niman Posted February 19, 2016 Report Share Posted February 19, 2016 LOCUS KU179098 1148 bp RNA linear VRL 19-FEB-2016 DEFINITION Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds. ACCESSION KU179098 VERSION KU179098.1 GI:998491569 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 1148) AUTHORS Perkasa,A., Yudaputri,F., Haryanto,S., Hayati,R.F., Ma'roef,C.N., Antonjaya,U., Yohan,B., Myint,K.S.A., Ledderman,J.P., Rosenberg,R., Powers,A.M. and Sasmono,R.T. TITLE Isolation of Zika virus from febrile patient, Indonesia JOURNAL Emerging Infect. Dis. 22 (5) (2016) In press REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 1148) AUTHORS Perkasa,A., Yudaputri,F., Haryanto,S., Hayati,R.F., Ma'roef,C.N., Antonjaya,U., Yohan,B., Myint,K.S.A., Ledderman,J.P., Rosenberg,R., Powers,A.M. and Sasmono,R.T. TITLE Direct Submission JOURNAL Submitted (20-NOV-2015) Dengue Unit, Eijkman Institute for Molecular Biology, Jl. Diponegoro 69, Jakarta 10430, Indonesia COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1148 /organism="Zika virus" /mol_type="genomic RNA" /isolate="JMB-185" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Indonesia: Jambi" /collection_date="30-Dec-2014" Link to comment Share on other sites More sharing options...
niman Posted February 19, 2016 Author Report Share Posted February 19, 2016 LOCUS KU179098 1148 bp RNA linear VRL 19-FEB-2016 DEFINITION Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds. ACCESSION KU179098 VERSION KU179098.1 GI:998491569 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 1148) AUTHORS Perkasa,A., Yudaputri,F., Haryanto,S., Hayati,R.F., Ma'roef,C.N., Antonjaya,U., Yohan,B., Myint,K.S.A., Ledderman,J.P., Rosenberg,R., Powers,A.M. and Sasmono,R.T. TITLE Isolation of Zika virus from febrile patient, Indonesia JOURNAL Emerging Infect. Dis. 22 (5) (2016) In press REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 1148) AUTHORS Perkasa,A., Yudaputri,F., Haryanto,S., Hayati,R.F., Ma'roef,C.N., Antonjaya,U., Yohan,B., Myint,K.S.A., Ledderman,J.P., Rosenberg,R., Powers,A.M. and Sasmono,R.T. TITLE Direct Submission JOURNAL Submitted (20-NOV-2015) Dengue Unit, Eijkman Institute for Molecular Biology, Jl. Diponegoro 69, Jakarta 10430, Indonesia COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1148 /organism="Zika virus" /mol_type="genomic RNA" /isolate="JMB-185" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Indonesia: Jambi" /collection_date="30-Dec-2014" CDS <1..>1148 /note="NS5" /codon_start=1 /product="nonstructural protein 5" /protein_id="AMK49492.1" /db_xref="GI:998491570" /translation="GAIFEEEKEWKTAVEAVNDPRFWALVDKEREHHLRGECQSCVYN MMGKREKKQGEFGKAKGSRAIWYMWLGARFLEFEALGFLNEDHWMGRENSGGGVEGLG LQRLGYVLEEMSRIPGGRMYADDTAGWDTRISRFDLENEALITNQMEKGHRALALAII KYTYQNKVVKVLRPAEKGKTVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAE EVLEMQDLWLLRRSEKVTNWLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDM GKVRKDTQEWKPSTGWDNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDELIGRARVSP GAGWSIRETACLAKSYAQMWQLLYFHRRDLRLMANAICSSVPVDWVPTG" ORIGIN 1 ggagcaatat ttgaagagga aaaagagtgg aagactgcag tggaagctgt gaacgatcca 61 aggttctggg ctctagtgga caaggaaaga gagcaccacc tgagaggaga gtgccagagc 121 tgtgtgtaca acatgatggg aaaaagagaa aagaaacaag gggaatttgg aaaggccaag 181 ggcagccgcg ccatctggta tatgtggcta ggggctagat ttctagagtt cgaagccctt 241 ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg tgttgaaggg 301 ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc aggaggaagg 361 atgtatgcag atgatactgc tggctgggac acccgcatca gcaggtttga tctggagaat 421 gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt ggccataatc 481 aagtatacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa agggaagaca 541 gttatggaca ttatttcaag acaagaccaa agggggagcg gacaagttgt cacttacgct 601 cttaatacat ttaccaacct agtggtgcag ctcattcgga atatggaggc tgaggaagtt 661 ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa ctggttgcag 721 agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg cgttgtgaag 781 ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg aaaagttagg 841 aaggacacac aagagtggaa accctcgact ggatgggaca actgggaaga agttccgttt 901 tgctcccacc acttcaacaa gctccatctc aaggacggga ggtccattgt ggttccctgc 961 cgccaccaag atgaactgat tggccgggcc cgcgtctctc caggggcggg atggagcatc 1021 cgggagactg cttgcctagc aaaatcgtat gcgcaaatgt ggcagctcct ttatttccac 1081 agaagggacc tccgactgat ggccaatgcc atttgttcat ctgtgccagt tgactgggtt 1141 ccaactgg Link to comment Share on other sites More sharing options...
niman Posted February 19, 2016 Author Report Share Posted February 19, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds20352035100%0.099%KF993678.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome20302030100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds20302030100%0.099%KJ776791.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds20262026100%0.099%KU647676.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds20262026100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds20262026100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome20212021100%0.099%KU501215.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome20212021100%0.099%KU321639.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds20122012100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds20122012100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds20122012100%0.099%KU365777.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds20122012100%0.099%KU312312.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds20032003100%0.099%KU365778.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds19991999100%0.099%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds19841984100%0.098%EU545988.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds18191819100%0.095%HQ234499.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1710171084%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1709170984%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1707170784%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1703170384%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1703170384%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1703170384%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1701170184%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1579157977%0.099%KJ873160.1 Link to comment Share on other sites More sharing options...
niman Posted February 28, 2016 Author Report Share Posted February 28, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds20712071100%0.0100%KU179098.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds20352035100%0.099%KF993678.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome20302030100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds20302030100%0.099%KJ776791.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome20262026100%0.099%KU497555.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds20262026100%0.099%KU647676.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds20262026100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds20262026100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome20212021100%0.099%KU501215.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome20212021100%0.099%KU321639.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome20172017100%0.099%KU527068.1Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds20122012100%0.099%KU740184.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome20122012100%0.099%KU707826.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds20122012100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds20122012100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds20122012100%0.099%KU365777.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds20122012100%0.099%KU312312.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds20032003100%0.099%KU365778.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome19991999100%0.099%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds19991999100%0.099%JN860885.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome19941994100%0.099%KU744693.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds19841984100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome19631963100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds18191819100%0.095%HQ234499.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1710171084%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1709170984%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1707170784%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1703170384%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1703170384%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1703170384%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1701170184%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1579157977%0.099%KJ873160.1 Link to comment Share on other sites More sharing options...
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now