. The first reported large outbreak occurred in 2007 on Yap Island, Federated States of Micronesia (2). The largest known ZIKV outbreak reported started in October 2013 in French Polynesia, South Pacific (3), a territory of France comprising 67 inhabited islands; an estimated 28,000 persons (11% of the population) sought medical care for the illness (4). The most common symptoms of Zika fever are rash, fever, arthralgia, and conjunctivitis. Most of the patients had mild disease, but severe neurologic complications have been described in other patients in French Polynesia (5).
niman Posted February 17, 2016 Author Report Posted February 17, 2016 The StudyIn early December 2013, during the ZIKV outbreak, a 44-year-old man in Tahiti had symptoms of ZIKV infection: asthenia, low grade fever (temperature from 37.5°C to 38°C) and arthralgia. Symptoms lasted 3 days. Eight weeks later, he described a second episode of symptoms compatible with ZIKV infection: temperature from 37.5°C to 38°C, headache on days 1–3, and wrist arthralgia on days 5–7. The patient did not seek treatment, thus biological samples were not collected during the first 2 periods of illness. The patient fully recovered from the second episode, but 2 weeks later he noted signs of hematospermia and sought treatment. Because the patient had experienced symptoms of ZIKV infection some weeks before, he was referred to our laboratory in the Institut Louis Malardé, Papeete, Tahiti for ZIKV infection diagnostic testing. The medical questionnaire revealed no signs of urinary tract infection, prostatitis, urethritis, or cystitis, and the patient stated that he did not had any recent physical contact with persons who had acute ZIKV infection. We collected blood and semen samples. Direct and macroscopic examinations of the semen confirmed hematospermia. We extracted RNA using the NucliSENS easyMAG system (bioMérieux, Marcy l’Etoile, France) from 200 μL of blood and from 500 μL of semen and urine; both were eluted by 50 μL of elution buffer. We used 5 μL of RNA extracted for amplification. We tested blood and semen RNA extracts using real-time reverse transcription PCR (rRT-PCR) as described using 2 primers/probe amplification sets specific for ZIKV (3). The rRT-PCR results were positive for ZIKV in semen and negative in blood, and confirmed by sequencing of the genomic position 858–1138 encompassing the prM/E protein coding regions of ZIKV. The generated sequence (GenBank accession no. KM014700) was identical to those previously reported at the beginning of the ZIKV outbreak (3). Three days later, we collected a urine sample, then a second set of blood and semen samples. Semen and urine from this second collection were not found to contain traces of blood by both direct and macroscopic examinations. rRT-PCR detected ZIKV RNA in the semen and urine, but not in the blood sample.We quantified ZIKV RNA loads using an RNA synthetic transcript standard that covers the region targeted by the 2 primers/probe sets. RNA loads were: 2.9 × 107 copies/mL and 1.1 × 107 copies/mL in the first and second semen samples, respectively, and 3.8 × 103 copies/mL in the urine sample.We cultured semen and urine as described for dengue virus cultured from urine (6). Briefly, 200 μL of each sample diluted in 200 μL of 1% fetal calf serum (FCS) minimum essential medium (MEM) were inoculated onto Vero cells and incubated for 1 h at 37°C; inoculum was then removed and replaced by 1 mL of culture medium. We also inoculated a negative control (200 μL of 1% FCS-MEM) and a positive control (5 μL of a ZIKV-positive serum diluted in 200 μL of 1% FCS-MEM). The cells were then incubated at 37°C in 5% CO2 for 6 days. The presence of ZIKV in the culture fluids was detected by rRT-PCR as described.Replicative ZIKV particles were found in the 2 semen samples but none were detected in the urine sample. This finding does not exclude the possibility that ZIKV particles were present in urine. Positive samples were not titered.
niman Posted February 17, 2016 Author Report Posted February 17, 2016 ConclusionsThe ZIKV natural transmission cycle involves mosquitoes, especially Aedes spp. (7), but perinatal transmission (8) and potential risk for transfusion-transmitted ZIKV infections has also been demonstrated (9). Moreover, ZIKV transmission by sexual intercourse has been suggested by Foy et al. (10), who described a patient who was infected with ZIKV in southeastern Senegal in 2008. After returning to his home in Colorado, United States, he experienced common symptoms of ZIKV infection and symptoms of prostatitis. Four days later, he observed signs of hematospermia, and on the same day, his wife had symptoms of ZIKV infection. Because the wife of the patient had not traveled out of the United States during the previous year and had sexual intercourse with him 1 day after he returned home, transmission by semen was suggested. ZIKV infection of the patient and his wife was confirmed by serologic testing, but the presence of ZIKV in the semen of the patient was not investigated.Infectious organisms, especially sexually transmitted microorganisms including viruses (human papillomavirus or herpes simplex virus), are known to be etiologic agents of hematospermia (11). To our knowledge, before the report of Foy et al. (10) and this study, arbovirus infections in humans had not been reported to be associated with hematospermia, and no arboviruses had been isolated from human semen.We detected a high ZIKV RNA load and replicative ZIKV in semen samples, but ZIKV remained undetectable by rRT-PCR in the blood sample collected at the same time. These results suggest that viral replication may have occurred in the genital tract, but we do not know when this replication started and how long it lasted. The fact that the patient had no common symptoms of ZIKV acute infection concomitantly to hematospermia suggests that the viremic phase occurred upstream, probably during the first or second episode of mild fever, headache, and arthralgia.The detection of ZIKV in both urine and semen is consistent with the results obtained in a study of effects of Japanese encephalitis virus, another flavivirus, on boars. The virus was isolated from urine and semen of experimentally infected animals, and viremia developed in female boars that artificially inseminated with the infectious semen (12).Flaviviruses have also been detected in urine of persons infected with West Nile virus (WNV). WNV RNA was detected in urine for a longer time and with higher RNA load than in plasma (13). WNV antigens were detected in renal tubular epithelial cells, vascular endothelial cells, and macrophages of kidneys from infected hamsters (14), suggesting that persistent shedding of WNV in urine was caused by viral replication in renal tissue. Dengue virus (DENV) RNA and DENV nonstructural protein 1 antigen were also detected in urine samples for a longer time than in blood, but infectious DENV has not been isolated in culture. Hirayama et al. concluded that the detection of DENV by rRT-PCR was useful to confirm DENV infections after the viremic phase (6). Also, yellow fever virus RNA was isolated from the urine of vaccinated persons (15), and Saint Louis encephalitis viral antigens, but not infective virus, have been detected in urine samples from infected patients (10).Our findings support the hypothesis that ZIKV can be transmitted by sexual intercourse. Furthermore, the observation that ZIKV RNA was detectable in urine after viremia clearance in blood suggests that, as found for DENV and WNV infections, urine samples can yield evidence ofZIKV for late diagnosis, but more investigation is needed.Dr. Musso is a medical doctor and director of the Diagnosis Medical Laboratory and the Unit of Emerging Infectious Diseases of the Institut Louis Malardé, Papeete, Tahiti, French Polynesia. His research programs target endemic infectious diseases, especially arbovirus infections, leptospirosis, tuberculosis, and lymphatic filariasis. AcknowledgmentWe obtained written informed consent from the patient for publication of this report, and publication of data related to ZIKV infections have been approved by the Ethics Committee of French Polynesia under reference 66/CEPF.
niman Posted February 17, 2016 Author Report Posted February 17, 2016 ReferencesDick GWA, Kitchen SF, Haddow AJ. Zika virus. I. Isolations and serological specificity. Trans R Soc Trop Med Hyg.1952;46:509–20 . DOIDuffy MR, Chen TH, Hancock WT, Powers AM, Kool JL, Lanciotti RS, Zika virus outbreak on Yap Island, Federated States of Micronesia. N Engl J Med. 2009;360:2536–43 . DOIPubMedCao-Lormeau VM, Roche C, Teissier A, Robin E, Berry ALT, Mallet HP, Zika virus, French Polynesia, South Pacific, 2013. Emerg Infect Dis. 2014;20:1085–6 . DOIMusso D, Nilles EJ, Cao-Lormeau VM. Rapid spread of emerging Zika virus in the Pacific area. Clin Micobiol Infect.2014; .DOIOehler E, Watrin L, Larre P, Leparc-Goffart I, Lastere S, Valour F, Zika virus infection complicated by Guillain-Barre syndrome–case report, French Polynesia, December 2013. Euro Surveill. 2014;19:7–9 .PubMedHirayama T, Mizuno Y, Takeshita N, Kotaki A, Tajima S, Omatsu T, Detection of dengue virus genome in urine by real-time reverse transcriptase PCR: a laboratory diagnostic method useful after disappearance of the genome in serum. J Clin Microbiol. 2012;50:2047–52 and. DOIPubMedHayes EB. Zika virus outside Africa. Emerg Infect Dis. 2009;15:1347–50 . DOIPubMedBesnard M, Lastère S, Teissier A, Cao-Lormeau VM, Musso D. Evidence of perinatal transmission of Zika virus, French Polynesia, December 2013 and February. Euro Surveill. 2014;19:20751[cited 2014 Dec 17].http://www.eurosurveillance.org/ViewArticle.aspx?ArticleId=20751PubMedMusso D, Nhan T, Robin E, Roche C, Bierlaire D, Zizou K, Potential for Zika virus transmission through blood transfusion demonstrated during an outbreak in French Polynesia, November 2013 to February 2014. Euro Surveill.2014;19:20771 .PubMedFoy BD, Kobylinski KC, Chilson Foy JL, Blitvich BJ, Travassos da Rosa A, Haddow AD, Probable non-vector-borne transmission of Zika virus, Colorado, USA. Emerg Infect Dis. 2011;17:880–2 . DOIPubMedStefanovic KB, Gregg PC, Soung M. Evaluation and treatment of hematospermia. Am Fam Physician. 2009;80:1421–7.PubMedHabu A, Murakami Y, Ogasa A, Fujisaki Y. Disorder of spermatogenesis and viral discharge into semen in boars infected with Japanese encephalitis virus. Uirusu. 1977;27:21–6 . DOIPubMedBarzon L, Pacenti M, Franchin E, Pagni S, Martello T, Cattai M, Excretion of West Nile virus in urine during acute infection. J Infect Dis. 2013;208:1086–92 . DOIPubMedTonry JH, Xiao SY, Siirin M, Chen H, da Rosa AP, Tesh RB, Persistent shedding of West Nile virus in urine of experimentally infected hamsters. Am J Trop Med Hyg. 2005;72:320–4 .PubMedDomingo C, Yactayo S, Agbenu E, Demanou M, Schulz AR, Daskalow K, Detection of yellow fever 17D genome in urine. J Clin Microbiol. 2011;49:760–2 . DOIPubMedSuggested citation for this article: Musso D, Roche C, Robin E, Nhan T, Teissier A, Cao-Lormeau VM. Potential sexual transmission of Zika virus. Emerg Infect Dis. 2015 Feb [date cited]. http://dx.doi.org/10.3201/eid2102.141363DOI: 10.3201/eid2102.141363
niman Posted February 28, 2016 Author Report Posted February 28, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds508508100%3e-140100%KU740184.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome508508100%3e-140100%KU527068.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds508508100%3e-140100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome508508100%3e-140100%KU509998.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds508508100%3e-140100%KU365778.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds508508100%3e-140100%KU312315.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds508508100%3e-140100%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds508508100%3e-140100%KU312313.1Select seq gb|KM212966.1|Zika virus isolate NC13(FP)-26112013-22072 glycoprotein gene, partial cds508508100%3e-140100%KM212966.1Select seq gb|KJ579441.1|Zika virus isolate PF13-CP221013c polyprotein gene, partial cds508508100%3e-140100%KJ579441.1Select seq dbj|AB908162.1|Zika virus gene for polyprotein, partial cds, strain: ZIKV Hu/Tahiti/01u/2014NIID508508100%3e-140100%AB908162.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome502502100%1e-13899%KU744693.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome502502100%1e-13899%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome502502100%1e-13899%KU707826.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds502502100%1e-13899%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds502502100%1e-13899%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome502502100%1e-13899%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds502502100%1e-13899%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds502502100%1e-13899%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds502502100%1e-13899%KU365777.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds502502100%1e-13899%KU312312.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome502502100%1e-13899%KU321639.1Select seq gb|KM212965.1|Zika virus isolate NC13(FP)-20112013-22015 glycoprotein gene, partial cds502502100%1e-13899%KM212965.1Select seq gb|KM212964.1|Zika virus isolate NC14-17042014-4554 glycoprotein gene, partial cds502502100%1e-13899%KM212964.1Select seq gb|KM212963.1|Zika virus isolate NC14-23012014-250 glycoprotein gene, partial cds502502100%1e-13899%KM212963.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds502502100%1e-13899%KJ776791.1Select seq gb|KJ680134.1|Zika virus strain PF13-091213-121 polyprotein gene, partial cds502502100%1e-13899%KJ680134.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome499499100%2e-13799%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds499499100%2e-13799%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds49149199%2e-13599%KF993678.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome484484100%4e-13398%KU681082.3Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds48448495%4e-133100%KU646828.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds484484100%4e-13398%EU545988.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds480480100%4e-13298%KU686218.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds47947995%2e-13199%KU646827.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds47947995%2e-13199%KJ634273.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds439439100%1e-11995%HQ234499.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds417417100%4e-11393%KF268949.1Select seq gb|KT381874.1|Zika virus strain Zika1697_BR-RJ/2015 envelope protein gene, partial cds41641684%2e-11299%KT381874.1
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now